# hmmscan :: search sequence(s) against a profile HMM database
# HMMER 3.0b2 (June 2009); http://hmmer.org/
# Copyright (C) 2009 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query sequence file:             /home/niguts/usr08/shisakam/FASTA/gib_20050.fasta
# target HMM database:             /home/niguts/usr08/shisakam/PFAM/ver24.0/Pfam-A.hmm
# sequence search space set to:    100000
# set reporting thresholds to:     GA cutoffs
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       ABA58618.1  [L=690]
Description: noce0 ABA58618.1 GIB00281CH01 "Flagellar biosynthesis protein FlhA"
Scores for complete sequence (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Model    Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
   5.7e-273  909.9   0.2   6.6e-273  909.7   0.2    1.0  1  PF00771  FHIPEP family
  ------ inclusion threshold ------
       0.71   12.0   6.3       0.52   12.4   2.7    2.0  1  PF05128  Domain of unknown function (DUF697)
        7.3    9.1   0.5         44    6.5   0.0    2.5  1  PF03748  Flagellar basal body-associated protein FliL
         11    8.6   0.0         23    7.5   0.0    1.5  1  PF00410  Ribosomal protein S8
         13    7.5   0.0         29    6.4   0.0    1.5  1  PF06888  Putative Phosphatase
         22    9.0   3.3         13    9.8   0.2    2.3  1  PF10550  Conantokin-G mollusc-toxin
         27    7.2   0.1         78    5.7   0.1    1.7  1  PF04217  Protein of unknown function, DUF412
         30    6.3   0.1         70    5.1   0.1    1.6  1  PF11984  Protein of unknown function (DUF3485)
         37    4.5   0.0         54    3.9   0.0    1.1  1  PF09508  Lacto-N-biose phosphorylase
         53    6.2   0.0    1.2e+02    5.0   0.0    1.6  1  PF02847  MA3 domain
    1.2e+02    5.0   0.0    2.7e+02    3.9   0.0    1.5  1  PF04117  Mpv17 / PMP22 family
    1.4e+02    4.5   4.6         35    6.4   0.6    1.9  1  PF05628  Borrelia membrane protein P13
    1.4e+02    5.4   4.8         53    6.8   0.1    2.8  1  PF02656  Domain of unknown function DUF
    1.7e+02    4.4   0.0    3.5e+02    3.4   0.0    1.5  1  PF04420  CHD5-like protein
      2e+02    3.8   0.5    4.1e+02    2.8   0.3    1.4  1  PF06120  Tail length tape measure protein
    2.7e+02    3.7   0.0    6.5e+02    2.4   0.0    1.6  1  PF05240  APOBEC-like C-terminal domain
      3e+02    2.2   0.0    4.7e+02    1.6   0.0    1.2  1  PF05095  Protein of unknown function (DUF687)
    3.4e+02    2.3   0.0    4.9e+02    1.8   0.0    1.1  1  PF00981  Rotavirus RNA-binding Protein 53 (NS53)
    3.4e+02    3.6   0.1    7.8e+02    2.4   0.0    1.5  1  PF02671  Paired amphipathic helix repeat
    3.5e+02    1.2   0.0    5.8e+02    0.5   0.0    1.2  1  PF05567  Neisseria PilC protein
      4e+02    2.2   0.0    6.6e+02    1.5   0.0    1.2  1  PF06673  Lactococcus lactis bacteriophage major capsid prote
    4.8e+02    2.6   0.0    9.4e+02    1.6   0.0    1.3  1  PF04808  Citrus tristeza virus (CTV) P23 protein
      5e+02    2.6   3.8    1.4e+03    1.1   2.6    1.7  1  PF12606  Tumour necrosis factor receptor superfamily member 
    5.3e+02    2.4   0.0    7.8e+02    1.9   0.0    1.1  1  PF00128  Alpha amylase, catalytic domain
    5.4e+02    3.3   0.0    1.7e+03    1.7   0.0    1.8  1  PF12040  Domain of unknown function (DUF3526)
    5.5e+02    3.4   0.2    1.1e+03    2.5   0.2    1.3  1  PF01749  Importin beta binding domain
    6.1e+02    1.9   0.0    1.1e+03    1.1   0.0    1.3  1  PF02384  N-6 DNA Methylase
    7.3e+02    1.2   0.0    1.1e+03    0.6   0.0    1.1  1  PF00245  Alkaline phosphatase
    1.1e+03    1.9   5.3    1.4e+02    4.7   0.3    2.0  1  PF03742  PetN
    1.3e+03    1.6   0.2      4e+03    0.1   0.2    1.6  1  PF12522  Cytomegalovirus glycoprotein N terminal
    1.6e+03    0.7   0.0    2.7e+03   -0.1   0.0    1.2  1  PF09777  Osteopetrosis-associated transmembrane protein 1 pr
    2.5e+03    1.8   1.5      1e+04   -0.1   1.1    2.0  1  PF08259  Periviscerokinin family


