# hmmscan :: search sequence(s) against a profile HMM database
# HMMER 3.0b2 (June 2009); http://hmmer.org/
# Copyright (C) 2009 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query sequence file:             /home/niguts/usr08/shisakam/FASTA/gib_20034.fasta
# target HMM database:             /home/niguts/usr08/shisakam/PFAM/ver24.0/Pfam-A.hmm
# sequence search space set to:    100000
# set reporting thresholds to:     GA cutoffs
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       ABA57005.1  [L=56]
Description: noce0 ABA57005.1 GIB00281CH01 "Protein of unknown function DUF1328"
Scores for complete sequence (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Model    Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    4.7e-14   54.7  19.6    6.4e-14   54.2  13.6    1.2  1  PF07043  Protein of unknown function (DUF1328)
  ------ inclusion threshold ------
          2   10.5   7.3          2   10.5   5.1    1.0  1  PF06738  Protein of unknown function (DUF1212)
        2.8   11.1   4.6          3   11.0   3.2    1.0  1  PF10993  Protein of unknown function (DUF2818)
        4.1   10.2   3.0        4.4   10.1   2.0    1.1  1  PF02592  Uncharacterized ACR, YhhQ family COG1738
        5.9    9.1   2.6        6.4    9.0   1.8    1.0  1  PF02293  AmiS/UreI family transporter
          6    9.3   3.8        6.9    9.1   2.6    1.0  1  PF11292  Protein of unknown function (DUF3093)
        6.6    8.8   9.5        7.1    8.7   6.6    1.0  1  PF01925  Sulfite exporter TauE/SafE
        6.6    9.0   7.6        7.2    8.9   5.3    1.1  1  PF01124  MAPEG family
          8    7.8   4.2        8.6    7.7   2.9    1.0  1  PF00375  Sodium:dicarboxylate symporter family
        8.2    8.6   0.6        9.2    8.5   0.4    1.1  1  PF04061  ORMDL family
        9.7    7.9   2.6         10    7.8   1.8    1.1  1  PF04647  Accessory gene regulator B
        9.8    8.5   0.5         14    8.1   0.1    1.4  1  PF05393  Human adenovirus early E3A glycoprotein
         11    8.7   4.0         13    8.5   2.8    1.1  1  PF05767  Poxvirus virion envelope protein A14
         11    8.6   7.4         11    8.5   5.1    1.0  1  PF06271  RDD family
         12    8.1   7.7         12    8.0   5.3    1.0  1  PF06826  Predicted Permease Membrane Region
         12    8.1   6.8         13    8.0   4.7    1.1  1  PF07695  7TM diverse intracellular signalling
         14    8.5   7.4         16    8.2   5.1    1.1  1  PF10953  Protein of unknown function (DUF2754)
         21    7.1   2.7         28    6.7   1.9    1.3  1  PF11375  Protein of unknown function (DUF3177)
         22    7.3   9.4         25    7.1   6.5    1.1  1  PF11026  Protein of unknown function (DUF2721)
         29    6.0   6.9         36    5.7   4.8    1.2  1  PF02378  Phosphotransferase system, EIIC
         30    6.4   9.2         33    6.3   6.4    1.0  1  PF01943  Polysaccharide biosynthesis protein
         34    7.2  10.9         37    7.1   7.6    1.1  1  PF01957  NfeD-like
         38    6.0   6.9         39    5.9   4.8    1.0  1  PF07907  YibE/F-like protein
         39    6.7   8.0         47    6.5   5.6    1.1  1  PF05656  Protein of unknown function (DUF805)
         39    6.3   4.7         48    6.0   3.2    1.2  1  PF10688  Bacterial inner membrane protein
         40    6.4   1.1         51    6.0   0.8    1.1  1  PF05546  She9 / Mdm33 family
         46    6.3   3.3      1e+02    5.2   2.3    1.6  1  PF07465  Photosystem I protein M (PsaM)
         48    4.9   7.6         50    4.9   5.2    1.0  1  PF05975  Bacterial ABC transporter protein EcsB
         49    5.7   2.9         56    5.5   2.0    1.1  1  PF11368  Protein of unknown function (DUF3169)
         55    6.0   6.4         76    5.5   4.5    1.2  1  PF09605  Hypothetical bacterial integral membrane protein (T
         55    6.4   0.8         69    6.1   0.6    1.2  1  PF11169  Protein of unknown function (DUF2956)
         61    6.6   7.6         76    6.3   5.3    1.2  1  PF09990  Predicted membrane protein (DUF2231)
         61    6.5   8.8         82    6.1   6.1    1.2  1  PF09834  Predicted membrane protein (DUF2061)
         62    5.3   9.0         71    5.1   6.2    1.1  1  PF09721  Transmembrane exosortase (Exosortase_EpsH)
         66    6.1   5.8         71    6.0   4.0    1.1  1  PF04241  Protein of unknown function (DUF423)
         69    5.8  12.2         97    5.3   8.4    1.3  1  PF07332  Protein of unknown function (DUF1469)
         73    5.1   8.9         77    5.0   6.2    1.1  1  PF01040  UbiA prenyltransferase family
         84    4.6   0.6         88    4.5   0.4    1.0  1  PF00434  Glycoprotein VP7
         85    5.7  11.4    1.1e+02    5.3   7.9    1.3  1  PF11127  Protein of unknown function (DUF2892)
         86    4.8   6.7    1.2e+02    4.3   4.7    1.4  1  PF11067  Protein of unknown function (DUF2868)
         92    4.8  12.8      1e+02    4.7   8.8    1.0  1  PF03706  Uncharacterised protein family (UPF0104)
         93    4.2   1.5    1.1e+02    3.9   1.1    1.1  1  PF00955  HCO3- transporter family
         98    4.4   8.5         99    4.4   5.9    1.0  1  PF06157  Protein of unknown function (DUF973)
    1.1e+02    3.9   9.7    1.1e+02    3.8   6.7    1.0  1  PF09972  Predicted membrane protein (DUF2207)
    1.1e+02    5.1   0.2    1.5e+02    4.7   0.1    1.2  1  PF06720  Bacteriophage phi-29 early protein GP16.7
    1.1e+02    4.9  11.2    1.3e+02    4.7   7.8    1.0  1  PF04156  IncA protein
    1.3e+02    4.4   2.4    1.6e+02    4.1   1.7    1.3  1  PF04298  Putative neutral zinc metallopeptidase
    1.4e+02    3.7   7.8    1.6e+02    3.5   5.4    1.1  1  PF03739  Predicted permease YjgP/YjgQ family
    1.4e+02    4.7   1.0    1.7e+02    4.4   0.7    1.0  1  PF10520  Kua-ubiquitin conjugating enzyme hybrid localisatio
    1.5e+02    3.5   8.2    1.5e+02    3.5   5.7    1.0  1  PF09913  Predicted membrane protein (DUF2142)
    1.5e+02    4.5   6.7    2.2e+02    4.0   4.6    1.3  1  PF04246  Positive regulator of sigma(E), RseC/MucC
    1.6e+02    4.1  14.8      2e+02    3.8  10.3    1.0  1  PF00335  Tetraspanin family
    1.6e+02    4.3   6.7      2e+02    4.0   4.7    1.1  1  PF11990  Protein of unknown function (DUF3487)
    1.7e+02    4.7   6.5    2.1e+02    4.4   4.5    1.1  1  PF05915  Eukaryotic protein of unknown function (DUF872)
    1.7e+02    4.3   5.9      2e+02    4.1   4.1    1.1  1  PF04403  Paraquat-inducible protein A
    1.8e+02    2.5   5.3    2.1e+02    2.4   3.6    1.0  1  PF09586  Bacterial membrane protein YfhO
    1.9e+02    4.7   2.0    1.9e+02    4.6   0.2    1.8  1  PF11167  Protein of unknown function (DUF2953)
    1.9e+02    5.1   7.2    6.4e+02    3.4   4.9    1.8  1  PF10852  Protein of unknown function (DUF2651)
    1.9e+02    4.2   4.4    2.1e+02    4.1   3.0    1.1  1  PF00951  Arterivirus GL envelope glycoprotein
    1.9e+02    4.1   4.8    2.2e+02    3.9   3.3    1.2  1  PF07895  Protein of unknown function (DUF1673)
    1.9e+02    3.6   6.9    2.3e+02    3.4   4.8    1.1  1  PF01036  Bacteriorhodopsin-like protein
      2e+02    4.8   3.9    2.7e+02    4.4   2.7    1.2  1  PF02178  AT hook motif
      2e+02    4.7   8.3    5.5e+02    3.3   5.7    1.7  1  PF11070  Protein of unknown function (DUF2871)
    2.1e+02    3.4  13.1    2.4e+02    3.2   9.1    1.0  1  PF03595  C4-dicarboxylate transporter/malic acid transport p
    2.1e+02    3.6   7.6    2.2e+02    3.5   5.3    1.1  1  PF09922  Predicted membrane protein (DUF2154)
    2.1e+02    4.4   7.2    3.1e+02    3.9   5.0    1.3  1  PF10066  Uncharacterized conserved protein (DUF2304)
    2.2e+02    4.5   1.9    3.3e+02    3.9   1.3    1.5  1  PF09610  Mycoplasma virulence signal region (Myco_arth_vir_N
    2.5e+02    3.8   6.8    4.1e+02    3.0   4.7    1.4  1  PF09878  Predicted membrane protein (DUF2105)
    2.5e+02    2.4   3.3    2.6e+02    2.3   2.3    1.1  1  PF01130  CD36 family
    2.8e+02    3.4   7.2    3.4e+02    3.1   5.0    1.1  1  PF00664  ABC transporter transmembrane region
      3e+02    3.8   7.2    5.2e+02    3.1   5.0    1.7  1  PF09796  Ubiquinol-cytochrome-c reductase complex subunit (Q
    3.1e+02    3.3   9.0    3.5e+02    3.1   6.2    1.0  1  PF00902  Sec-independent protein translocase protein (TatC)
    3.2e+02    3.8   8.5    3.8e+02    3.5   5.9    1.2  1  PF01127  Succinate dehydrogenase/Fumarate reductase transmem
    3.5e+02    2.1  11.0    3.8e+02    1.9   7.6    1.0  1  PF03169  OPT oligopeptide transporter protein
    3.7e+02    2.3  15.4    1.3e+03    0.6  10.7    1.7  1  PF07690  Major Facilitator Superfamily
    3.8e+02    3.1   8.4      4e+02    3.1   5.8    1.0  1  PF02361  Cobalt transport protein
    4.1e+02    3.2   4.4    4.2e+02    3.1   3.1    1.1  1  PF12576  Protein of unknown function (DUF3754)
    4.2e+02    3.7   9.8    4.8e+02    3.5   6.8    1.2  1  PF04304  Protein of unknown function (DUF454)
    4.6e+02    3.1   5.8    5.1e+02    3.0   4.0    1.1  1  PF08592  Domain of unknown function (DUF1772)
      5e+02    3.7   5.4    5.5e+02    3.5   3.7    1.1  1  PF09685  Chloroplast import component protein (Tic20)
    5.2e+02    3.0   5.0    6.5e+02    2.7   3.4    1.2  1  PF05745  Chlamydia 15 kDa cysteine-rich outer membrane prote
    5.3e+02    3.5   6.1    5.9e+02    3.3   4.2    1.1  1  PF01769  Divalent cation transporter
    5.4e+02    2.9   9.5    2.2e+02    4.2   5.1    1.3  1  PF04932  O-Antigen ligase
    5.6e+02    2.3   6.6      9e+02    1.6   4.6    1.4  1  PF07062  Clc-like
    5.6e+02    1.2   9.3    6.9e+02    0.9   6.4    1.1  1  PF06011  Transient receptor potential (TRP) ion channel
    5.9e+02    1.9   8.0    7.4e+02    1.6   5.5    1.1  1  PF09991  Predicted membrane protein (DUF2232)
    6.1e+02    1.8   6.1    5.9e+02    1.8   4.2    1.0  1  PF05297  Herpesvirus latent membrane protein 1 (LMP1)
    6.8e+02    2.7  12.3    8.1e+02    2.4   8.5    1.1  1  PF01284  Membrane-associating domain
    7.4e+02    2.5   2.7    9.1e+02    2.3   1.7    1.2  1  PF03908  Sec20
      8e+02    2.8  10.7    9.8e+02    2.5   7.4    1.2  1  PF11239  Protein of unknown function (DUF3040)
    8.7e+02    2.1   9.1    1.3e+04   -1.6   6.3    2.1  1  PF02495  7kD viral coat protein
    9.4e+02    2.5   8.0    1.4e+03    1.9   5.5    1.4  1  PF05101  Type IV secretory pathway, VirB3-like protein
    9.7e+02    2.2  11.5    1.6e+02    4.7   3.9    1.9  2  PF04341  Protein of unknown function, DUF485
    9.9e+02    2.2   9.0    1.1e+03    2.0   6.2    1.1  1  PF07884  Vitamin K epoxide reductase family
      1e+03    1.9  11.1         50    6.1   1.5    2.0  2  PF08510  PIG-P
      1e+03    1.6  12.0    1.2e+03    1.4   8.3    1.0  1  PF00487  Fatty acid desaturase
    1.1e+03    1.1   7.2    1.1e+03    1.0   5.0    1.0  1  PF04123  Domain of unknown function (DUF373)
    1.1e+03    2.8  12.7         58    6.8   2.7    2.0  2  PF06749  Protein of unknown function (DUF1218)
    1.1e+03    1.5   9.4         69    5.3   1.7    2.0  2  PF12606  Tumour necrosis factor receptor superfamily member 
    1.1e+03    1.4   7.4    1.8e+03    0.8   5.1    1.4  1  PF06570  Protein of unknown function (DUF1129)
    1.1e+03    0.9   7.5      1e+03    1.0   4.5    1.4  1  PF11893  Domain of unknown function (DUF3413)
    1.1e+03    2.2   3.8    1.1e+03    2.2   2.2    1.3  1  PF07123  Photosystem II reaction centre W protein (PsbW)
    1.2e+03    2.3   3.4    1.6e+03    1.8   2.4    1.4  1  PF08571  Yos1-like
    1.3e+03    0.2   6.8    1.4e+03    0.1   4.7    1.1  1  PF02516  Oligosaccharyl transferase STT3 subunit
    1.3e+03    1.9   9.0    1.9e+03    1.4   6.2    1.3  1  PF05814  Baculovirus protein of unknown function (DUF843)
    1.5e+03    1.5   9.8         68    5.8   1.5    2.1  2  PF02468  Photosystem II reaction centre N protein (psbN)
    1.5e+03    1.3   8.1    1.9e+03    1.0   5.6    1.1  1  PF01277  Oleosin
    1.6e+03    0.8   7.7    1.5e+02    4.1   1.8    1.9  1  PF02038  ATP1G1/PLM/MAT8 family
    1.8e+03    1.9  10.9    8.9e+03   -0.3   7.5    2.0  1  PF05421  Protein of unknown function (DUF751)
    1.8e+03    0.9   6.7    6.4e+02    2.4   1.9    1.8  2  PF11821  Protein of unknown function (DUF3341)
    1.8e+03    0.5   3.1    2.5e+03    0.0   2.1    1.2  1  PF04790  Sarcoglycan complex subunit protein
    1.8e+03    1.2  12.6         48    6.2   1.8    2.2  2  PF05360  yiaA/B two helix domain
    1.8e+03    0.8  12.2    2.2e+03    0.6   8.5    1.2  1  PF10003  Integral membrane protein (DUF2244)
    1.9e+03    1.2   8.6    6.1e+02    2.9   3.6    1.8  1  PF10861  Protein of Unknown function (DUF2784)
    2.1e+03    1.9   1.3    2.3e+03    1.8   0.9    1.2  1  PF04749  PLAC8 family
    2.2e+03    1.1  17.0    1.4e+02    5.0   5.0    2.0  2  PF09851  Predicted membrane protein (DUF2078)
    2.6e+03    0.0  12.7    3.1e+03   -0.2   8.8    1.1  1  PF01061  ABC-2 type transporter
    2.8e+03    1.0   6.7    4.4e+03    0.4   4.7    1.5  1  PF11460  Protein of unknown function (DUF3007)
    2.8e+03    0.8  15.1      1e+05   -5.2  10.5    2.1  1  PF06724  Domain of Unknown Function (DUF1206)
      4e+03    0.7  12.9    3.4e+02    4.1   2.0    2.1  2  PF00672  HAMP domain
    4.1e+03    0.9  11.6    1.7e+02    5.4   1.9    2.0  2  PF12273  Chitin synthesis regulation, resistance to Congo re
    4.2e+03    1.1  18.1      1e+05   -6.8  12.5    2.5  1  PF03929  PepSY-associated TM helix
    4.3e+03    0.0   7.7    7.2e+03   -0.7   5.4    1.7  1  PF06781  Uncharacterised protein family (UPF0233)
    4.4e+03    0.1  11.2    8.9e+03   -0.9   7.8    1.6  1  PF10947  Protein of unknown function (DUF2628)
    4.5e+03    0.6  12.8    4.2e+02    3.9   2.5    2.1  2  PF02656  Domain of unknown function DUF
    5.7e+03    0.1  15.8    1.6e+02    5.0   3.0    2.9  2  PF07589  PEP-CTERM motif


