# hmmscan :: search sequence(s) against a profile HMM database
# HMMER 3.0b2 (June 2009); http://hmmer.org/
# Copyright (C) 2009 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query sequence file:             /home/niguts/usr08/shisakam/FASTA/gib_20042.fasta
# target HMM database:             /home/niguts/usr08/shisakam/PFAM/ver24.0/Pfam-A.hmm
# sequence search space set to:    100000
# set reporting thresholds to:     GA cutoffs
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       ABA57898.1  [L=152]
Description: noce0 ABA57898.1 GIB00281CH01 "Universal stress protein UspA and related nucleo.."
Scores for complete sequence (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Model    Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    2.1e-28  101.9   0.0    2.6e-28  101.6   0.0    1.0  1  PF00582  Universal stress protein family
  ------ inclusion threshold ------
        1.1   12.1   0.0        1.8   11.5   0.0    1.3  1  PF09736  Pre-mRNA-splicing factor of RES complex
        5.6    9.5   0.5         12    8.4   0.4    1.6  1  PF03713  Domain of unknown function (DUF305)
          7    9.0   0.0         16    7.8   0.0    1.5  1  PF02720  Domain of unknown function DUF222
        9.7    8.7   0.0         12    8.4   0.0    1.3  1  PF00338  Ribosomal protein S10p/S20e
         10    7.9   2.4    1.7e+02    4.0   0.2    2.8  2  PF09532  DFDF motif
         16    8.0   0.2         22    7.6   0.1    1.2  1  PF11221  Subunit 21 of Mediator complex
         23    7.6   0.4         49    6.6   0.3    1.5  1  PF10338  Protein of unknown function (DUF2423)
         24    7.1   0.2         42    6.3   0.1    1.3  1  PF09920  Uncharacterized protein conserved in archaea (DUF21
         26    6.5   0.0         33    6.1   0.0    1.3  1  PF01968  Hydantoinase/oxoprolinase
         27    6.6   0.0         26    6.7   0.0    1.1  1  PF03261  Cyclin-dependent kinase 5 activator protein
         32    7.3   0.0         87    5.9   0.0    1.7  1  PF08818  Domain of unknown function (DU1801)
         35    5.3   0.0         36    5.3   0.0    1.1  1  PF03098  Animal haem peroxidase
         37    6.8   0.4         52    6.3   0.3    1.2  1  PF09229  Activator of Hsp90 ATPase, N-terminal
         41    6.4   0.0         93    5.3   0.0    1.6  1  PF05952  Bacillus competence pheromone ComX
         43    6.8   0.0    3.9e+02    3.8   0.0    2.1  2  PF08628  Sorting nexin C terminal
         45    6.1   0.0         93    5.1   0.0    1.5  1  PF10294  Putative methyltransferase
         47    6.3   0.3         94    5.4   0.2    1.4  1  PF11591  Ferredoxin chloroplastic transit peptide
         54    6.5   0.1    1.3e+02    5.3   0.0    1.7  1  PF09702  CRISPR-associated protein (Cas_Csa5)
         56    6.1   0.0         70    5.8   0.0    1.2  1  PF12013  Protein of unknown function (DUF3505)
         57    6.3   0.2      1e+02    5.5   0.2    1.6  1  PF09636  XkdW protein
         60    5.8   0.0         98    5.2   0.0    1.5  1  PF00782  Dual specificity phosphatase, catalytic domain
         61    4.5   0.2         75    4.2   0.2    1.1  1  PF05340  Protein of unknown function (DUF740)
         64    3.7   0.7         85    3.3   0.5    1.1  1  PF02029  Caldesmon
         64    6.4   0.2    1.2e+02    5.5   0.1    1.5  1  PF06260  Protein of unknown function (DUF1024)
         72    5.5   0.0    1.3e+02    4.6   0.0    1.4  1  PF01973  Protein of unknown function DUF115
         72    5.5   0.0      1e+02    5.0   0.0    1.2  1  PF02722  Major Outer Sheath Protein C-terminal region
         75    5.1   0.0         88    4.9   0.0    1.2  1  PF01650  Peptidase C13 family
         75    4.9   0.0    1.3e+02    4.2   0.0    1.5  1  PF03918  Cytochrome C biogenesis protein
         79    6.9   0.5    1.4e+02    6.1   0.4    1.6  1  PF11983  Domain of unknown function (DUF3484)
         84    4.4   0.1    1.1e+02    4.1   0.1    1.2  1  PF07149  Pes-10
    1.2e+02    5.1   1.6    2.3e+02    4.1   0.2    1.9  2  PF08500  Tombusvirus p33
    1.2e+02    5.4   0.0    2.3e+02    4.5   0.0    1.6  1  PF10705  Chloroplast protein precursor Ycf15 putative
    1.3e+02    4.8   0.1    2.2e+02    4.0   0.0    1.4  1  PF00389  D-isomer specific 2-hydroxyacid dehydrogenase, cata
    2.2e+02    4.2   0.0    4.7e+02    3.1   0.0    1.5  1  PF04536  Domain of unknown function (DUF477)
    2.2e+02    5.0   0.3    4.2e+02    4.1   0.0    1.6  1  PF11015  Protein of unknown function (DUF2853)
    2.6e+02    5.0   1.1      1e+03    3.3   0.8    2.0  1  PF03373  Octapeptide repeat
    2.7e+02    3.7   0.0    4.9e+02    2.9   0.0    1.4  1  PF01277  Oleosin
    2.8e+02    2.9   0.0    5.6e+02    1.9   0.0    1.2  1  PF06090  Inositol-pentakisphosphate 2-kinase
    3.1e+02    3.4   1.0    1.6e+03    1.1   0.0    2.1  2  PF08518  Spa2 homology domain (SHD) of GIT
    3.6e+02    4.4   0.0    8.3e+02    3.2   0.0    1.6  1  PF04718  Mitochondrial ATP synthase g subunit
    4.2e+02    2.9   0.0    7.1e+02    2.2   0.0    1.2  1  PF04909  Amidohydrolase
    8.8e+02    2.5   2.4    6.1e+02    3.0   0.2    1.9  1  PF05184  Saposin-like type B, region 1
    9.3e+02    2.7   1.0    1.9e+03    1.7   0.7    1.5  1  PF10529  Histidine-rich Calcium-binding repeat region
      2e+03    1.1   4.6    3.6e+02    3.4   0.3    1.9  1  PF12436  Ubiquitin-specific protease 7