Domain and alignment annotation for each model:
>> PF00771  FHIPEP family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  909.7   0.2  2.1e-276  6.6e-273       2     658 .]      27     682 ..      26     682 .. 0.99

  Alignments for each domain:
  == domain 1    score: 909.7 bits;  conditional E-value: 2.1e-276
     PF00771   2 ilamlilPlpalllDlllalnialsvlillvalyikkpldfsvFPslLLittLlRLaLnvastrliLlege...daaGkvieaFGefvvggnlvvGlvv 97 
                 +lam++lPlpa+llDll+++ni+l++++ll  +y+++pldfs+FP++LL++tL+RLaLnvastr++Lleg+   daaGkvi+aFGefv+ggn++vGlvv
  ABA58618.1  27 MLAMMVLPLPAALLDLLFTFNISLALVVLLAGVYARRPLDFSSFPTILLLATLMRLALNVASTRVVLLEGHtgsDAAGKVIQAFGEFVIGGNYAVGLVV 125
                 79************************************************************************************************* PP

     PF00771  98 FlilvivnfiVitkGaeRvaEVaARFtLDamPGKQmaIDaDLnaGlideeeAkkrReelekEadfyGamDGAsKFVkGDAiagiiilliNiigGlliGv 196
                 F+ilv++nf+V+tkGa+R++EV+ARFtLDamPGKQmaIDaDLnaGlid+eeA+ rRee+ +EadfyG+mDGA KFV+GDAiagi+illiN+ gGl++G+
  ABA58618.1 126 FFILVLINFVVVTKGATRISEVSARFTLDAMPGKQMAIDADLNAGLIDQEEARLRREEVMQEADFYGSMDGAGKFVRGDAIAGILILLINVAGGLAVGL 224
                 *************************************************************************************************** PP

     PF00771 197 lqhgmslgeaaetytlltiGDGLvsqiPaLliSvaagiivtrvseeenlgeeiveqllaspkalliaavlllllalvpglPklvflllaalllllayll 295
                 lqh++s++eaa++ytlltiGDGLv+qiP+L++S+aagi+vtrvs+ +++g++i+ ql+++pk l+++av+l  ++l+pg+P+l+fl la+l+++ +++l
  ABA58618.1 225 LQHDLSFSEAARNYTLLTIGDGLVAQIPSLVLSTAAGILVTRVSHAQDMGSQILAQLFKNPKSLAVVAVVLGSMGLIPGMPNLAFLGLALLCGFGVWWL 323
                 *************************************************************************************************** PP

     PF00771 296 kkkkkeeekeeeeeekeeeeeeeeeeesveevlkvdplelelgyklielvdeeqggellerikairkklaeelGvvlpeirirdnlelkpneyriklkg 394
                  k++k    +e +++   ++++e+ e s+e++++vdp+ le+gy+li+lvd++qgg+l+ rik++rkkl+++ G+++p+++irdnl+l+p +yri+l g
  ABA58618.1 324 GKRQK----AEVAPTPPMAAPSETPELSWEDIPPVDPIGLEVGYRLIPLVDKTQGGQLMGRIKGVRKKLSQDWGFLIPPVHIRDNLNLAPIAYRITLFG 418
                 ***94....4445555555678899************************************************************************** PP