Domain and alignment annotation for each model:
>> PF07043  Protein of unknown function (DUF1328)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   54.2  13.6   8.1e-17   6.4e-14       1      39 []       6      44 ..       6      44 .. 0.98

  Alignments for each domain:
  == domain 1    score: 54.2 bits;  conditional E-value: 8.1e-17
     PF07043  1 liFlviAlvAgvlGFgGiAgaaagiAkiLFfiflvlfvv 39
                ++Fl+iAl+A+++GF+G+Ag+a+ iA+iLF+++l+lfvv
  ABA57005.1  6 VTFLIIALIAALFGFTGLAGVATHIAWILFVVGLILFVV 44
                79************************************8 PP

>> PF06738  Protein of unknown function (DUF1212)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   10.5   5.1    0.0025         2     103     152 ..       4      55 ..       1      56 [] 0.83

  Alignments for each domain:
  == domain 1    score: 10.5 bits;  conditional E-value: 0.0025
     PF06738 103 rwlvvlaaglaca..afavlfggdwidvliaflagllggllrvllakrklnp 152
                 + +++l ++l++a  +f+ l g    +++i f++gl+++++ +ll +r+++p
  ABA57005.1   4 WAVTFLIIALIAAlfGFTGLAGVATHIAWILFVVGLILFVVFLLLGRRGRPP 55 
                 455669999999944566679999***********************99876 PP

>> PF10993  Protein of unknown function (DUF2818)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   11.0   3.2    0.0038         3      42      83 ..       3      46 ..       1      50 [. 0.87

  Alignments for each domain:
  == domain 1    score: 11.0 bits;  conditional E-value: 0.0038
     PF10993 42 EllvlylvvgllalllE..krlgqiaaqgWeFYaitlalflvla 83
                 ++v++l+++l+a+l+     +g +++ +W  +++ l+lf+v+ 
  ABA57005.1  3 GWAVTFLIIALIAALFGftGLAGVATHIAWILFVVGLILFVVFL 46
                5899*********998764778999999**************96 PP

>> PF02592  Uncharacterized ACR, YhhQ family COG1738
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   10.1   2.0    0.0055       4.4       5      46 ..       2      47 ..       1      55 [. 0.76

  Alignments for each domain:
  == domain 1    score: 10.1 bits;  conditional E-value: 0.0055
     PF02592  5 ltypltflvtDlinevyGkk....aarrvvlagflanillvlllli 46
                + +++tfl+  li+ ++G      +a  + ++ f+++++l++++l+
  ABA57005.1  2 FGWAVTFLIIALIAALFGFTglagVATHIAWILFVVGLILFVVFLL 47
                7799**************8633337888889999998888555543 PP

>> PF02293  AmiS/UreI family transporter
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    9.0   1.8    0.0081       6.4      88     133 ..       3      49 ..       1      54 [. 0.72

  Alignments for each domain:
  == domain 1    score: 9.0 bits;  conditional E-value: 0.0081
     PF02293  88 gwyslfvaitavvvailslsdaedlvlaviWlawav..Lwllffllla 133
                 gw   f  i+a+ +a+  ++  +++++ + W+++ v  + +++flll+
  ABA57005.1   3 GWAVTFL-IIALIAALFGFTGLAGVATHIAWILFVVglILFVVFLLLG 49 
                 5655554.78999999999999*********99976225555566655 PP

>> PF11292  Protein of unknown function (DUF3093)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    9.1   2.6    0.0086       6.9      12      54 ..       6      48 ..       2      53 .. 0.75

  Alignments for each domain:
  == domain 1    score: 9.1 bits;  conditional E-value: 0.0086
     PF11292 12 wlwlvgalvvaliaievvlgvesllagvpaavllavavvvllv 54
                + +l+ al++al  +    gv   +a++ ++v+l++ vv ll+
  ABA57005.1  6 VTFLIIALIAALFGFTGLAGVATHIAWILFVVGLILFVVFLLL 48
                4577777777888888888999999999999988877776654 PP

>> PF01925  Sulfite exporter TauE/SafE
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.7   6.6    0.0089       7.1      67     110 ..       6      49 ..       1      55 [. 0.43

  Alignments for each domain:
  == domain 1    score: 8.7 bits;  conditional E-value: 0.0089
     PF01925  67 lplllgallGallGalllsllpsellkllfgvlllllallmllr 110
                 +++l+ al++al+G + l+ + +++  +lf+v l+l+++++ll+
  ABA57005.1   6 VTFLIIALIAALFGFTGLAGVATHIAWILFVVGLILFVVFLLLG 49 
                 33444455555555444444444444444444444444444443 PP

>> PF01124  MAPEG family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.9   5.3     0.009       7.2      56      97 ..       5      49 ..       1      56 [] 0.76

  Alignments for each domain:
  == domain 1    score: 8.9 bits;  conditional E-value: 0.009
     PF01124 56 vplflllvllaeltgapg...glvallgaafvvaRvahalgyiag 97
                ++ fl+++l+a+l g  g    +++++ ++fvv+ ++++++++ g
  ABA57005.1  5 AVTFLIIALIAALFGFTGlagVATHIAWILFVVGLILFVVFLLLG 49
                677888888888887765665888888888999999999999887 PP

>> PF00375  Sodium:dicarboxylate symporter family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.7   2.9     0.011       8.6     188     229 ..       6      48 ..       2      55 .. 0.58

  Alignments for each domain:
  == domain 1    score: 7.7 bits;  conditional E-value: 0.011
     PF00375 188 vfaliaatvas.kglgallslgkflltvylallihllvvlpll 229
                 v +li a++a  +g+  l+ ++  ++ +++++ ++l+vv++ll
  ABA57005.1   6 VTFLIIALIAAlFGFTGLAGVATHIAWILFVVGLILFVVFLLL 48 
                 4444444444446666666666666666666666666666665 PP

>> PF04061  ORMDL family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.5   0.4     0.012       9.2      14      62 ..       4      54 ..       2      55 .. 0.72

  Alignments for each domain:
  == domain 1    score: 8.5 bits;  conditional E-value: 0.012
     PF04061 14 Wliyvlvilllkll..lllipgvskelaWtltnltyvivsyilfHlvkGtP 62
                W + +l+i+l+  l  ++ ++gv++++aW l  +  +++   l+   +G P
  ABA57005.1  4 WAVTFLIIALIAALfgFTGLAGVATHIAWILFVVGLILFVVFLLLGRRGRP 54
                877778877777661245689999*****9998888777666666666655 PP