Domain and alignment annotation for each model:
>> PF00582  Universal stress protein family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  101.6   0.0   1.2e-31   2.6e-28       4     140 .]      11     152 .]       9     152 .] 0.98

  Alignments for each domain:
  == domain 1    score: 101.6 bits;  conditional E-value: 1.2e-31
                 EEEEE--SSHHHHHHHHHHHHHHHHSCCEEEEEEEC-SSCCTTCTCHHHHHHHHHHHHHHHHHHHHH.....HHHHHTTCCEEEEEEEEESHHHHHHHH CS
     PF00582   4 rilVavDgseeskrAlewAlelakargaelillhvvdpessgsaseakeeeeeeeleeelaeaeada.....kkaaeaggekvevvvlegdpaeaivev 97 
                  i+V vDgse++krA+++A++lak ++ + +ll+v ++++ +  + ++ ++ eee  e+l+++ a +     ++  ++++ + + ++l+gdpa +i+ +
  ABA57898.1  11 DIIVTVDGSENAKRAARFAARLAKTTKNKMTLLYVFPTRATSDFDFLSITHPEEEDNEQLKKETARKvfdeaRRIIGDQDQEIKEEILTGDPATEIIHY 109
                 69*************************************************************9999***999999*********************** PP

                 HHHTTSSEEEEE--EE-S-TTCE---HHHHHHHHTSSEEEEE- CS
     PF00582  98 aeeenadliVmGsrgrsglrrlllGSvsekvlrkapcpVlvvr 140
                  e++  ++ V+G+rg+s+++ lllGSvsekv+r+a+ pV++++
  ABA57898.1 110 LEKRPNTITVIGRRGLSRFEALLLGSVSEKVVRHASGPVTIIH 152
                 ****************************************986 PP

>> PF09736  Pre-mRNA-splicing factor of RES complex
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   11.5   0.0   0.00079       1.8      50      99 ..      64     115 ..      57     130 .. 0.73

  Alignments for each domain:
  == domain 1    score: 11.5 bits;  conditional E-value: 0.00079
     PF09736  50 ekkleeeekakkkpl..aryeddedldeelkekerfeDPmaellkkkkekee 99 
                 e+ +e+++k+++ ++     ++  d d+e ke++  +DP++e+++  +++++
  ABA57898.1  64 EEDNEQLKKETARKVfdEARRIIGDQDQEIKEEILTGDPATEIIHYLEKRPN 115
                 44555555555555545667788999***************99887666554 PP

>> PF03713  Domain of unknown function (DUF305)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.4   0.4    0.0055        12      22      48 ..      69      95 ..      66      95 .. 0.87

