# hmmscan :: search sequence(s) against a profile HMM database
# HMMER 3.0b2 (June 2009); http://hmmer.org/
# Copyright (C) 2009 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query sequence file:             /home/niguts/usr08/shisakam/FASTA/gib_20038.fasta
# target HMM database:             /home/niguts/usr08/shisakam/PFAM/ver24.0/Pfam-A.hmm
# sequence search space set to:    100000
# set reporting thresholds to:     GA cutoffs
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       ABA57493.1  [L=218]
Description: noce0 ABA57493.1 GIB00281CH01 "conserved hypothetical protein"
Scores for complete sequence (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Model    Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
  ------ inclusion threshold ------
       0.76   11.9   0.0        1.2   11.2   0.0    1.3  1  PF01464  Transglycosylase SLT domain
        1.3   11.9   2.5        2.2   11.2   1.7    1.4  1  PF08139  Prokaryotic membrane lipoprotein lipid attachment s
        3.1   10.6   0.0        6.4    9.6   0.0    1.6  1  PF06474  MLTD_N
         20    7.5   0.1         35    6.8   0.1    1.3  1  PF09619  Type III secretion system lipoprotein chaperone (Ys
         21    7.0   0.0         31    6.5   0.0    1.4  1  PF11153  Protein of unknown function (DUF2931)
         59    6.4   0.5    2.6e+02    4.3   0.2    2.0  1  PF08802  Cytochrome B6-F complex Fe-S subunit
         66    6.0   0.0    2.3e+02    4.3   0.0    1.8  1  PF00317  Ribonucleotide reductase, all-alpha domain
         86    4.9   0.1    1.3e+02    4.3   0.0    1.2  1  PF12319  Tryptophan-Threonine-rich plasmodium antigen C term
      1e+02    5.1   0.4    1.6e+02    4.5   0.3    1.3  1  PF08085  Entericidin EcnA/B family
    1.2e+02    4.9   0.1      3e+02    3.6   0.1    1.6  1  PF07653  Variant SH3 domain
    1.2e+02    4.6   0.1    1.6e+02    4.2   0.0    1.1  1  PF03357  Snf7
    1.3e+02    5.3   0.3    3.7e+02    3.9   0.2    1.7  1  PF08086  Ergtoxin family
    1.5e+02    5.3   0.0    2.4e+02    4.6   0.0    1.2  1  PF09537  Domain of unknown function (DUF2383)
    1.8e+02    4.1   0.0    2.7e+02    3.5   0.0    1.2  1  PF09476  Pilus biogenesis CpaD protein (pilus_cpaD)
    2.3e+02    4.9   0.5    6.1e+02    3.6   0.3    1.7  1  PF08259  Periviscerokinin family
    2.4e+02    3.6   0.0    3.2e+02    3.2   0.0    1.2  1  PF11769  Protein of unknown function (DUF3313)
    2.5e+02    4.1   0.0    4.5e+02    3.3   0.0    1.4  1  PF07119  Protein of unknown function (DUF1375)
    5.9e+02    2.1   0.0    8.3e+02    1.6   0.0    1.1  1  PF09614  CRISPR-associated protein (Cas_Csy2)
      7e+02    2.7   2.1    1.4e+03    1.7   1.5    1.5  1  PF04995  Heme exporter protein D (CcmD)
      1e+03    2.4   0.2    1.5e+03    1.9   0.1    1.2  1  PF01201  Ribosomal protein S8e
    4.4e+03    1.1   1.9    5.2e+03    0.9   0.2    1.8  1  PF10578  Seminal vesicle protein repeat


Domain and alignment annotation for each model:
>> PF01464  Transglycosylase SLT domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   11.2   0.0   0.00026       1.2       2     106 ..      54     170 ..      53     179 .. 0.86