>> PF04647  Accessory gene regulator B
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.8   1.8     0.013        10      85     118 ..       6      45 ..       2      54 .. 0.76

  Alignments for each domain:
  == domain 1    score: 7.8 bits;  conditional E-value: 0.013
     PF04647  85 ilfvliilliklislnls......iviilflisliiiyly 118
                 ++f++i+l++ l+ ++        i++ilf+++li+++++
  ABA57005.1   6 VTFLIIALIAALFGFTGLagvathIAWILFVVGLILFVVF 45 
                 4566666777777766666777889999999999998765 PP

>> PF05393  Human adenovirus early E3A glycoprotein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.1   0.1     0.017        14      42      65 ..      33      56 .]      20      56 .] 0.86

  Alignments for each domain:
  == domain 1    score: 8.1 bits;  conditional E-value: 0.017
     PF05393 42 lmfvcliimwlicclkrkrarppi 65
                ++fv+ +i++++  l  +r rpp+
  ABA57005.1 33 ILFVVGLILFVVFLLLGRRGRPPL 56
                689999999*************96 PP

>> PF05767  Poxvirus virion envelope protein A14
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.5   2.8     0.016        13      19      64 ..       6      47 ..       1      53 [. 0.81

  Alignments for each domain:
  == domain 1    score: 8.5 bits;  conditional E-value: 0.016
     PF05767 19 ivLLilacifAfiefskstkpsdktwralsiiaFilgivlllglll 64
                +  Li+a i A + f+    +++     ++ i F++g++l +  ll
  ABA57005.1  6 VTFLIIALIAALFGFTGLAGVAT----HIAWILFVVGLILFVVFLL 47
                789************99887766....6888999999998887766 PP

>> PF06271  RDD family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.5   5.1     0.014        11      15      59 ..       4      47 ..       1      53 [. 0.47

  Alignments for each domain:
  == domain 1    score: 8.5 bits;  conditional E-value: 0.014
     PF06271 15 llilllilalivllivaksaneaeallllivlllllllvllyyiv 59
                +++ +li ali++l+++  +   +a+ + ++l+++ l++++++ +
  ABA57005.1  4 WAVTFLIIALIAALFGF-TGLAGVATHIAWILFVVGLILFVVFLL 47
                44555555555555555.233344444444444444444444433 PP

>> PF06826  Predicted Permease Membrane Region
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.0   5.3     0.016        12      23      65 ..       2      44 ..       1      49 [. 0.91

  Alignments for each domain:
  == domain 1    score: 8.0 bits;  conditional E-value: 0.016
     PF06826 23 LGvaggvLivglllGqlgkkgplvldisalsllrelgLalFla 65
                +G a+  Li++l+ + +g +g   + +++ ++l  +gL+lF++
  ABA57005.1  2 FGWAVTFLIIALIAALFGFTGLAGVATHIAWILFVVGLILFVV 44
                588999***********9887777*****************97 PP

>> PF07695  7TM diverse intracellular signalling
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.0   4.7     0.017        13     105     145 ..       6      46 ..       1      55 [. 0.36

  Alignments for each domain:
  == domain 1    score: 8.0 bits;  conditional E-value: 0.017
     PF07695 105 vllsllllllpllpyteslslaqllallvilfllligikaw 145
                 v +++++l++ l+ +t    +a+ +a++ +++ l+++++ +
  ABA57005.1   6 VTFLIIALIAALFGFTGLAGVATHIAWILFVVGLILFVVFL 46 
                 22223333333444444444444333333333333333333 PP

>> PF10953  Protein of unknown function (DUF2754)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.2   5.1      0.02        16      11      52 ..       4      46 ..       2      53 .. 0.84

  Alignments for each domain:
  == domain 1    score: 8.2 bits;  conditional E-value: 0.02
     PF10953 11 whyyavalGlifilnGvvGllGfeak.GwqtyavGlvtwvisf 52
                w    + + li  l G  Gl G  ++  w  + vGl+ +v+ +
  ABA57005.1  4 WAVTFLIIALIAALFGFTGLAGVATHiAWILFVVGLILFVVFL 46
                555667899**************99758**********99854 PP

>> PF11375  Protein of unknown function (DUF3177)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.7   1.9     0.035        28     156     187 ..      22      54 ..       4      56 .] 0.67

  Alignments for each domain:
  == domain 1    score: 6.7 bits;  conditional E-value: 0.035
     PF11375 156 allgflgllalviYvvgllqfvl.vrlpkqGrs 187
                 +l+g  + +a +++vvgl+ fv+ + l+++Gr 
  ABA57005.1  22 GLAGVATHIAWILFVVGLILFVVfLLLGRRGRP 54 
                 455566666777777777777651458999985 PP

>> PF11026  Protein of unknown function (DUF2721)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.1   6.5     0.032        25      68     114 ..       2      48 ..       1      51 [. 0.75

  Alignments for each domain:
  == domain 1    score: 7.1 bits;  conditional E-value: 0.032
     PF11026  68 lltlaallivlvilllflsallelelslvvailFilallllilslll 114
                 ++ + ++li+++i++lf    l    + ++ ilF+++l+l+++ lll
  ABA57005.1   2 FGWAVTFLIIALIAALFGFTGLAGVATHIAWILFVVGLILFVVFLLL 48 
                 5666778888888888875555555667778***********98876 PP

>> PF02378  Phosphotransferase system, EIIC
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.7   4.8     0.045        36     201     235 ..       5      39 ..       2      51 .. 0.84

  Alignments for each domain:
  == domain 1    score: 5.7 bits;  conditional E-value: 0.045
     PF02378 201 llgvliigflerllipfGlHgafiapawvtaiggs 235
                 ++ +lii+++ +l+ ++Gl g+++ +aw++++ g+
  ABA57005.1   5 AVTFLIIALIAALFGFTGLAGVATHIAWILFVVGL 39 
                 56789************************998444 PP

>> PF01943  Polysaccharide biosynthesis protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.3   6.4     0.042        33      82     127 ..       1      46 [.       1      49 [. 0.87

  Alignments for each domain:
  == domain 1    score: 6.3 bits;  conditional E-value: 0.042
     PF01943  82 llvllllslifllilliaallglpdlavlllilallilllvsissf 127
                 +++  +++li++li  ++ ++gl  +a+++ +++++++l+++++ +
  ABA57005.1   1 MFGWAVTFLIIALIAALFGFTGLAGVATHIAWILFVVGLILFVVFL 46 
                 6777899999999999999*******************88888776 PP

>> PF01957  NfeD-like
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.1   7.6     0.046        37      18      65 ..       4      48 ..       1      53 [. 0.75

  Alignments for each domain:
  == domain 1    score: 7.1 bits;  conditional E-value: 0.046
                ----------------------.........----------------- CS
     PF01957 18 tfgvlglgGlaalvigallllsteavgleisplvilvlaiviaalllf 65
                + + +++++l+a+++g+  l+ +     +i++ +++v +i+++++ll+
  ABA57005.1  4 WAVTFLIIALIAALFGFTGLAGV---ATHIAWILFVVGLILFVVFLLL 48
                56789999***********9994...4477777777777777776665 PP

>> PF07907  YibE/F-like protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.9   4.8      0.05        39       2      44 ..       5      47 ..       4      56 .] 0.71

  Alignments for each domain:
  == domain 1    score: 5.9 bits;  conditional E-value: 0.05
     PF07907  2 vlvillllfilllllvggkkGlksllsLvlnllllllvllpll 44
                ++++l++++i++l+ + g  G+++ ++ +l ++ l+l+++ ll
  ABA57005.1  5 AVTFLIIALIAALFGFTGLAGVATHIAWILFVVGLILFVVFLL 47
                5789999999999999999999999996666555555554333 PP

>> PF05656  Protein of unknown function (DUF805)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.5   5.6     0.059        47      16      66 ..       4      49 ..       1      53 [. 0.58

  Alignments for each domain:
  == domain 1    score: 6.5 bits;  conditional E-value: 0.059
     PF05656 16 wfllfnillsivllildillsessssasseslalllgllllalllptlavt 66
                w++ f+i+++i++l+ ++          ++ +a++l++++l+l++  l ++
  ABA57005.1  4 WAVTFLIIALIAALFGFTG-----LAGVATHIAWILFVVGLILFVVFLLLG 49
                5555555554444433333.....467778888888888888887555444 PP

>> PF10688  Bacterial inner membrane protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.0   3.2      0.06        48       7      47 ..      10      49 ..       1      51 [. 0.76

  Alignments for each domain:
  == domain 1    score: 6.0 bits;  conditional E-value: 0.06
     PF10688  7 llglialllgllaflqkndqrllllllvasllialhFlLLg 47
                ++ lia l+g+++      +++  +l+v +l+  + FlLLg
  ABA57005.1 10 IIALIAALFGFTGL-AGVATHIAWILFVVGLILFVVFLLLG 49
                34566666666554.6778999*****************99 PP

>> PF05546  She9 / Mdm33 family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.0   0.8     0.064        51     150     172 ..      26      48 ..      23      52 .. 0.89

  Alignments for each domain:
  == domain 1    score: 6.0 bits;  conditional E-value: 0.064
     PF05546 150 astwgtwilmgvnvllFlvlqll 172
                 ++t+ +wil  v ++lF+v+ ll
  ABA57005.1  26 VATHIAWILFVVGLILFVVFLLL 48 
                 578899*************9886 PP

>> PF07465  Photosystem I protein M (PsaM)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.2   2.3      0.13     1e+02       9      18 ..       8      17 ..       6      20 .. 0.77

  Alignments for each domain:
  == domain 1    score: 5.2 bits;  conditional E-value: 0.13
     PF07465  9 ALiiALipai 18
                 LiiALi+a 
  ABA57005.1  8 FLIIALIAAL 17
                5999999985 PP

>> PF05975  Bacterial ABC transporter protein EcsB
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.9   5.2     0.063        50      29      72 ..       6      49 ..       1      52 [. 0.70

  Alignments for each domain:
  == domain 1    score: 4.9 bits;  conditional E-value: 0.063
     PF05975 29 vlvlifllgalgyyYsqllkelpsnfptialvlavlllllll.ig 72
                v +li++l+a+++++  l        + i +v++++l++++l +g
  ABA57005.1  6 VTFLIIALIAALFGFTGLAGVATHIAW-ILFVVGLILFVVFLlLG 49
                678999999999999887665555555.77777777777666355 PP

>> PF11368  Protein of unknown function (DUF3169)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.5   2.0      0.07        56     110     145 ..       9      44 ..       3      51 .. 0.75

  Alignments for each domain:
  == domain 1    score: 5.5 bits;  conditional E-value: 0.07
     PF11368 110 svlslialllgyvlklaeegailliliidilllvvl 145
                 ++++lia l+g++     + +i +il++  l+l+v+
  ABA57005.1   9 LIIALIAALFGFTGLAGVATHIAWILFVVGLILFVV 44 
                 578888888888888888888888888777777765 PP

>> PF09605  Hypothetical bacterial integral membrane protein (Trep_Strep)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.5   4.5     0.096        76      12      54 ..       5      47 ..       2      53 .. 0.66

  Alignments for each domain:
  == domain 1    score: 5.5 bits;  conditional E-value: 0.096
     PF09605 12 aalyfvvvfivgmlgainpvlmllapaitallgGiifmLlvak 54
                a+ ++++ +i++++g+++ + +   +a + +++G i + +   
  ABA57005.1  5 AVTFLIIALIAALFGFTGLAGVATHIAWILFVVGLILFVVFLL 47
                4556666777777777777777777777777777776665544 PP

>> PF11169  Protein of unknown function (DUF2956)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.1   0.6     0.088        69      83     102 ..      28      47 ..      22      48 .. 0.88