  Alignments for each domain:
  == domain 1    score: 8.4 bits;  conditional E-value: 0.0055
                HHHH---HHHHHHHHHHHHHHHHHHHH CS
     PF03713 22 alersadpevralAedIiaaQqaEiaq 48
                 l++ +   v + A++Ii +Q +Ei++
  ABA57898.1 69 QLKKETARKVFDEARRIIGDQDQEIKE 95
                5778888999999************85 PP

>> PF02720  Domain of unknown function DUF222
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.8   0.0    0.0071        16      29      56 ..      11      38 ..       8      44 .. 0.87

  Alignments for each domain:
  == domain 1    score: 7.8 bits;  conditional E-value: 0.0071
     PF02720 29 dgmsrlsgeltaeaaaaldarldklaap 56
                d  +++ g+++a+ aa++ arl+k  + 
  ABA57898.1 11 DIIVTVDGSENAKRAARFAARLAKTTKN 38
                66789*****************998776 PP

>> PF00338  Ribosomal protein S10p/S20e
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.4   0.0    0.0054        12      11      70 ..      20      80 ..      11     113 .. 0.91

  Alignments for each domain:
  == domain 1    score: 8.4 bits;  conditional E-value: 0.0054
                HHHHHHHHHHHHHHHT----EE-EEEECEEE.EEEEE-----S-SSS-EEEEEEEEEEEEE CS
     PF00338 11 kllekavkqiieaakrlglkvsgpiplPtkr.krvtvlrsphvdkksreqfeirthkrlid 70
                ++ ++a++++ ++ak ++ k++  +  Pt+  + + +l+  h + +  eq + +t ++++d
  ABA57898.1 20 ENAKRAARFAARLAKTTKNKMTLLYVFPTRAtSDFDFLSITHPEEEDNEQLKKETARKVFD 80
                677899***********************98689****************99999998876 PP

>> PF09532  DFDF motif
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.8   0.0      0.18   4.1e+02      11      23 ..       1      11 [.       1      13 [. 0.73
   2 ?    4.0   0.2     0.076   1.7e+02       3       8 ..      51      56 ..      50      58 .. 0.90

  Alignments for each domain:
  == domain 1    score: 2.8 bits;  conditional E-value: 0.18
                -GGGS-HHHHHHH CS
     PF09532 11 nNAKFdKedvfee 23
                +NA+F+  d+ e+
  ABA57898.1  1 MNAQFN--DIIED 11
                7****6..66665 PP

  == domain 2    score: 4.0 bits;  conditional E-value: 0.076
                SS---- CS
     PF09532  3 eeDFDF 8 
                ++DFDF
  ABA57898.1 51 TSDFDF 56
                79**** PP

>> PF11221  Subunit 21 of Mediator complex
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.6   0.1    0.0098        22      59     120 ..      19      80 ..       6      96 .. 0.85

  Alignments for each domain:
  == domain 1    score: 7.6 bits;  conditional E-value: 0.0098
                 HHHHHHHHHHHHHHHHHHHHHHHHHHH-----S-HHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
     PF11221  59 eefeerqreLardlilkaqqIeyLIdsLPgiesSeeeQlkrikeLeeelreveeereeavke 120
                 +e ++r++ +a+ l++++++  +L  ++P   +S  + l+  +  ee+++++++e +++v +
  ABA57898.1  19 SENAKRAARFAARLAKTTKNKMTLLYVFPTRATSDFDFLSITHPEEEDNEQLKKETARKVFD 80 
                 6778999*****************************99999999999999999999887743 PP

>> PF10338  Protein of unknown function (DUF2423)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.6   0.3     0.022        49      27      44 ..      22      39 ..      18      40 .. 0.90

  Alignments for each domain:
  == domain 1    score: 6.6 bits;  conditional E-value: 0.022
     PF10338 27 daRaeRLsaKLkeelkkq 44
                ++Ra R +a+L++++k++
  ABA57898.1 22 AKRAARFAARLAKTTKNK 39
                78************9986 PP

>> PF09920  Uncharacterized protein conserved in archaea (DUF2150)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.3   0.1     0.019        42      55      86 ..      66      97 ..      56     103 .. 0.90

  Alignments for each domain:
  == domain 1    score: 6.3 bits;  conditional E-value: 0.019
     PF09920 55 enkelskeealeeleevreivleeveiidedk 86
                +n++l+ke a +  +e r+i+ ++++ i+e++
  ABA57898.1 66 DNEQLKKETARKVFDEARRIIGDQDQEIKEEI 97
                799*********************99999886 PP