  Alignments for each domain:
  == domain 1    score: 11.2 bits;  conditional E-value: 0.00026
                 HHHHHH-TTSS-HHHHHHHHHHHHTT-TT---....---.............-B----B-TTTCHHHHHHHT...---HHCCSHHHHHHHHHHHHHHHH CS
     PF01464   2 lilaaeeaygvepsllaaiaqqESsfnpkaisinknksg.............avGLmQinsstakalglkvs...lseddlldPcknisagakyLksll 84 
                 + ++ e+++g +  +l+a + +ESsf+ +a      +               a+G  Qi +++++ +   ++   +s+ d+ d  + i    ++ +++l
  ABA57493.1  54 YAKESEKKWGTPTPILMAFIHRESSFRGDARP----PRRwflgfiplprsssAYGYGQIQDPAWEDYLGANGgwfKSRADMEDVLDFIGWYNHISARRL 148
                 6788999************************9....777788899******9************99988877788888888888888888888888888 PP

                 CCS-HHHHHHHHHHH-----HH CS
     PF01464  85 ksyggnlrealaaYNaGagtvk 106
                 +  + n ++ + aY+ G++ ++
  ABA57493.1 149 GISKRNPEHLYLAYHEGHRGYQ 170
                 8888899999999999987655 PP

>> PF08139  Prokaryotic membrane lipoprotein lipid attachment site
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   11.2   1.7   0.00046       2.2      10      26 .]      15      32 ..      14      32 .. 0.89

  Alignments for each domain:
  == domain 1    score: 11.2 bits;  conditional E-value: 0.00046
     PF08139 10 kilflllallm.LaGCas 26
                k++f+ l+ll+ L+GCas
  ABA57493.1 15 KYCFIILFLLSlLTGCAS 32
                788999999999*****8 PP

>> PF06474  MLTD_N
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    9.6   0.0    0.0013       6.4       5      24 ..      18      38 ..      14      67 .. 0.83

  Alignments for each domain:
  == domain 1    score: 9.6 bits;  conditional E-value: 0.0013
     PF06474  5 avlvlal.lLvGCqstqavss 24
                +++++ l lL+GC+st++ s+
  ABA57493.1 18 FIILFLLsLLTGCASTPPAST 38
                66777777*******998876 PP

>> PF09619  Type III secretion system lipoprotein chaperone (YscW)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.8   0.1    0.0073        35       2      20 ..      21      39 ..      20      46 .. 0.82

  Alignments for each domain:
  == domain 1    score: 6.8 bits;  conditional E-value: 0.0073
     PF09619  2 lllsllltGCvtepvlkea 20
                l l+ lltGC+++p    a
  ABA57493.1 21 LFLLSLLTGCASTPPASTA 39
                8899*********986665 PP

>> PF11153  Protein of unknown function (DUF2931)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.5   0.0    0.0065        31       5      31 ..      18      52 ..      14      88 .. 0.84

  Alignments for each domain:
  == domain 1    score: 6.5 bits;  conditional E-value: 0.0065
     PF11153  5 llll.lllllagCstkaaeetq.......kkleWr 31
                +++l ll ll+gC++++ + t+       k+ eW+
  ABA57493.1 18 FIILfLLSLLTGCASTPPASTAnlcvifeKQPEWY 52
                3444233369****999998888999999888886 PP

>> PF08802  Cytochrome B6-F complex Fe-S subunit
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.3   0.2     0.054   2.6e+02      11      32 ..      23      44 ..      22      45 .. 0.92

  Alignments for each domain:
  == domain 1    score: 4.3 bits;  conditional E-value: 0.054
     PF08802 11 llNllllGavalpalgalyPyv 32
                ll+ll++ a + pa +a ++++
  ABA57493.1 23 LLSLLTGCASTPPASTANLCVI 44
                89**************999986 PP

>> PF00317  Ribonucleotide reductase, all-alpha domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.3   0.0     0.049   2.3e+02      32      61 ..     180     212 ..     177     213 .. 0.86

  Alignments for each domain:
  == domain 1    score: 4.3 bits;  conditional E-value: 0.049
     PF00317  32 fmRvAlalaiaealyd...kleedkdlaeefyd 61 
                  +RvA+ +a + ++y    k  ed+ ++++fy+
  ABA57493.1 180 LRRVAKRVARQARMYGsqlKSCEDRFKCRKFYQ 212
                 58********99988887888889999999996 PP