  Alignments for each domain:
  == domain 1    score: 6.1 bits;  conditional E-value: 0.088
     PF11169  83 sklpWvLLvlsWlgfiaylv 102
                 ++++W+L v+  + f+++l+
  ABA57005.1  28 THIAWILFVVGLILFVVFLL 47 
                 689*************9986 PP

>> PF09990  Predicted membrane protein (DUF2231)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.3   5.3     0.096        76      12      57 ..       8      48 ..       2      52 .. 0.87

  Alignments for each domain:
  == domain 1    score: 6.3 bits;  conditional E-value: 0.096
     PF09990 12 alvigflavaaGlvelllaepsirakstallHaiggvlllalivvl 57
                 l+i+++a+++G++ l  +     a+++a++ +++g++l++++++l
  ABA57005.1  8 FLIIALIAALFGFTGLAGV-----ATHIAWILFVVGLILFVVFLLL 48
                47999*********99999.....9999*********999998874 PP

>> PF09834  Predicted membrane protein (DUF2061)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.1   6.1       0.1        82      13      47 ..       5      45 ..       1      45 [. 0.75

  Alignments for each domain:
  == domain 1    score: 6.1 bits;  conditional E-value: 0.1
     PF09834 13 tvaflVayll......TgslalagaialvEplvktvlYyfH 47
                +v+fl+  l+      Tg + +a  ia + ++v+++l++++
  ABA57005.1  5 AVTFLIIALIaalfgfTGLAGVATHIAWILFVVGLILFVVF 45
                4455444444445566**********************975 PP

>> PF09721  Transmembrane exosortase (Exosortase_EpsH)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.1   6.2      0.09        71      58     103 ..       4      51 ..       1      54 [. 0.57

  Alignments for each domain:
  == domain 1    score: 5.1 bits;  conditional E-value: 0.09
     PF09721  58 lglfllalalllllyllgslsyv..lllailalpllllgllllllgrk 103
                 +++++l++al+++l+ +  l+ v   + +il ++ l+l++++lllgr+
  ABA57005.1   4 WAVTFLIIALIAALFGFTGLAGVatHIAWILFVVGLILFVVFLLLGRR 51 
                 344455555545555555544443666666677777777777777776 PP

>> PF04241  Protein of unknown function (DUF423)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.0   4.0      0.09        71      38      67 ..      10      44 ..       1      51 [. 0.66

  Alignments for each domain:
  == domain 1    score: 6.0 bits;  conditional E-value: 0.09
     PF04241 38 alallakrl.....asrllklagalflaGillFsG 67
                ++al+a+       a    ++a +lf++G++lF  
  ABA57005.1 10 IIALIAALFgftglAGVATHIAWILFVVGLILFVV 44
                333333333334448888999999*********75 PP

>> PF07332  Protein of unknown function (DUF1469)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.3   8.4      0.12        97      44      92 ..       5      44 ..       1      55 [. 0.34

  Alignments for each domain:
  == domain 1    score: 5.3 bits;  conditional E-value: 0.12
     PF07332 44 alvlalvallvllaalvaaLaealvlpawlAalivavvllllAgilalv 92
                a+        +l++al+aaL   ++   +  a  +a +l+++++il+ v
  ABA57005.1  5 AV-------TFLIIALIAAL--FGFTGLAGVATHIAWILFVVGLILFVV 44
                33.......33333333333..222211112222333333333333322 PP

>> PF01040  UbiA prenyltransferase family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.0   6.2     0.097        77     124     236 ..       9      47 ..       1      55 [. 0.43

  Alignments for each domain:
  == domain 1    score: 5.0 bits;  conditional E-value: 0.097
     PF01040 124 lvvglafgllillgaaavggdislpllllalllfllalallltndirDvegDraaGirtlpvrlgrkatlyalllaaallallllllllaplllllava 222
                 l+++l  +l+ + g a v+++i + l++++l+                                                                   
  ABA57005.1   9 LIIALIAALFGFTGLAGVATHIAWILFVVGLI------------------------------------------------------------------- 40 
                 23333333444444444444444444444444................................................................... PP

     PF01040 223 laalallrallllr 236
                         ++++l 
  ABA57005.1  41 -------LFVVFLL 47 
                 .......3333333 PP

>> PF00434  Glycoprotein VP7
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.5   0.4      0.11        88       1      47 [.       1      47 [.       1      52 [. 0.81

  Alignments for each domain:
  == domain 1    score: 4.5 bits;  conditional E-value: 0.11
     PF00434  1 mygieyttillllislvllayilktllkimdfiiyrillvvvllsal 47
                m+g  +t +++ li+ ++  + l  + + ++ i++ + l++ +++ l
  ABA57005.1  1 MFGWAVTFLIIALIAALFGFTGLAGVATHIAWILFVVGLILFVVFLL 47
                78888999999999999999999999999999998887776666554 PP

>> PF11127  Protein of unknown function (DUF2892)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.3   7.9      0.14   1.1e+02      14      45 ..       9      43 ..       3      48 .. 0.88

  Alignments for each domain:
  == domain 1    score: 5.3 bits;  conditional E-value: 0.14
     PF11127 14 ivvGaallllallglqgaw...gwllglvGavllv 45
                +++++++ l++++gl g+    +w+l +vG++l+v
  ABA57005.1  9 LIIALIAALFGFTGLAGVAthiAWILFVVGLILFV 43
                6788999999999998877999***********97 PP

>> PF11067  Protein of unknown function (DUF2868)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.3   4.7      0.15   1.2e+02      40      65 ..      24      49 ..       4      52 .. 0.86

  Alignments for each domain:
  == domain 1    score: 4.3 bits;  conditional E-value: 0.15
     PF11067 40 lsrlshllwlafllGalltllllllt 65
                 + ++h++w++f +G++l +++lll 
  ABA57005.1 24 AGVATHIAWILFVVGLILFVVFLLLG 49
                67899************999999975 PP

>> PF03706  Uncharacterised protein family (UPF0104)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.7   8.8      0.13     1e+02     115     159 ..       7      51 ..       1      54 [. 0.60

  Alignments for each domain:
  == domain 1    score: 4.7 bits;  conditional E-value: 0.13
     PF03706 115 llalllfallalllflsselialsllllllillaalvlllillir 159
                  ++++++ +++++++  ++ ++  +++l+++ l+++v++l+l +r
  ABA57005.1   7 TFLIIALIAALFGFTGLAGVATHIAWILFVVGLILFVVFLLLGRR 51 
                 233333444444446777777777777777777777777776554 PP

>> PF00955  HCO3- transporter family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.9   1.1      0.14   1.1e+02      38      85 ..       5      49 ..       4      54 .. 0.75

  Alignments for each domain:
  == domain 1    score: 3.9 bits;  conditional E-value: 0.14
                HHHHHHHHHHHHHHC---------------HHHHHHHHH---HHHH-- CS
     PF00955 38 avifiYfaalspaitfGGLlgekteeligvsesllstavagivfslla 85
                av f+ +a +++   f GL g +t+ +     +++ + ++ +vf ll+
  ABA57005.1  5 AVTFLIIALIAALFGFTGLAGVATHIAW---ILFVVGLILFVVFLLLG 49
                7889999999999999999999997432...34555566666776665 PP

>> PF06157  Protein of unknown function (DUF973)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.4   5.9      0.13        99      92     133 ..       4      43 ..       1      52 [. 0.69

  Alignments for each domain:
  == domain 1    score: 4.4 bits;  conditional E-value: 0.13
     PF06157  92 vgiviivigalltivgllslligviilfigvilaliGsiLig 133
                 +++ +++i+++ +++g+  l +g ++  i+ il+++G iL  
  ABA57005.1   4 WAVTFLIIALIAALFGFTGL-AG-VATHIAWILFVVGLILFV 43 
                 66778899999999988886.33.345677777777777654 PP

>> PF09972  Predicted membrane protein (DUF2207)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.8   6.7      0.14   1.1e+02     403     447 ..       4      48 ..       1      54 [. 0.52

  Alignments for each domain:
  == domain 1    score: 3.8 bits;  conditional E-value: 0.14
     PF09972 403 lgilllilsfiliifllalfaglllaalvllvivlvigliialll 447
                 +++ +li+++i+  f ++  ag++ +++ +l++v +i+++++lll
  ABA57005.1   4 WAVTFLIIALIAALFGFTGLAGVATHIAWILFVVGLILFVVFLLL 48 
                 455556666666645555555555555555555555554444444 PP

>> PF06720  Bacteriophage phi-29 early protein GP16.7
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.7   0.1      0.18   1.5e+02       4      22 ..      33      51 ..      30      54 .. 0.80

  Alignments for each domain:
  == domain 1    score: 4.7 bits;  conditional E-value: 0.18
                ------------------- CS
     PF06720  4 ilmigvlalcvifllsgrn 22
                il++  l l v+fll gr 
  ABA57005.1 33 ILFVVGLILFVVFLLLGRR 51
                67777788999****9996 PP

>> PF04156  IncA protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.7   7.8      0.16   1.3e+02       9      56 ..       6      49 ..       4      53 .. 0.74

  Alignments for each domain:
  == domain 1    score: 4.7 bits;  conditional E-value: 0.16
     PF04156  9 valiilgllliasGiallvlfasslgvlisallgivliAlgvvLlalg 56
                v+++i++l+ ++ G ++l+  a+     i+ +l++v ++l+vv l lg
  ABA57005.1  6 VTFLIIALIAALFGFTGLAGVATH----IAWILFVVGLILFVVFLLLG 49
                677777777777777777777666....88888888888888888777 PP

>> PF04298  Putative neutral zinc metallopeptidase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.1   1.7      0.21   1.6e+02     118     139 ..      22      43 ..       4      50 .. 0.75

  Alignments for each domain:
  == domain 1    score: 4.1 bits;  conditional E-value: 0.21
     PF04298 118 pvvsigsnlslillllglllks 139
                  ++ ++ ++++il+++gl+l +
  ABA57005.1  22 GLAGVATHIAWILFVVGLILFV 43 
                 4677889999999999999832 PP

>> PF03739  Predicted permease YjgP/YjgQ family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.5   5.4       0.2   1.6e+02     280     330 ..       5      52 ..       2      56 .] 0.62

  Alignments for each domain:
  == domain 1    score: 3.5 bits;  conditional E-value: 0.2
     PF03739 280 placlllvligiplglkkprggrglrlvlailiffiyyvlsslgealakgg 330
                 +++ l+ +li++ +g++      g +  +a ++f++ ++l++++  l+++g
  ABA57005.1   5 AVTFLIIALIAALFGFTG---LAGVATHIAWILFVVGLILFVVFLLLGRRG 52 
                 567788899999999993...333335555555555555555555555555 PP

>> PF10520  Kua-ubiquitin conjugating enzyme hybrid localisation domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.4   0.7      0.21   1.7e+02      58      97 ..       6      45 ..       3      47 .. 0.82

  Alignments for each domain:
  == domain 1    score: 4.4 bits;  conditional E-value: 0.21
     PF10520 58 lsivvllvlalklalsakseltlalglhvfvltlailval 97
                ++ ++++++a+ + ++  + +++++++ +fv+ l+++v++
  ABA57005.1  6 VTFLIIALIAALFGFTGLAGVATHIAWILFVVGLILFVVF 45
                5566777778888888888999999*********999986 PP

>> PF09913  Predicted membrane protein (DUF2142)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.5   5.7      0.19   1.5e+02     317     362 ..       4      47 ..       1      54 [. 0.49

  Alignments for each domain:
  == domain 1    score: 3.5 bits;  conditional E-value: 0.19
     PF09913 317 wlyflwllalllllfaalkvgskrlkekilvlllvlvivllialal 362
                 w++ + ++al+++lf  ++       + i ++l+v++ +l+++++l
  ABA57005.1   4 WAVTFLIIALIAALFGFTGLAGVA--THIAWILFVVGLILFVVFLL 47 
                 444444555555555555554444..34444444444444444443 PP