>> PF01968  Hydantoinase/oxoprolinase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.1   0.0     0.015        33     183     218 ..      64      99 ..      48     145 .. 0.77

  Alignments for each domain:
  == domain 1    score: 6.1 bits;  conditional E-value: 0.015
     PF01968 183 pdgdqkldselarrafeelakelslkveevaeglls 218
                 ++ +++l++e+ar+ f+e +  ++++ +e++e++l+
  ABA57898.1  64 EEDNEQLKKETARKVFDEARRIIGDQDQEIKEEILT 99 
                 457899********************9999999974 PP

>> PF03261  Cyclin-dependent kinase 5 activator protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.7   0.0     0.012        26     109     151 ..      61     104 ..      12     140 .. 0.77

  Alignments for each domain:
  == domain 1    score: 6.7 bits;  conditional E-value: 0.012
     PF03261 109 kprpsd.ttlslanlssleeefrrqlqntvqdlveevlagspkk 151
                 +p+ +d  +l+ +++ ++ +e rr   ++ q+++ee l+g p+ 
  ABA57898.1  61 HPEEEDnEQLKKETARKVFDEARRIIGDQDQEIKEEILTGDPAT 104
                 676554157888889999999999999*************9986 PP

>> PF08818  Domain of unknown function (DU1801)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.9   0.0     0.039        87       3      66 ..      76     133 ..      74     145 .. 0.74

  Alignments for each domain:
  == domain 1    score: 5.9 bits;  conditional E-value: 0.039
                 HHHHHHHHHHHHHHSTTSEEEEETTEEEEE-...EEE--EE-SSEEEEEE-HHH.HHHCHHHH. CS
     PF08818   3 reeleeLralilealpeleetikwgmpaytldgkpfigfaarkkhvslyfakgallkdfeeele 66 
                 r+++ e r++i ++++e++e+i  g pa  +    + +++ r + ++++  +g  l++fe++l+
  ABA57898.1  76 RKVFDEARRIIGDQDQEIKEEILTGDPATEI----IHYLEKRPNTITVIGRRG--LSRFEALLL 133
                 7889999*****************9999876....556666666666666544..366666665 PP

>> PF03098  Animal haem peroxidase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.3   0.0     0.016        36     239     259 ..      73      93 ..      26     111 .. 0.71

  Alignments for each domain:
  == domain 1    score: 5.3 bits;  conditional E-value: 0.016
                 ----HHHHHHHHH---HHHHH CS
     PF03098 239 wsdeelFqeARlivialiqkI 259
                  ++ ++F+eAR+i++ + q I
  ABA57898.1  73 ETARKVFDEARRIIGDQDQEI 93 
                 56778***********99887 PP

>> PF09229  Activator of Hsp90 ATPase, N-terminal
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.3   0.3     0.024        52      71     134 ..      25      96 ..      10      98 .. 0.80

  Alignments for each domain:
  == domain 1    score: 6.3 bits;  conditional E-value: 0.024
     PF09229  71 e........kkvkGtveipelsseneeedyeieikvtdkkkeskelkallkkkgvpkireklkkfvkeLkee 134
                 +        k+ k ++++ ++  + +++d+++   +  +++++++lk+   +k+ ++ r+ + +  +e+kee
  ABA57898.1  25 AarfaarlaKTTKNKMTLLYVFPTRATSDFDFLSITHPEEEDNEQLKKETARKVFDEARRIIGDQDQEIKEE 96 
                 2444444557788999999999999*******8888888888999******************999999876 PP

>> PF05952  Bacillus competence pheromone ComX
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.3   0.0     0.042        93       4      19 ..     105     120 ..     103     134 .. 0.85

  Alignments for each domain:
  == domain 1    score: 5.3 bits;  conditional E-value: 0.042
     PF05952   4 divsYLvknPevlkkl 19 
                 +i++YL k P++++ +
  ABA57898.1 105 EIIHYLEKRPNTITVI 120
                 8**********99866 PP

>> PF08628  Sorting nexin C terminal
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.0   0.0       1.3   2.9e+03      80     102 ..       5      27 ..       1      32 [. 0.86
   2 ?    3.8   0.0      0.18   3.9e+02      69      97 ..      63      91 ..      33      96 .. 0.86

  Alignments for each domain:
  == domain 1    score: 1.0 bits;  conditional E-value: 1.3
     PF08628  80 LqellpdalvkvvGreaareais 102
                 + + + d++v+v G+e+a++a++
  ABA57898.1   5 FNDIIEDIIVTVDGSENAKRAAR 27 
                 667899999**********9986 PP