>> PF12319  Tryptophan-Threonine-rich plasmodium antigen C terminal
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.3   0.0     0.027   1.3e+02      28      48 ..      44      64 ..      38      76 .. 0.85

  Alignments for each domain:
  == domain 1    score: 4.3 bits;  conditional E-value: 0.027
     PF12319 28 lekkekeweewlkeienkWlh 48
                + +k+ ew ++ ke e+kW  
  ABA57493.1 44 IFEKQPEWYDYAKESEKKWGT 64
                568999*************76 PP

>> PF08085  Entericidin EcnA/B family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.5   0.3     0.033   1.6e+02       9      21 ..      18      30 ..      14      40 .. 0.70

  Alignments for each domain:
  == domain 1    score: 4.5 bits;  conditional E-value: 0.033
     PF08085  9 lalaalaflLagC 21
                +++++l+ lL+gC
  ABA57493.1 18 FIILFLLSLLTGC 30
                455666669**** PP

>> PF07653  Variant SH3 domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.6   0.1     0.063     3e+02      29      46 ..     151     169 ..     137     170 .. 0.91

  Alignments for each domain:
  == domain 1    score: 3.6 bits;  conditional E-value: 0.063
                 .EE----.EE--------- CS
     PF07653  29 dkdsdgw.wegesrGrrGl 46 
                 +k+++++ ++++  G+rG+
  ABA57493.1 151 SKRNPEHlYLAYHEGHRGY 169
                 58889999**********8 PP

>> PF03357  Snf7
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.2   0.0     0.035   1.6e+02      40      60 ..     181     201 ..     160     205 .. 0.85

  Alignments for each domain:
  == domain 1    score: 4.2 bits;  conditional E-value: 0.035
                 HHHHHHHHHHHHHHHHHHHHH CS
     PF03357  40 kdrAlllLkqkkryekqldql 60 
                 ++ A+++++q ++y +ql++ 
  ABA57493.1 181 RRVAKRVARQARMYGSQLKSC 201
                 789**************9976 PP

>> PF08086  Ergtoxin family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.9   0.2     0.077   3.7e+02       4      14 ..     200     210 ..     198     217 .. 0.84

  Alignments for each domain:
  == domain 1    score: 3.9 bits;  conditional E-value: 0.077
     PF08086   4 sCvDkskCakY 14 
                 sC D+ kC k+
  ABA57493.1 200 SCEDRFKCRKF 210
                 9*********7 PP

>> PF09537  Domain of unknown function (DUF2383)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.6   0.0      0.05   2.4e+02      14      52 ..     163     200 ..     156     203 .. 0.90

  Alignments for each domain:
  == domain 1    score: 4.6 bits;  conditional E-value: 0.05
                 HHHHHHHHHHHHH--SHHHHHHHHHHHHHHHHHHHHHHH CS
     PF09537  14 ndgeegyekaaekvkdpelkalfqemaaereqaaaeLqa 52 
                 + g++gy++ a + k p+l+ +++++a++ + + ++L++
  ABA57493.1 163 HEGHRGYQRGAWRRK-PHLRRVAKRVARQARMYGSQLKS 200
                 678999999999999.*****************999985 PP

>> PF09476  Pilus biogenesis CpaD protein (pilus_cpaD)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.5   0.0     0.057   2.7e+02       2      22 ..      20      40 ..      19      49 .. 0.82

  Alignments for each domain:
  == domain 1    score: 3.5 bits;  conditional E-value: 0.057
     PF09476  2 llalalllaaCastaaevtas 22
                +l+l+ ll++Cast+++ ta+
  ABA57493.1 20 ILFLLSLLTGCASTPPASTAN 40
                678999********9966665 PP

>> PF08259  Periviscerokinin family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.6   0.3      0.13   6.1e+02       4      10 ..      92      98 ..      92      99 .. 0.93