>> PF04246  Positive regulator of sigma(E), RseC/MucC
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.0   4.6      0.28   2.2e+02      82     116 ..       8      51 ..       2      54 .. 0.61

  Alignments for each domain:
  == domain 1    score: 4.0 bits;  conditional E-value: 0.28
     PF04246  82 lllgallgqallls.........ellaallgllglllgflilrl 116
                 +l+ al++  ++++          ++ +++gl+++++ +l+ r+
  ABA57005.1   8 FLIIALIAALFGFTglagvathiAWILFVVGLILFVVFLLLGRR 51 
                 44444444444444454556556778888888888777777665 PP

>> PF00335  Tetraspanin family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.8  10.3      0.25     2e+02      46      88 ..       6      47 ..       2      49 .. 0.77

  Alignments for each domain:
  == domain 1    score: 3.8 bits;  conditional E-value: 0.25
     PF00335 46 illiiviGviililgilGcigalkeskcllliyailllllfla 88
                 +++i i +i+ ++g+ G +g   +  ++l++  ++l+++fl+
  ABA57005.1  6 VTFLI-IALIAALFGFTGLAGVATHIAWILFVVGLILFVVFLL 47
                44555.7888888899999999999999999999999998887 PP

>> PF11990  Protein of unknown function (DUF3487)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.0   4.7      0.25     2e+02      26      67 ..       8      49 ..       3      54 .. 0.74

  Alignments for each domain:
  == domain 1    score: 4.0 bits;  conditional E-value: 0.25
     PF11990 26 lgvvaglslalglvvglllalllgtialiptlavlgvilvvl 67
                ++++a++++++g+     +a  +++i ++++l++ +v+l++ 
  ABA57005.1  8 FLIIALIAALFGFTGLAGVATHIAWILFVVGLILFVVFLLLG 49
                567888888888876666777788888888888888877764 PP

>> PF05915  Eukaryotic protein of unknown function (DUF872)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.4   4.5      0.26   2.1e+02      47      88 ..       5      43 ..       3      48 .. 0.74

  Alignments for each domain:
  == domain 1    score: 4.4 bits;  conditional E-value: 0.26
     PF05915 47 avlLlllGllllvlgvliaanpvegdgsqaivllvlGillfi 88
                av+ l++ l+  + g+  +a+    +++ a++l+v+G++lf+
  ABA57005.1  5 AVTFLIIALIAALFGFTGLAGV---ATHIAWILFVVGLILFV 43
                5566666665555555555555...88999**********97 PP

>> PF04403  Paraquat-inducible protein A
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.1   4.1      0.25     2e+02     108     142 ..      10      44 ..       6      51 .. 0.83

  Alignments for each domain:
  == domain 1    score: 4.1 bits;  conditional E-value: 0.25
     PF04403 108 vvailvalvklaalasiepgpglwaFalvvlltml 142
                 ++a++ al+ + +la + + ++ ++F++  +l ++
  ABA57005.1  10 IIALIAALFGFTGLAGVATHIAWILFVVGLILFVV 44 
                 799********************999876665544 PP

>> PF09586  Bacterial membrane protein YfhO
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.4   3.6      0.26   2.1e+02     341     385 ..       2      46 ..       2      52 .. 0.66

  Alignments for each domain:
  == domain 1    score: 2.4 bits;  conditional E-value: 0.26
     PF09586 341 fsfllsflilllaaealdelkelk.klkilllllllvlllllilll 385
                 f + ++fli+ l+a+ +  ++ l+     ++++l++v+l+l++++l
  ABA57005.1   2 FGWAVTFLIIALIAALFG-FTGLAgVATHIAWILFVVGLILFVVFL 46 
                 568888888888777665.555555777777777777777766554 PP

>> PF11167  Protein of unknown function (DUF2953)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.6   0.2      0.24   1.9e+02      17      35 ..       2      20 ..       2      25 .. 0.86

  Alignments for each domain:
  == domain 1    score: 4.6 bits;  conditional E-value: 0.24
     PF11167 17 llwaikgllygllsnlfki 35
                + wa++ l+++l+ +lf +
  ABA57005.1  2 FGWAVTFLIIALIAALFGF 20
                57**********9999876 PP

>> PF10852  Protein of unknown function (DUF2651)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.4   4.9       0.8   6.4e+02      39      73 ..       7      41 ..       4      50 .. 0.64

  Alignments for each domain:
  == domain 1    score: 3.4 bits;  conditional E-value: 0.8
     PF10852 39 ifLiltvtvfnpsflfWvvvYslvsfilsyitllv 73
                 fLi+++++  + f + ++v + +++il  + l++
  ABA57005.1  7 TFLIIALIAALFGFTGLAGVATHIAWILFVVGLIL 41
                56777777777777777777777776666665553 PP

>> PF00951  Arterivirus GL envelope glycoprotein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.1   3.0      0.26   2.1e+02      35      77 ..       2      43 ..       1      51 [. 0.57

  Alignments for each domain:
  == domain 1    score: 4.1 bits;  conditional E-value: 0.26
     PF00951 35 ldfavetvvllplltkllslkllttahlllflnvaalsytgyv 77
                +++av+  ++++++    + +l+++a+ +  + + + +++ +v
  ABA57005.1  2 FGWAVTFLIIALIAALFGFTGLAGVATHIAWILFVV-GLILFV 43
                667776666666666666666666666554443333.444443 PP

>> PF07895  Protein of unknown function (DUF1673)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.9   3.3      0.28   2.2e+02      64      99 ..       4      49 ..       1      53 [. 0.58

  Alignments for each domain:
  == domain 1    score: 3.9 bits;  conditional E-value: 0.28
     PF07895 64 ifltlvlf.lvisllgvnlk.........lilllglilslllvllt 99
                +++t++++ l+ +l g +           + +++glil ++++ll 
  ABA57005.1  4 WAVTFLIIaLIAALFGFTGLagvathiawILFVVGLILFVVFLLLG 49
                5555555555555555444445566677777777777776666655 PP

>> PF01036  Bacteriorhodopsin-like protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.4   4.8      0.29   2.3e+02     103     141 ..      12      46 ..       4      50 .. 0.74

  Alignments for each domain:
  == domain 1    score: 3.4 bits;  conditional E-value: 0.29
                 HHHHHHHHH---HHHCT-SSHHHHHHHHHHHHHHHHHHH CS
     PF01036 103 vvldilmivtGlaaalttssgllrwvlfaistafflvll 141
                   + +l   tGla++ t     + w+lf ++ ++f+v l
  ABA57005.1  12 ALIAALFGFTGLAGVAT----HIAWILFVVGLILFVVFL 46 
                 33455666788988888....689***********9977 PP

>> PF02178  AT hook motif
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.4   2.7      0.34   2.7e+02       3       8 ..      50      55 ..      49      56 .] 0.87

  Alignments for each domain:
  == domain 1    score: 4.4 bits;  conditional E-value: 0.34
                ------ CS
     PF02178  3 kRGRPr 8 
                +RGRP+
  ABA57005.1 50 RRGRPP 55
                7****8 PP

>> PF11070  Protein of unknown function (DUF2871)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.3   5.7      0.69   5.5e+02      31      58 ..      17      48 ..       1      52 [. 0.60

  Alignments for each domain:
  == domain 1    score: 3.3 bits;  conditional E-value: 0.69
     PF11070 31 ftgktqLsvvHtH....llvlGtvlflivlll 58
                + g t L+ v tH    l+v+G +lf+++lll
  ABA57005.1 17 LFGFTGLAGVATHiawiLFVVGLILFVVFLLL 48
                34555566666663333467777777777776 PP

>> PF03595  C4-dicarboxylate transporter/malic acid transport protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.2   9.1       0.3   2.4e+02       4      47 ..       2      47 ..       1      49 [. 0.57

  Alignments for each domain:
  == domain 1    score: 3.2 bits;  conditional E-value: 0.3
     PF03595  4 fglvmGtgilslalenlpypfrglttige....ilfllalvlfillll 47
                fg+   + i++l+ +++   f+gl  +++    ilf++ l+lf+++ll
  ABA57005.1  2 FGWAVTFLIIALIAALFG--FTGLAGVAThiawILFVVGLILFVVFLL 47
                777777777777777776..4444444433333666666666666655 PP

>> PF09922  Predicted membrane protein (DUF2154)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.5   5.3      0.27   2.2e+02      26      66 ..       7      47 ..       1      53 [. 0.50

  Alignments for each domain:
  == domain 1    score: 3.5 bits;  conditional E-value: 0.27
     PF09922 26 fllllplllillgyyllkkrkfklgnvlliiglillllsll 66
                ++l+++l+  l+g++ l      ++ +l+++glil++ +ll
  ABA57005.1  7 TFLIIALIAALFGFTGLAGVATHIAWILFVVGLILFVVFLL 47
                44444444444444444444444455555555555554444 PP

>> PF10066  Uncharacterized conserved protein (DUF2304)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.9   5.0      0.39   3.1e+02       9      49 ..       6      45 ..       2      48 .. 0.82

  Alignments for each domain:
  == domain 1    score: 3.9 bits;  conditional E-value: 0.39
     PF10066  9 ivviiaailviivrirkkkleisdlllwlvlwivllllalf 49
                ++++i+a++ +++ +    + +++ + w+++++ l+l+++f
  ABA57005.1  6 VTFLIIALIAALFGFTGL-AGVATHIAWILFVVGLILFVVF 45
                667777777777777654.78999**************997 PP

>> PF09610  Mycoplasma virulence signal region (Myco_arth_vir_N)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.9   1.3      0.42   3.3e+02      12      20 ..       9      17 ..       6      28 .. 0.87

  Alignments for each domain:
  == domain 1    score: 3.9 bits;  conditional E-value: 0.42
     PF09610 12 LvlalvAsL 20
                L++al+A+L
  ABA57005.1  9 LIIALIAAL 17
                89******9 PP

>> PF09878  Predicted membrane protein (DUF2105)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.0   4.7      0.51   4.1e+02     155     181 ..      18      45 ..       2      48 .. 0.75

  Alignments for each domain:
  == domain 1    score: 3.0 bits;  conditional E-value: 0.51
     PF09878 155 vefegiegis.GiaWalWilgfiiffll 181
                 + f+g++g++  iaW+l+++g i+f+++
  ABA57005.1  18 FGFTGLAGVAtHIAWILFVVGLILFVVF 45 
                 5678888875258999999999999886 PP

>> PF01130  CD36 family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.3   2.3      0.33   2.6e+02     435     463 ..      19      47 ..       6      50 .. 0.81

  Alignments for each domain:
  == domain 1    score: 2.3 bits;  conditional E-value: 0.33
     PF01130 435 qlvilprivailaivllalglillllaiv 463
                  +  l  ++  +a++l+++glil++++++
  ABA57005.1  19 GFTGLAGVATHIAWILFVVGLILFVVFLL 47 
                 5666677888999**********999986 PP

>> PF00664  ABC transporter transmembrane region
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.1   5.0      0.43   3.4e+02     115     157 ..       6      47 ..       2      53 .. 0.78

  Alignments for each domain:
  == domain 1    score: 3.1 bits;  conditional E-value: 0.43
                 ---HHHHHHHHHHHH----HHHHH---THHHHHHHHHHHHHHH CS
     PF00664 115 lgdklglffqslatfvgglivmfylgwkltlvllailpllilv 157
                 ++  ++ ++ +l+ f g+ +v+  + w l++v l il++++l+
  ABA57005.1   6 VTFLIIALIAALFGFTGLAGVATHIAWILFVVGL-ILFVVFLL 47 
                 5677888999999999999999999999999999.55554443 PP

>> PF09796  Ubiquinol-cytochrome-c reductase complex subunit (QCR10)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.1   5.0      0.66   5.2e+02      10      31 ..       8      29 ..       2      49 .. 0.89