  == domain 2    score: 3.8 bits;  conditional E-value: 0.18
     PF08628 69 klrtkkeakkeLqellpdalvkvvGreaa 97
                 ++++++ kke  +++ d +++++G ++ 
  ABA57898.1 63 EEEDNEQLKKETARKVFDEARRIIGDQDQ 91
                46888999999999999999999999875 PP

>> PF10294  Putative methyltransferase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.1   0.0     0.042        93     117     165 ..      11      59 ..       2      63 .. 0.91

  Alignments for each domain:
  == domain 1    score: 5.1 bits;  conditional E-value: 0.042
     PF10294 117 DlilaaDcvYledalelLvktLkdlleketkvlvaykkrreaekkFfkl 165
                 D+i+ +D   +++     ++ L + ++++ ++l+++  r  ++ +F++ 
  ABA57898.1  11 DIIVTVDGSENAKRAARFAARLAKTTKNKMTLLYVFPTRATSDFDFLSI 59 
                 9999999999************************************975 PP

>> PF11591  Ferredoxin chloroplastic transit peptide
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.4   0.2     0.042        94      13      28 ..      16      31 ..      15      34 .. 0.82

  Alignments for each domain:
  == domain 1    score: 5.4 bits;  conditional E-value: 0.042
                -.--GGGT----SS-S CS
     PF11591 13 VaGAkPAVRaARPaaR 28
                V G   A RaAR aaR
  ABA57898.1 16 VDGSENAKRAARFAAR 31
                567778999***9999 PP

>> PF09702  CRISPR-associated protein (Cas_Csa5)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.3   0.0      0.06   1.3e+02      18      35 ..      70      87 ..      66     121 .. 0.79

  Alignments for each domain:
  == domain 1    score: 5.3 bits;  conditional E-value: 0.06
     PF09702 18 LskEavekvlyeaqRivr 35
                L kE++ kv  ea+Ri+ 
  ABA57898.1 70 LKKETARKVFDEARRIIG 87
                89**************95 PP

>> PF12013  Protein of unknown function (DUF3505)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.8   0.0     0.031        70     107     183 ..      16      92 ..       6     118 .. 0.75

  Alignments for each domain:
  == domain 1    score: 5.8 bits;  conditional E-value: 0.031
     PF12013 107 khgetqrpkrgrkakadatplwrvvklQtfFrarklshyfevraaeqtesaaatapsseaeaivdaieqaleedear 183
                 ++g ++ ++  r a + a+++  +++l  +F++r+ s++     ++++e+++++ ++++a ++ d+  + + +++++
  ABA57898.1  16 VDGSENAKRAARFAARLAKTTKNKMTLLYVFPTRATSDFDFLSITHPEEEDNEQLKKETARKVFDEARRIIGDQDQE 92 
                 56666656666666778888999999999****99999877777777777677777777777777766666666554 PP

>> PF09636  XkdW protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.5   0.2     0.045     1e+02      73     104 ..      68      99 ..       6     101 .. 0.84

  Alignments for each domain:
  == domain 1    score: 5.5 bits;  conditional E-value: 0.045
                 -------------------------------- CS
     PF09636  73 elskeklarkqleelnktlgnelsklklella 104
                 e +k+  ark ++e  + +g++ +++k e+l+
  ABA57898.1  68 EQLKKETARKVFDEARRIIGDQDQEIKEEILT 99 
                 44455789**********************97 PP

>> PF00782  Dual specificity phosphatase, catalytic domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.2   0.0     0.044        98      49      86 ..      80     127 ..      29     133 .. 0.72

  Alignments for each domain:
  == domain 1    score: 5.2 bits;  conditional E-value: 0.044
                 C.......STTCGGGGGH...HHHHHHHHHHHHTT--EEEEE----HH CS
     PF00782  49 d.......etetkiskel...eeavefiekaeqkgkkvlVHCqaGisR 86 
                 d       +++++i +e+   + a+e+i+ +e++ +++ V  + G+sR
  ABA57898.1  80 DearriigDQDQEIKEEIltgDPATEIIHYLEKRPNTITVIGRRGLSR 127
                 3444444445566666554446799**********************9 PP

>> PF05340  Protein of unknown function (DUF740)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.2   0.2     0.034        75     157     187 ..      63      94 ..      36      98 .. 0.81

  Alignments for each domain:
  == domain 1    score: 4.2 bits;  conditional E-value: 0.034
     PF05340 157 aEedeeeeeke.pkkvvdekseeigeeeeElK 187
                  Eed+e+ +ke  +kv+de   +ig +++E K
  ABA57898.1  63 EEEDNEQLKKEtARKVFDEARRIIGDQDQEIK 94 
                 4677777666526899*****99999999988 PP