  Alignments for each domain:
  == domain 1    score: 3.6 bits;  conditional E-value: 0.13
     PF08259  4 GLIpfPR 10
                G Ip+PR
  ABA57493.1 92 GFIPLPR 98
                89****9 PP

>> PF11769  Protein of unknown function (DUF3313)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.2   0.0     0.066   3.2e+02       2      13 ..      26      37 ..      25      60 .. 0.86

  Alignments for each domain:
  == domain 1    score: 3.2 bits;  conditional E-value: 0.066
     PF11769  2 llagCaskpptp 13
                ll+gCas+pp +
  ABA57493.1 26 LLTGCASTPPAS 37
                89*******985 PP

>> PF07119  Protein of unknown function (DUF1375)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.3   0.0     0.095   4.5e+02       2      13 ..      21      32 ..      20      53 .. 0.85

  Alignments for each domain:
  == domain 1    score: 3.3 bits;  conditional E-value: 0.095
     PF07119  2 lalllllsGCgt 13
                l+ll+ll+GC++
  ABA57493.1 21 LFLLSLLTGCAS 32
                56777*****99 PP

>> PF09614  CRISPR-associated protein (Cas_Csy2)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.6   0.0      0.17   8.3e+02     211     232 ..      47      68 ..      31      85 .. 0.83

  Alignments for each domain:
  == domain 1    score: 1.6 bits;  conditional E-value: 0.17
     PF09614 211 seseWeskrkkkgkgwlvpipv 232
                 +++eW ++ k+ +k+w +p+p+
  ABA57493.1  47 KQPEWYDYAKESEKKWGTPTPI 68 
                 2349***************998 PP

>> PF04995  Heme exporter protein D (CcmD)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.7   1.5       0.3   1.4e+03      26      45 ..     173     192 ..     172     193 .. 0.89

  Alignments for each domain:
  == domain 1    score: 1.7 bits;  conditional E-value: 0.3
     PF04995  26 lrrrrrllrelarleareqr 45 
                 ++rr+  lr++a++ ar++r
  ABA57493.1 173 AWRRKPHLRRVAKRVARQAR 192
                 58999999*********998 PP

>> PF01201  Ribosomal protein S8e
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.9   0.1      0.32   1.5e+03      19      67 ..     161     209 ..     148     213 .. 0.79

  Alignments for each domain:
  == domain 1    score: 1.9 bits;  conditional E-value: 0.32
                 --------------------S.HHH.HHHHHHT--------TTSS-EEE CS
     PF01201  19 dheekkrkkelgrpaaetklgkvlskrvkqvrvrggnrkvralrlkkan 67 
                  ++e  r +++g    + +l +v ++  +q r+ g + k+   r+k  +
  ABA57493.1 161 AYHEGHRGYQRGAWRRKPHLRRVAKRVARQARMYGSQLKSCEDRFKCRK 209
                 6788888888888888888888888899999999999998777776655 PP

>> PF10578  Seminal vesicle protein repeat
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.9   0.2       1.1   5.2e+03       1       5 [.     196     200 ..     196     200 .. 0.70

  Alignments for each domain:
  == domain 1    score: 0.9 bits;  conditional E-value: 1.1
     PF10578   1 sQlKS 5  
                 sQlKS
  ABA57493.1 196 SQLKS 200
                 67777 PP



Internal pipeline statistics summary:
-------------------------------------
Query sequence(s):                         1  (218 residues)
Target model(s):                       11912  (2158902 nodes)
Passed MSV filter:                       255  (0.021407); expected 238.2 (0.02)
Passed bias filter:                      224  (0.0188046); expected 238.2 (0.02)
Passed Vit filter:                        23  (0.00193083); expected 11.9 (0.001)
Passed Fwd filter:                        23  (0.00193083); expected 0.1 (1e-05)
Initial search space (Z):             100000  [as set by --Z on cmdline]
Domain search space  (domZ):              21  [number of targets reported over threshold]
# CPU time: 0.17u 0.03s 00:00:00.20 Elapsed: 00:00:00
# Mc/sec: 2768.47
//