  Alignments for each domain:
  == domain 1    score: 3.1 bits;  conditional E-value: 0.66
     PF09796 10 ltkygpnlalfGgaagagvlfF 31
                +  +++++alfG++ +agv+  
  ABA57005.1  8 FLIIALIAALFGFTGLAGVATH 29
                566899*************975 PP

>> PF00902  Sec-independent protein translocase protein (TatC)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.1   6.2      0.44   3.5e+02      70     117 ..       1      48 [.       1      50 [. 0.94

  Alignments for each domain:
  == domain 1    score: 3.1 bits;  conditional E-value: 0.44
     PF00902  70 vaglilafPvilyqiwaFvapglyknekkavlpfliaslllfllGaaf 117
                 ++g+ ++f +i+    +F   gl     ++++++++++l+lf++++++
  ABA57005.1   1 MFGWAVTFLIIALIAALFGFTGLAGVATHIAWILFVVGLILFVVFLLL 48 
                 58999**************************************99887 PP

>> PF01127  Succinate dehydrogenase/Fumarate reductase transmembrane subunit
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.5   5.9      0.48   3.8e+02      35      80 ..       3      46 ..       1      52 [. 0.47

  Alignments for each domain:
  == domain 1    score: 3.5 bits;  conditional E-value: 0.48
     PF01127 35 v.lllhlllwlllllslgspesfeavvallsspiklilllllllall 80
                + ++ +l+++l+++l   ++ + + v+  ++ +++++  l+l++++l
  ABA57005.1  3 GwAVTFLIIALIAAL--FGFTGLAGVATHIAWILFVVG-LILFVVFL 46
                444455555444444..555555666544542234444.44444443 PP

>> PF03169  OPT oligopeptide transporter protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.9   7.6      0.48   3.8e+02     352     394 ..       4      48 ..       2      52 .. 0.72

  Alignments for each domain:
  == domain 1    score: 1.9 bits;  conditional E-value: 0.48
     PF03169 352 wylallvlslvlgvilvealfg..tqlpvwglllalllaallaip 394
                 w + +l+++l+ +++ +++l g  t++ +++++++l+l +++++ 
  ABA57005.1   4 WAVTFLIIALIAALFGFTGLAGvaTHIAWILFVVGLILFVVFLLL 48 
                 777778888888888888777765777777777777777777765 PP

>> PF07690  Major Facilitator Superfamily
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.6  10.7       1.6   1.3e+03     134     178 ..       3      54 ..       1      56 [] 0.54

  Alignments for each domain:
  == domain 1    score: 0.6 bits;  conditional E-value: 1.6
     PF07690 134 Gailgpllggllasslg.......WravFlilailsllaavlvllllprepp 178
                 G +++ l+ +l+a+++g        + + +il +++l+++v++lll +r +p
  ABA57005.1   3 GWAVTFLIIALIAALFGftglagvATHIAWILFVVGLILFVVFLLLGRRGRP 54 
                 4555555555555555522244444444788888888887765566555555 PP

>> PF02361  Cobalt transport protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.1   5.8       0.5     4e+02      30      72 ..       4      45 ..       1      52 [. 0.65

  Alignments for each domain:
  == domain 1    score: 3.1 bits;  conditional E-value: 0.5
     PF02361 30 fvflsvifllvlfvfliaklpsaiksitlllllllfvlwfifl 72
                + +  +i++l+ ++f++ +l   + ++++ +l+ + ++ f+++
  ABA57005.1  4 WAVTFLIIALIAALFGFTGLA-GVATHIAWILFVVGLILFVVF 45
                555558999999999999999.555555555555555555444 PP

>> PF12576  Protein of unknown function (DUF3754)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.1   3.1      0.53   4.2e+02      73     106 ..      10      42 ..       1      51 [. 0.42

  Alignments for each domain:
  == domain 1    score: 3.1 bits;  conditional E-value: 0.53
     PF12576  73 viavlvkivkkillllanillaallialvaliaf 106
                 +ia+++ +++ ++l+ ++ ++a+ l+++  li f
  ABA57005.1  10 IIALIAALFGFTGLAGVATHIAWILFVVG-LILF 42 
                 44444444444444444433333332222.2222 PP

>> PF04304  Protein of unknown function (DUF454)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.5   6.8      0.61   4.8e+02      32      69 ..      10      46 ..       4      51 .. 0.58

  Alignments for each domain:
  == domain 1    score: 3.5 bits;  conditional E-value: 0.61
     PF04304 32 alllmllsfaisliflvpslwvkilllvlllgvliwil 69
                +++l++++f+++ +  v++ ++ ++l v++l++ + +l
  ABA57005.1 10 IIALIAALFGFTGLAGVAT-HIAWILFVVGLILFVVFL 46
                6666677777775555555.555555555554444333 PP

>> PF08592  Domain of unknown function (DUF1772)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.0   4.0      0.64   5.1e+02      42      83 ..       6      44 ..       1      50 [. 0.40

  Alignments for each domain:
  == domain 1    score: 3.0 bits;  conditional E-value: 0.64
     PF08592 42 lltallfaylav.atlsrsgnvaaallylaaallllgivpfTl 83
                ++ +++    a+ a+l +  + a   + +a+ l+++g+++f +
  ABA57005.1  6 VTFLII----ALiAALFGFTGLAGVATHIAWILFVVGLILFVV 44
                222222....222223333334444444444444444444433 PP

>> PF09685  Chloroplast import component protein (Tic20)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.5   3.7      0.69   5.5e+02      31      71 ..       6      46 ..       1      53 [. 0.61

  Alignments for each domain:
  == domain 1    score: 3.5 bits;  conditional E-value: 0.69
     PF09685 31 llflalqvillvikwipligklllafwlvvalaalflwlvl 71
                ++fl +++i  ++ +  l+g      w+++ +  ++ +++l
  ABA57005.1  6 VTFLIIALIAALFGFTGLAGVATHIAWILFVVGLILFVVFL 46
                56666777777777777776666665555544444444443 PP

>> PF05745  Chlamydia 15 kDa cysteine-rich outer membrane protein (CRPA)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.7   3.4      0.81   6.5e+02      74     111 ..       8      45 ..       3      51 .. 0.81

  Alignments for each domain:
  == domain 1    score: 2.7 bits;  conditional E-value: 0.81
     PF05745  74 lLviaglallfilqaqlganafylliPaviGlvkllvt 111
                 +L+ia +a lf +++ +g+ +    i  v+Gl+ ++v 
  ABA57005.1   8 FLIIALIAALFGFTGLAGVATHIAWILFVVGLILFVVF 45 
                 78999999999999999998888888889998876664 PP

>> PF01769  Divalent cation transporter
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.3   4.2      0.74   5.9e+02      53      96 ..       7      48 ..       1      50 [. 0.59

  Alignments for each domain:
  == domain 1    score: 3.3 bits;  conditional E-value: 0.74
     PF01769 53 gallgvvavlfaallvvelegvatllaivvavalvvslvlatil 96
                ++  +++a++ a + +  l+gvat +a +++v  ++++v+ ++l
  ABA57005.1  7 TF--LIIALIAALFGFTGLAGVATHIAWILFVVGLILFVVFLLL 48
                33..3455555555566677777777777766666666665554 PP

>> PF04932  O-Antigen ligase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.2   5.1      0.28   2.2e+02       1      36 [.      14      49 ..      14      55 .. 0.85

  Alignments for each domain:
  == domain 1    score: 4.2 bits;  conditional E-value: 0.28
     PF04932  1 ivlllsllalfltnsRsaiigvlvalivlillfykn 36
                i++l++++ l +  +  a+i ++v+li+++++++  
  ABA57005.1 14 IAALFGFTGLAGVATHIAWILFVVGLILFVVFLLLG 49
                67899***************9999999998877654 PP

>> PF07062  Clc-like
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.6   4.6       1.1     9e+02     101     126 ..       2      27 ..       1      50 [. 0.57

  Alignments for each domain:
  == domain 1    score: 1.6 bits;  conditional E-value: 1.1
     PF07062 101 ygWhkavlilllislllaalsllsgi 126
                 +gW  + li+ li+ l+ +  l+ ++
  ABA57005.1   2 FGWAVTFLIIALIAALFGFTGLAGVA 27 
                 99***********9998776665422 PP

>> PF06011  Transient receptor potential (TRP) ion channel
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.9   6.4      0.87   6.9e+02     502     541 ..       6      48 ..       2      49 .. 0.69

  Alignments for each domain:
  == domain 1    score: 0.9 bits;  conditional E-value: 0.87
     PF06011 502 tallfiaFsr.elgls..eivktvvGvvilvihaivalvllil 541
                 +++l+ia++   +g++    v+t ++++++v+ +i+++v+l+l
  ABA57005.1   6 VTFLIIALIAaLFGFTglAGVATHIAWILFVVGLILFVVFLLL 48 
                 455555555413344311568999***************9987 PP

>> PF09991  Predicted membrane protein (DUF2232)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.6   5.5      0.94   7.4e+02     206     245 ..       5      44 ..       2      49 .. 0.74

  Alignments for each domain:
  == domain 1    score: 1.6 bits;  conditional E-value: 0.94
     PF09991 206 lvwlliialllllllkkeegslltsiglnllvvlslllli 245
                 +v++liial++ l++ +    ++t i++ l+vv ++l+++
  ABA57005.1   5 AVTFLIIALIAALFGFTGLAGVATHIAWILFVVGLILFVV 44 
                 6888888888888888888777777777777776666654 PP

>> PF05297  Herpesvirus latent membrane protein 1 (LMP1)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.8   4.2      0.74   5.9e+02      90     127 ..       6      44 ..       1      53 [. 0.50

  Alignments for each domain:
  == domain 1    score: 1.8 bits;  conditional E-value: 0.74
     PF05297  90 itlllialw.nlhgqalylgivlfifgcllvlglwiyle 127
                 +t+l+ial   l+g +   g+   i   l+v+gl +++ 
  ABA57005.1   6 VTFLIIALIaALFGFTGLAGVATHIAWILFVVGLILFVV 44 
                 444555543134555555555555555555555544432 PP

>> PF01284  Membrane-associating domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.4   8.5         1   8.1e+02      43      91 ..       3      48 ..       1      50 [. 0.65

  Alignments for each domain:
  == domain 1    score: 2.4 bits;  conditional E-value: 1
     PF01284 43 nfavfvavfsflyalallllylfknkyftsilwplidlivdalaallwl 91
                ++av++ ++++++al+++   ++    +t i+w l+++++ + +++l l
  ABA57005.1  3 GWAVTFLIIALIAALFGFTGLAG---VATHIAWILFVVGLILFVVFLLL 48
                56666666666666666666554...77888887777777777666655 PP

>> PF03908  Sec20
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.3   1.7       1.1   9.1e+02      73      91 ..      33      51 ..      24      51 .. 0.85

  Alignments for each domain:
  == domain 1    score: 2.3 bits;  conditional E-value: 1.1
     PF03908 73 vflalglflacvvyvvkkR 91
                +++ +gl+l++v+ ++ +R
  ABA57005.1 33 ILFVVGLILFVVFLLLGRR 51
                7788999999999999988 PP

>> PF11239  Protein of unknown function (DUF3040)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.5   7.4       1.2   9.8e+02      39      80 ..       6      47 ..       2      49 .. 0.76

  Alignments for each domain:
  == domain 1    score: 2.5 bits;  conditional E-value: 1.2
     PF11239 39 errivlgvllavlGlvllvaGvvlqlvi.lgvaGflvmlagvl 80
                   +++++++a++G++ l aGv++++ + l v+G+++ ++ +l
  ABA57005.1  6 VTFLIIALIAALFGFTGL-AGVATHIAWiLFVVGLILFVVFLL 47
                55678999999***9665.78888877669999*888887665 PP