>> PF02029  Caldesmon
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.3   0.5     0.038        85     257     291 ..      62      96 ..      50     105 .. 0.73

  Alignments for each domain:
  == domain 1    score: 3.3 bits;  conditional E-value: 0.038
     PF02029 257 aeekekeraekerekleaeekerlkaeeekkiaee 291
                  ee++ e+ +ke ++   +e  r+  ++++ i ee
  ABA57898.1  62 PEEEDNEQLKKETARKVFDEARRIIGDQDQEIKEE 96 
                 45677777777777777777777777777777766 PP

>> PF06260  Protein of unknown function (DUF1024)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.5   0.1     0.056   1.2e+02      37      68 ..      77     108 ..      61     113 .. 0.83

  Alignments for each domain:
  == domain 1    score: 5.5 bits;  conditional E-value: 0.056
     PF06260  37 qafdeilegltnalqealkedieldeavgilv 68 
                 + fde +  + ++ qe  +e +  d a++i+ 
  ABA57898.1  77 KVFDEARRIIGDQDQEIKEEILTGDPATEIIH 108
                 57**************99999999***99985 PP

>> PF01973  Protein of unknown function DUF115
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.6   0.0     0.059   1.3e+02      65      83 ..       6      24 ..       4      54 .. 0.73

  Alignments for each domain:
  == domain 1    score: 4.6 bits;  conditional E-value: 0.059
     PF01973 65 egIkPDivvslDrqeitye 83
                ++I+ Di+v++D++e   +
  ABA57898.1  6 NDIIEDIIVTVDGSENAKR 24
                68999********766554 PP

>> PF02722  Major Outer Sheath Protein C-terminal region
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.0   0.0     0.046     1e+02      26      62 ..      75     111 ..      54     117 .. 0.92

  Alignments for each domain:
  == domain 1    score: 5.0 bits;  conditional E-value: 0.046
     PF02722  26 gksvfdaalsdhldaaaflkletksgDpatklvegle 62 
                 + +vfd+a +   d    +k+e  +gDpat++++ le
  ABA57898.1  75 ARKVFDEARRIIGDQDQEIKEEILTGDPATEIIHYLE 111
                 7899***************************998775 PP

>> PF01650  Peptidase C13 family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.9   0.0     0.039        88     201     236 ..      55      90 ..      24     109 .. 0.85

  Alignments for each domain:
  == domain 1    score: 4.9 bits;  conditional E-value: 0.039
     PF01650 201 dlfsvawledsddedlsketlekqfelvkkkvakse 236
                 d +s++  e+ d+e+l+ket +k f+++++ + ++ 
  ABA57898.1  55 DFLSITHPEEEDNEQLKKETARKVFDEARRIIGDQD 90 
                 56788888999******************9885443 PP

>> PF03918  Cytochrome C biogenesis protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.2   0.0     0.057   1.3e+02      61      86 ..      88     113 ..      41     115 .. 0.93

  Alignments for each domain:
  == domain 1    score: 4.2 bits;  conditional E-value: 0.057
     PF03918  61 dlRrkvremlkeGksdeeiidymveR 86 
                 d  ++++e +  G+   eii y+ +R
  ABA57898.1  88 DQDQEIKEEILTGDPATEIIHYLEKR 113
                 556899****************9987 PP

>> PF11983  Domain of unknown function (DUF3484)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.1   0.4     0.061   1.4e+02      46      72 ..      62      87 ..      16      88 .. 0.90

  Alignments for each domain:
  == domain 1    score: 6.1 bits;  conditional E-value: 0.061
     PF11983 46 pteesaeeqeqkepkekltdrvkgfFg 72
                p+ee++e q +ke   k++d +++++g
  ABA57898.1 62 PEEEDNE-QLKKETARKVFDEARRIIG 87
                5666666.77999999********998 PP

>> PF07149  Pes-10
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.1   0.1     0.048   1.1e+02     146     181 ..      77     108 ..      51     122 .. 0.79

  Alignments for each domain:
  == domain 1    score: 4.1 bits;  conditional E-value: 0.048
     PF07149 146 eqleeAdeliakvdlllkdevleeleqeeeadelld 181
                 + + eA ++i + d+ +k+e+l  + ++    e++ 
  ABA57898.1  77 KVFDEARRIIGDQDQEIKEEILTGDPAT----EIIH 108
                 5689**********99999999887776....4444 PP

>> PF08500  Tombusvirus p33
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.1   0.2       0.1   2.3e+02      65      86 ..      22      43 ..       6      52 .. 0.83
   2 ?    0.2   0.0       1.7   3.7e+03      27      62 ..      73     109 ..      49     127 .. 0.50

  Alignments for each domain:
  == domain 1    score: 4.1 bits;  conditional E-value: 0.1
     PF08500 65 ksRRnryavkvAavAkakVGlL 86
                ++R  r+a+++A+  k k  lL
  ABA57898.1 22 AKRAARFAARLAKTTKNKMTLL 43
                45788*************9998 PP

  == domain 2    score: 0.2 bits;  conditional E-value: 1.7
     PF08500  27 keaeekvedddeiteilevee.kvdlgkdpesrkekv 62 
                 + a++ + + + i      e  +++l+ dp+++ ++ 
  ABA57898.1  73 ETARKVFDEARRIIGDQDQEIkEEILTGDPATEIIHY 109
                 3333333333332222222222455556666665554 PP

>> PF10705  Chloroplast protein precursor Ycf15 putative
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.5   0.0       0.1   2.3e+02      41      66 ..      94     119 ..      70     140 .. 0.84

  Alignments for each domain:
  == domain 1    score: 4.5 bits;  conditional E-value: 0.1
     PF10705  41 kqeflnseqpepithyikkfplmksi 66 
                 k+e l  +   +i+hy+ k+p + ++
  ABA57898.1  94 KEEILTGDPATEIIHYLEKRPNTITV 119
                 88999999999********9976554 PP

>> PF00389  D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.0   0.0     0.098   2.2e+02      40      81 ..      66     107 ..      49     111 .. 0.81

  Alignments for each domain:
  == domain 1    score: 4.0 bits;  conditional E-value: 0.098
                 C.SSSHCHHHCGG--.-SEEEE-TTS-BSHHHHCCHHTT--EE CS
                 x.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
     PF00389  40 e.ellteellekakdaadalivrsntkvtaevlealapkLkvi 81 
                 + e+l++e+++k+ d a+ +i  + +++++e+l    p  ++i
  ABA57898.1  66 DnEQLKKETARKVFDEARRIIGDQDQEIKEEILTGD-PATEII 107
                 3388889999998887999*************9887.777777 PP

>> PF04536  Domain of unknown function (DUF477)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.1   0.0      0.21   4.7e+02      27      52 ..      12      37 ..       7      47 .. 0.84

  Alignments for each domain:
  == domain 1    score: 3.1 bits;  conditional E-value: 0.21
     PF04536 27 vvvtvdslgdeediedyAlrlfrewg 52
                ++vtvd ++ ++++ ++A rl+++ +
  ABA57898.1 12 IIVTVDGSENAKRAARFAARLAKTTK 37
                68999999999999999999998766 PP

>> PF11015  Protein of unknown function (DUF2853)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.1   0.0      0.19   4.2e+02      64      99 ..       3      38 ..       1      41 [. 0.88

  Alignments for each domain:
  == domain 1    score: 4.1 bits;  conditional E-value: 0.19
                TTT----HHHHHH-----S--BHHHHHHHHHHH--- CS
     PF11015 64 aeldaaiekviekmgksnrnKyRvvvYyllakelgk 99
                a+ ++ ie++i ++ +s+++K  + +   lak +++
  ABA57898.1  3 AQFNDIIEDIIVTVDGSENAKRAARFAARLAKTTKN 38
                667899****************99**9****99875 PP

>> PF03373  Octapeptide repeat
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.3   0.8      0.45     1e+03       1       7 [.      62      68 ..      62      69 .. 0.87

  Alignments for each domain:
  == domain 1    score: 3.3 bits;  conditional E-value: 0.45
     PF03373  1 PgkEDnn 7 
                P +EDn 
  ABA57898.1 62 PEEEDNE 68
                89****5 PP

>> PF01277  Oleosin
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.9   0.0      0.22   4.9e+02      72     117 ..      51      96 ..      45      97 .. 0.82

  Alignments for each domain:
  == domain 1    score: 2.9 bits;  conditional E-value: 0.22
     PF01277  72 lsslswllkyvrkkeaasadqldqakrrlkeaaeyvgqktkelgqk 117
                  s + +l  +  ++e++++ ++++a++   ea   +g + +e++++
  ABA57898.1  51 TSDFDFLSITHPEEEDNEQLKKETARKVFDEARRIIGDQDQEIKEE 96 
                 56666676667778888899999999999*************9986 PP

>> PF06090  Inositol-pentakisphosphate 2-kinase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.9   0.0      0.25   5.6e+02     190     229 ..      74     113 ..      64     123 .. 0.86