>> PF02495  7kD viral coat protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -1.6   6.3        16   1.3e+04       3      18 ..      33      48 ..       3      55 .. 0.84

  Alignments for each domain:
  == domain 1    score: -1.6 bits;  conditional E-value: 16
     PF02495  3 llaligllvallalyl 18
                +l+++gl++++++l l
  ABA57005.1 33 ILFVVGLILFVVFLLL 48
                7889999999998877 PP

>> PF05101  Type IV secretory pathway, VirB3-like protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.9   5.5       1.8   1.4e+03      30      58 ..      11      39 ..       5      51 .. 0.51

  Alignments for each domain:
  == domain 1    score: 1.9 bits;  conditional E-value: 1.8
     PF05101 30 sgllavlliliissllaaligvllwavar 58
                + l+a+l+++++   +a+ i+ +l++v+ 
  ABA57005.1 11 IALIAALFGFTGLAGVATHIAWILFVVGL 39
                44555555555554444444444444432 PP

>> PF04341  Protein of unknown function, DUF485
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.6   0.9       1.9   1.5e+03      55      70 ..       3      18 ..       1      25 [. 0.50
   2 ?    4.7   3.9       0.2   1.6e+02       7      35 ..      20      48 ..      14      51 .. 0.86

  Alignments for each domain:
  == domain 1    score: 1.6 bits;  conditional E-value: 1.9
     PF04341 55 gillglgqfvltfllt 70
                g+++ +++++l  +l 
  ABA57005.1  3 GWAVTFLIIALIAALF 18
                4444444444444443 PP

  == domain 2    score: 4.7 bits;  conditional E-value: 0.2
     PF04341  7 fkeLvrkrrrfalpltalmlvlYfgfill 35
                f  L+   +++a++l ++ l+l+++f+ll
  ABA57005.1 20 FTGLAGVATHIAWILFVVGLILFVVFLLL 48
                77788888999***************998 PP

>> PF07884  Vitamin K epoxide reductase family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.0   6.2       1.4   1.1e+03      64     103 ..       6      47 ..       1      49 [. 0.65

  Alignments for each domain:
  == domain 1    score: 2.0 bits;  conditional E-value: 1.4
     PF07884  64 ilaylvvlllavlllarv..tlsrwawlllllgslvgvvfsl 103
                 + + ++ l++a+++++++      +aw+l+++g+++ vvf l
  ABA57005.1   6 VTFLIIALIAALFGFTGLagVATHIAWILFVVGLILFVVFLL 47 
                 444455567777777766756677777777777777777754 PP

>> PF08510  PIG-P
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.1   1.5     0.063        50      45      69 ..       4      28 ..       3      32 .. 0.90
   2 ?    1.1   2.1       2.3   1.8e+03       9      26 ..      30      47 ..      25      51 .. 0.70

  Alignments for each domain:
  == domain 1    score: 6.1 bits;  conditional E-value: 0.063
     PF08510 45 Walaipilllvlllfaylvlallnl 69
                Wa+++ i++l++ lf +++la++ +
  ABA57005.1  4 WAVTFLIIALIAALFGFTGLAGVAT 28
                *******************998766 PP

  == domain 2    score: 1.1 bits;  conditional E-value: 2.3
     PF08510  9 vlyllstllfllyllWaf 26
                + ++l++++++l+++  +
  ABA57005.1 30 IAWILFVVGLILFVVFLL 47
                567777777777777655 PP

>> PF00487  Fatty acid desaturase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.4   8.3       1.5   1.2e+03     135     176 ..       7      44 ..       2      52 .. 0.37

  Alignments for each domain:
  == domain 1    score: 1.4 bits;  conditional E-value: 1.5
     PF00487 135 allilalllalaglllllsglgalllyvvplalaltvlllvn 176
                 + li+al++al+g+     gl++++  +++ +++++++l+v 
  ABA57005.1   7 TFLIIALIAALFGF----TGLAGVATHIAWILFVVGLILFVV 44 
                 34444444444444....333322222222222222222222 PP

>> PF04123  Domain of unknown function (DUF373)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.0   5.0       1.4   1.1e+03     161     199 ..       7      43 ..       2      50 .. 0.69

  Alignments for each domain:
  == domain 1    score: 1.0 bits;  conditional E-value: 1.4
     PF04123 161 tilgvpGlllliyallallnlsavalavillilGlyllv 199
                 t+l +++l++ +++++ l+++ a+ +a il+++Gl l+v
  ABA57005.1   7 TFL-IIALIAALFGFTGLAGV-ATHIAWILFVVGLILFV 43 
                 556.66666666666666666.66788888888887765 PP

>> PF06749  Protein of unknown function (DUF1218)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.2   1.9         2   1.6e+03      36      56 ..       4      24 ..       2      28 .. 0.85
   2 ?    6.8   2.7     0.073        58      36      57 ..      23      44 ..      19      52 .. 0.87

  Alignments for each domain:
  == domain 1    score: 2.2 bits;  conditional E-value: 2
     PF06749 36 lavvlfviswvlfvvavalll 56
                +av +++i++++++++++ l+
  ABA57005.1  4 WAVTFLIIALIAALFGFTGLA 24
                7999********999998776 PP

  == domain 2    score: 6.8 bits;  conditional E-value: 0.073
     PF06749 36 lavvlfviswvlfvvavallla 57
                la v  +i+w+lfvv+ +l+++
  ABA57005.1 23 LAGVATHIAWILFVVGLILFVV 44
                6889999***********9987 PP

>> PF12606  Tumour necrosis factor receptor superfamily member 19
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.6   0.5       2.5     2e+03       3      13 ..       7      15 ..       5      23 .. 0.61
   2 ?    5.3   1.7     0.087        69       8      24 ..      32      48 ..      26      52 .. 0.76

  Alignments for each domain:
  == domain 1    score: 0.6 bits;  conditional E-value: 2.5
     PF12606  3 afllVsiffvm 13
                +fl++ ++  +
  ABA57005.1  7 TFLIIALI--A 15
                66776655..3 PP

  == domain 2    score: 5.3 bits;  conditional E-value: 0.087
     PF12606  8 siffvmglLgllictll 24
                 i fv+gl+++++  ll
  ABA57005.1 32 WILFVVGLILFVVFLLL 48
                68999999999987655 PP

>> PF06570  Protein of unknown function (DUF1129)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.8   5.1       2.3   1.8e+03     152     198 ..       7      50 ..       1      52 [. 0.52

  Alignments for each domain:
  == domain 1    score: 0.8 bits;  conditional E-value: 2.3
     PF06570 152 lllivvvwlvlftlvsllpkviNpvLpplvliiigvvalvvryylkk 198
                 ++li++++ +lf ++ l       +  +++l+++g + +vv  +l +
  ABA57005.1   7 TFLIIALIAALFGFTGLAGV---ATHIAWILFVVGLILFVVFLLLGR 50 
                 33444444444444444332...222467777778887777776655 PP

>> PF11893  Domain of unknown function (DUF3413)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.0   4.5       1.3     1e+03      55      80 ..      24      48 ..      10      53 .. 0.71

  Alignments for each domain:
  == domain 1    score: 1.0 bits;  conditional E-value: 1.3
     PF11893 55 vsllghfsllafllyllvlfplslil 80
                +++ +h++ + f+++l +lf + l+l
  ABA57005.1 24 AGVATHIAWILFVVGL-ILFVVFLLL 48
                4567799999999999.777766665 PP

>> PF07123  Photosystem II reaction centre W protein (PsbW)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.2   2.2       1.4   1.1e+03     101     123 ..      28      50 ..      21      53 .. 0.81

  Alignments for each domain:
  == domain 1    score: 2.2 bits;  conditional E-value: 1.4
     PF07123 101 naLgwiLlgvfgliwslYfiytk 123
                 + + wiL+ v ++++ ++++ ++
  ABA57005.1  28 THIAWILFVVGLILFVVFLLLGR 50 
                 5678****999999999988765 PP

>> PF08571  Yos1-like
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.8   2.4         2   1.6e+03      54      80 .]      23      49 ..       8      49 .. 0.90

  Alignments for each domain:
  == domain 1    score: 1.8 bits;  conditional E-value: 2
     PF08571 54 isavrtlmrlpLiaiNivvivyeLvlG 80
                +  v t + + L ++ +++ v+ L+lG
  ABA57005.1 23 LAGVATHIAWILFVVGLILFVVFLLLG 49
                567999999*********999999998 PP

>> PF02516  Oligosaccharyl transferase STT3 subunit
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.1   4.7       1.7   1.4e+03     178     210 ..      15      46 ..       2      53 .. 0.39

  Alignments for each domain:
  == domain 1    score: 0.1 bits;  conditional E-value: 1.7
     PF02516 178 avlaalliflmvlaWggyaifllivlllfilal 210
                 a+l++++ +  v++  ++ i++++ l+lf++ l
  ABA57005.1  15 AALFGFTGLAGVATHIAW-ILFVVGLILFVVFL 46 
                 333333333444444444.22222222222222 PP

>> PF05814  Baculovirus protein of unknown function (DUF843)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.4   6.2       2.3   1.9e+03       4      40 ..      11      48 ..       4      50 .. 0.52

  Alignments for each domain:
  == domain 1    score: 1.4 bits;  conditional E-value: 2.3
     PF05814  4 illlialivlafildkneklse.llltllllfvlFiil 40
                i+l+ al  ++ +   ++++   l+++ l+lfv+F++l
  ABA57005.1 11 IALIAALFGFTGLAGVATHIAWiLFVVGLILFVVFLLL 48
                333333333333444444444314455599*****975 PP

>> PF02468  Photosystem II reaction centre N protein (psbN)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.8   1.5     0.086        68       5      22 ..       7      24 ..       2      28 .. 0.92
   2 ?    0.5   0.8       3.7     3e+03       7      16 ..      39      48 ..      25      52 .. 0.65

  Alignments for each domain:
  == domain 1    score: 5.8 bits;  conditional E-value: 0.086
     PF02468  5 tllaifiavlllsiTgYs 22
                t+l i++ ++l ++Tg +
  ABA57005.1  7 TFLIIALIAALFGFTGLA 24
                7999************86 PP

  == domain 2    score: 0.5 bits;  conditional E-value: 3.7
     PF02468  7 laifiavlll 16
                l +f+++lll
  ABA57005.1 39 LILFVVFLLL 48
                3445555555 PP

>> PF01277  Oleosin
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.0   5.6       2.4   1.9e+03      10      43 ..      12      45 ..       4      47 .. 0.57

  Alignments for each domain:
  == domain 1    score: 1.0 bits;  conditional E-value: 2.4
     PF01277 10 talpvggvLLvLagltlagtvialavatPlfviF 43
                +++ +   + +Lag++   + i ++v + lfv+F
  ABA57005.1 12 ALIAALFGFTGLAGVATHIAWILFVVGLILFVVF 45
                2222223344566666666666677888888888 PP

>> PF02038  ATP1G1/PLM/MAT8 family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.1   1.8      0.19   1.5e+02      21      32 ..      30      41 ..      22      49 .. 0.88

  Alignments for each domain:
  == domain 1    score: 4.1 bits;  conditional E-value: 0.19
                CCCCCTT---CC CS
     PF02038 21 fAgvLfivGili 32
                +A +Lf+vG+++
  ABA57005.1 30 IAWILFVVGLIL 41
                5789*****997 PP

>> PF05421  Protein of unknown function (DUF751)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -0.3   7.5        11   8.9e+03      36      55 ..      28      47 ..       7      49 .. 0.90

  Alignments for each domain:
  == domain 1    score: -0.3 bits;  conditional E-value: 11
     PF05421 36 taialiiiliggllflslvl 55
                t ia i++++g++lf+++ l
  ABA57005.1 28 THIAWILFVVGLILFVVFLL 47
                78999************987 PP

>> PF11821  Protein of unknown function (DUF3341)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.4   1.5       1.6   1.3e+03      52      68 ..      11      27 ..       1      37 [. 0.61
   2 ?    2.4   1.9      0.81   6.4e+02      49      70 ..      27      48 ..      19      50 .. 0.85

  Alignments for each domain:
  == domain 1    score: 1.4 bits;  conditional E-value: 1.6
     PF11821 52 lplvallaGltGaaval 68
                ++l+a l+G+tG+a   
  ABA57005.1 11 IALIAALFGFTGLAGVA 27
                56666677777766443 PP

  == domain 2    score: 2.4 bits;  conditional E-value: 0.81
     PF11821 49 ksrlplvallaGltGaavalll 70
                 + ++++ +++Gl+  +v lll
  ABA57005.1 27 ATHIAWILFVVGLILFVVFLLL 48
                689**********999998876 PP

>> PF04790  Sarcoglycan complex subunit protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.0   2.1       3.2   2.5e+03       4      31 ..      21      48 ..      19      49 .. 0.84

  Alignments for each domain:
  == domain 1    score: 0.0 bits;  conditional E-value: 3.2
     PF04790  4 vGiyGrrkrclylvvlLLllllvvNLil 31
                +G+ G  + +++++ ++ l+l vv L+l
  ABA57005.1 21 TGLAGVATHIAWILFVVGLILFVVFLLL 48
                6899999999999999999999988876 PP

>> PF05360  yiaA/B two helix domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.8   1.7         3   2.4e+03       8      19 ..       8      19 ..       1      26 [. 0.57
   2 ?    6.2   1.8      0.06        48       4      18 ..      30      44 ..      27      48 .. 0.89

  Alignments for each domain:
  == domain 1    score: 0.8 bits;  conditional E-value: 3
     PF05360  8 afvlgvvlyliG 19
                 +++++ + l+G
  ABA57005.1  8 FLIIALIAALFG 19
                444444444444 PP

  == domain 2    score: 6.2 bits;  conditional E-value: 0.06
     PF05360  4 lawvafvlgvvlyli 18
                +aw++fv+g+ l+ +
  ABA57005.1 30 IAWILFVVGLILFVV 44
                79********99976 PP

>> PF10003  Integral membrane protein (DUF2244)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.6   8.5       2.8   2.2e+03      10      52 ..       5      47 ..       1      53 [. 0.62

  Alignments for each domain:
  == domain 1    score: 0.6 bits;  conditional E-value: 2.8
     PF10003 10 rgfllfllalallsllialaflllgawpvlpFaglellalala 52
                +  +l+++++a+l   ++la ++++  ++l  +gl l++++l 
  ABA57005.1  5 AVTFLIIALIAALFGFTGLAGVATHIAWILFVVGLILFVVFLL 47
                4445566666666666666666666666666666666666665 PP

>> PF10861  Protein of Unknown function (DUF2784)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.9   3.6      0.77   6.1e+02       8      27 ..      25      44 ..      18      54 .. 0.74

  Alignments for each domain:
  == domain 1    score: 2.9 bits;  conditional E-value: 0.77
     PF10861  8 vvvlHllfvlFvvlGgllvl 27
                 v++H++ +lFvv+  l+v+
  ABA57005.1 25 GVATHIAWILFVVGLILFVV 44
                5899*******997666554 PP

>> PF04749  PLAC8 family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.8   0.9       2.8   2.3e+03      22      46 ..       7      31 ..       1      53 [. 0.38

  Alignments for each domain:
  == domain 1    score: 1.8 bits;  conditional E-value: 2.8
     PF04749 22 pcvlfgknaerlgegsksehagscl 46
                ++++++ +a  +g+    + a+  +
  ABA57005.1  7 TFLIIALIAALFGFTGLAGVATHIA 31
                4444444444444433222112222 PP

>> PF09851  Predicted membrane protein (DUF2078)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.0   2.5       1.4   1.1e+03      12      28 ..       3      18 ..       1      29 [. 0.42
   2 ?    5.0   5.0      0.17   1.4e+02       7      29 ..      26      49 ..      18      55 .. 0.61

  Alignments for each domain:
  == domain 1    score: 2.0 bits;  conditional E-value: 1.4
     PF09851 12 mlllwlllialvvyllv 28
                ++ + +l+ial+  +l+
  ABA57005.1  3 GWAVTFLIIALIA-ALF 18
                3333333333333.222 PP

  == domain 2    score: 5.0 bits;  conditional E-value: 0.17
     PF09851  7 w.ggllmlllwlllialvvyllvr 29
                +   + ++l+ + li++vv+ll+ 
  ABA57005.1 26 VaTHIAWILFVVGLILFVVFLLLG 49
                245567777777777777777764 PP

>> PF01061  ABC-2 type transporter
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -0.2   8.8       3.9   3.1e+03     131     173 ..       5      47 ..       1      50 [. 0.34

  Alignments for each domain:
  == domain 1    score: -0.2 bits;  conditional E-value: 3.9
     PF01061 131 flllllltalfasslgllisalapsfedasqlasllllpllll 173
                 ++ +l++ +++a++ +  ++ +a+++  + ++++l+l++ +ll
  ABA57005.1   5 AVTFLIIALIAALFGFTGLAGVATHIAWILFVVGLILFVVFLL 47 
                 3333333333333333333333333333333333333333333 PP

>> PF11460  Protein of unknown function (DUF3007)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.4   4.7       5.6   4.4e+03      21      50 ..      15      43 ..       2      53 .. 0.49

  Alignments for each domain:
  == domain 1    score: 0.4 bits;  conditional E-value: 5.6
     PF11460 21 ylllqalGldalsAgiasqavlvlivvgWv 50
                 +l+ + Gl ++ A+ ++ +++v++++  v
  ABA57005.1 15 AALFGFTGLAGV-ATHIAWILFVVGLILFV 43
                444555555444.33333444444444443 PP

>> PF06724  Domain of Unknown Function (DUF1206)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -5.2  10.5   1.3e+02     1e+05       6      25 ..       3      22 ..       1      53 [. 0.65

  Alignments for each domain:
  == domain 1    score: -5.2 bits;  conditional E-value: 1.3e+02
     PF06724  6 arGvvylllgvlalqaalgg 25
                + +v++l+++++a+ + ++g
  ABA57005.1  3 GWAVTFLIIALIAALFGFTG 22
                56788888888888888843 PP

>> PF00672  HAMP domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.6   1.7       1.3     1e+03       3      17 ..       6      20 ..       4      29 .. 0.63
   2 ?    4.1   2.0      0.43   3.4e+02       3      22 ..      32      51 ..      30      56 .] 0.60

  Alignments for each domain:
  == domain 1    score: 2.6 bits;  conditional E-value: 1.3
                --TTT-------HHH CS
     PF00672  3 vvlllalllalvlaw 17
                v++l+++l+a+++++
  ABA57005.1  6 VTFLIIALIAALFGF 20
                556666666666655 PP

  == domain 2    score: 4.1 bits;  conditional E-value: 0.43
                --TTT-------HHHH--HH CS
     PF00672  3 vvlllalllalvlawllarr 22
                ++l+++ l+++v+ +ll rr
  ABA57005.1 32 WILFVVGLILFVVFLLLGRR 51
                56666666666666666666 PP

>> PF12273  Chitin synthesis regulation, resistance to Congo red
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.1   1.1       4.6   3.7e+03       2      18 ..       4      20 ..       3      25 .. 0.56
   2 ?    5.4   1.9      0.21   1.7e+02       2      18 ..      32      48 ..      30      54 .. 0.47

  Alignments for each domain:
  == domain 1    score: 1.1 bits;  conditional E-value: 4.6
     PF12273  2 Wvlfaiivvallilffl 18
                W++  +i++++ +lf +
  ABA57005.1  4 WAVTFLIIALIAALFGF 20
                66666655555444433 PP

  == domain 2    score: 5.4 bits;  conditional E-value: 0.21
     PF12273  2 Wvlfaiivvallilffl 18
                W+lf++ +++++++++l
  ABA57005.1 32 WILFVVGLILFVVFLLL 48
                55555544444333333 PP

>> PF03929  PepSY-associated TM helix
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -6.8  12.5   1.3e+02     1e+05       6      21 ..      28      46 ..       1      46 [. 0.70

  Alignments for each domain:
  == domain 1    score: -6.8 bits;  conditional E-value: 1.3e+02
     PF03929  6 r...ylgglaallllvlll 21
                +   +++++++l+l+v++l
  ABA57005.1 28 ThiaWILFVVGLILFVVFL 46
                0456999999999999875 PP

>> PF06781  Uncharacterised protein family (UPF0233)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -0.7   5.4         9   7.2e+03      36      53 ..      30      47 ..       2      54 .. 0.84

  Alignments for each domain:
  == domain 1    score: -0.7 bits;  conditional E-value: 9
     PF06781 36 lmvalmllGllwlvvfyl 53
                +   l+++Gl+  vvf l
  ABA57005.1 30 IAWILFVVGLILFVVFLL 47
                455689999999999977 PP

>> PF10947  Protein of unknown function (DUF2628)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -0.9   7.8        11   8.9e+03      67      93 ..       9      44 ..       1      53 [. 0.39

  Alignments for each domain:
  == domain 1    score: -0.9 bits;  conditional E-value: 11
     PF10947 67 valaivllllei.........akglallllllialv 93
                + +a++++l+++          +++ +++ l++ +v
  ABA57005.1  9 LIIALIAALFGFtglagvathIAWILFVVGLILFVV 44
                333333333333334223333444444333333222 PP

>> PF02656  Domain of unknown function DUF
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.9   2.5      0.53   4.2e+02      52      67 ..       5      20 ..       2      23 .. 0.91
   2 ?    2.3   1.5       1.6   1.3e+03      47      64 ..      26      43 ..      21      49 .. 0.72

  Alignments for each domain:
  == domain 1    score: 3.9 bits;  conditional E-value: 0.53
     PF02656 52 gltfiglailvllygl 67
                ++tf+++a++++l+g+
  ABA57005.1  5 AVTFLIIALIAALFGF 20
                89************98 PP

  == domain 2    score: 2.3 bits;  conditional E-value: 1.6
     PF02656 47 lgkplgltfiglailvll 64
                ++  ++++++++++++++
  ABA57005.1 26 VATHIAWILFVVGLILFV 43
                556677788888877776 PP

>> PF07589  PEP-CTERM motif
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.1   2.6       7.2   5.7e+03      10      18 ..      17      26 ..       5      29 .. 0.64
   2 ?    5.0   3.0       0.2   1.6e+02       8      25 .]      32      51 ..      30      53 .. 0.76

  Alignments for each domain:
  == domain 1    score: 0.1 bits;  conditional E-value: 7.2
     PF07589 10 LlglG.Lagl 18
                L+g+  Lag+
  ABA57005.1 17 LFGFTgLAGV 26
                4444335555 PP

  == domain 2    score: 5.0 bits;  conditional E-value: 0.2
     PF07589  8 laLlglGLaglga..lrrRR 25
                ++L+ +GL++++   l+ RR
  ABA57005.1 32 WILFVVGLILFVVflLLGRR 51
                89*****7777777755555 PP



Internal pipeline statistics summary:
-------------------------------------
Query sequence(s):                         1  (56 residues)
Target model(s):                       11912  (2158902 nodes)
Passed MSV filter:                       920  (0.077233); expected 238.2 (0.02)
Passed bias filter:                      663  (0.0556582); expected 238.2 (0.02)
Passed Vit filter:                       166  (0.0139355); expected 11.9 (0.001)
Passed Fwd filter:                       166  (0.0139355); expected 0.1 (1e-05)
Initial search space (Z):             100000  [as set by --Z on cmdline]
Domain search space  (domZ):             126  [number of targets reported over threshold]
# CPU time: 0.28u 0.05s 00:00:00.33 Elapsed: 00:00:00
# Mc/sec: 431.78
//