  Alignments for each domain:
  == domain 1    score: 1.9 bits;  conditional E-value: 0.25
     PF06090 190 nnlrvfkngsliysdekesssedevleelikliaeiLlkk 229
                    +vf + + i +d++++++e+ ++++ ++ i ++L k+
  ABA57898.1  74 TARKVFDEARRIIGDQDQEIKEEILTGDPATEIIHYLEKR 113
                 56799999****************************9984 PP

>> PF08518  Spa2 homology domain (SHD) of GIT
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.1   0.0      0.74   1.6e+03      10      20 ..       2      12 ..       2      16 .. 0.90
   2 ?    0.0   0.1       1.6   3.6e+03      20      26 ..      78      84 ..      78      84 .. 0.93

  Alignments for each domain:
  == domain 1    score: 1.1 bits;  conditional E-value: 0.74
     PF08518 10 qqqFeeLstDV 20
                ++qF++ + D+
  ABA57898.1  2 NAQFNDIIEDI 12
                78*****9998 PP

  == domain 2    score: 0.0 bits;  conditional E-value: 1.6
     PF08518 20 VydElkR 26
                V+dE++R
  ABA57898.1 78 VFDEARR 84
                89***99 PP

>> PF04718  Mitochondrial ATP synthase g subunit
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.2   0.0      0.37   8.3e+02      37      80 ..       3      46 ..       1      52 [. 0.88

  Alignments for each domain:
  == domain 1    score: 3.2 bits;  conditional E-value: 0.37
     PF04718 37 aefqelyqqllklikalksgakpknllenvknlkvkeavlaglv 80
                a+f+ ++++++ +++  ++++ + +++++++++++++++l  ++
  ABA57898.1  3 AQFNDIIEDIIVTVDGSENAKRAARFAARLAKTTKNKMTLLYVF 46
                78999999*******999999999*********99999887666 PP

>> PF04909  Amidohydrolase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.2   0.0      0.32   7.1e+02     234     268 ..      45      79 ..      43      80 .. 0.86

  Alignments for each domain:
  == domain 1    score: 2.2 bits;  conditional E-value: 0.32
                 TTHTTCHHHHHHHCHHHHSHHHHHHHHTHHHHHHH CS
     PF04909 234 ppgelplealklldlldaseevrekilrdNAarll 268
                 + ++++ +++++l   ++ ee+ e++  ++A++++
  ABA57898.1  45 VFPTRATSDFDFLSITHPEEEDNEQLKKETARKVF 79 
                 567788889999999888***************98 PP

>> PF05184  Saposin-like type B, region 1
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.0   0.2      0.27   6.1e+02      19      33 ..      98     112 ..      91     112 .. 0.71

  Alignments for each domain:
  == domain 1    score: 3.0 bits;  conditional E-value: 0.27
     PF05184  19 kdnkteeeIikaldk 33 
                    +  +eIi++l+k
  ABA57898.1  98 LTGDPATEIIHYLEK 112
                 55556689*****98 PP

>> PF10529  Histidine-rich Calcium-binding repeat region
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.7   0.7      0.87   1.9e+03       5      11 ..      60      66 ..      60      68 .. 0.75

  Alignments for each domain:
  == domain 1    score: 1.7 bits;  conditional E-value: 0.87
     PF10529  5 GHreEED 11
                +H eEED
  ABA57898.1 60 THPEEED 66
                5888998 PP

>> PF12436  Ubiquitin-specific protease 7
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.4   0.3      0.16   3.6e+02      16      26 ..      63      73 ..      62      75 .. 0.94

  Alignments for each domain:
  == domain 1    score: 3.4 bits;  conditional E-value: 0.16
     PF12436 16 EreerErrrKE 26
                E+e+ E+++KE
  ABA57898.1 63 EEEDNEQLKKE 73
                99********9 PP



Internal pipeline statistics summary:
-------------------------------------
Query sequence(s):                         1  (152 residues)
Target model(s):                       11912  (2158902 nodes)
Passed MSV filter:                       596  (0.0500336); expected 238.2 (0.02)
Passed bias filter:                      516  (0.0433177); expected 238.2 (0.02)
Passed Vit filter:                        46  (0.00386165); expected 11.9 (0.001)
Passed Fwd filter:                        46  (0.00386165); expected 0.1 (1e-05)
Initial search space (Z):             100000  [as set by --Z on cmdline]
Domain search space  (domZ):              45  [number of targets reported over threshold]
# CPU time: 0.19u 0.05s 00:00:00.24 Elapsed: 00:00:00
# Mc/sec: 1727.12