     PF00771 395 vevaegelkpdkllaidsgeekeelegeetkepafgleavwieeeekeeaekagytvvdpstvlathlsevlkknaaellgrqevqklldelekeapkl 493
                 v+v+e+e+ p++ +ai++g++ +++eg+++++pafglea+wie++++e+a+++gytvvd+ tv+athls++l+++a+ llgr+evqkll++l+k+apkl
  ABA58618.1 419 VTVGEAEVFPEREMAINPGQVFGKVEGTPAQDPAFGLEALWIEPAQREQAQMHGYTVVDAGTVIATHLSQILQNHAHGLLGREEVQKLLENLAKTAPKL 517
                 *************************************************************************************************** PP

     PF00771 494 veelvpkklslselqkvlqrLlkervsirdlrtilealaeaaekekdvelLteavRqaLarqivqklaeekgelkvitldpeleqllreslkqteegse 592
                 ve lvp+ l+ls +qkvlq+Ll+e+v+ird+rti+e+l+e++ +++d+++Lt+ +R+aL+r i+q + + ++el+vi ++p+leqll +sl++ +eg  
  ABA58618.1 518 VEGLVPEILPLSIVQKVLQQLLEEGVPIRDMRTIVESLTEHGLRSQDPAILTAIIRIALGRFIIQCFNGLEKELQVISIAPALEQLLLASLQTASEGGG 616
                 *************************************************************************************************** PP

     PF00771 593 lalepelaekllesvkealekleakgekpvllvspdlRrllrkllerelpelaVlsyqEipeevei 658
                 l++ep laekl  ++++ ++++ea+g++++llv+  lR+ l++++++++pel+Vlsy+Eipe++++
  ABA58618.1 617 LNMEPGLAEKLHLTLRDSVQRQEAAGKPAILLVQGVLRPWLARFVRHAIPELKVLSYNEIPEDKQV 682
                 **************************************************************9875 PP

>> PF05128  Domain of unknown function (DUF697)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   12.4   2.7   0.00017      0.52      34     121 ..      29     117 ..      26     149 .. 0.81

  Alignments for each domain:
  == domain 1    score: 12.4 bits;  conditional E-value: 0.00017
     PF05128  34 AlvvavsPlalvDllavaavnlqmirelaklYgielgyegaqkLarsvlknlaglGlvelgtdl.lkqllslnlatklsaraaQGvvag 121
                 A++v+  P al+Dll++  + l++++ la +Y  ++   ++   +  +++ +  +  v+ +  + l++ ++++ a+k+++++++ v++g
  ABA58618.1  29 AMMVLPLPAALLDLLFTFNISLALVVLLAGVYARRPLDFSSFPTILLLATLMRLALNVASTRVVlLEGHTGSDAAGKVIQAFGEFVIGG 117
                 8899999*************************998777776666666666665555554444334899999999999999998877776 PP

>> PF03748  Flagellar basal body-associated protein FliL
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.5   0.0     0.014        44      10      48 ..     308     342 ..     304     370 .. 0.66

  Alignments for each domain:
  == domain 1    score: 6.5 bits;  conditional E-value: 0.014
     PF03748  10 lllllvvgggggvffllsgkqeaeqaaaaeaeeaaaaap 48 
                 + l l++  g+gv++l+++++++     a++++ aa+++
  ABA58618.1 308 AFLGLALLCGFGVWWLGKRQKAEV----APTPPMAAPSE 342
                 567788889999*****9976663....33333333222 PP

>> PF00410  Ribosomal protein S8
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.5   0.0    0.0072        23      97     128 ..     250     281 ..     235     282 .. 0.89

  Alignments for each domain:
  == domain 1    score: 7.5 bits;  conditional E-value: 0.0072
     PF00410  97 glgililsTskGvmtdreArkkkvGGevlckv 128
                 +++ l+lsT +G++  r  + + +G ++l+++
  ABA58618.1 250 QIPSLVLSTAAGILVTRVSHAQDMGSQILAQL 281
                 67789************************987 PP

>> PF06888  Putative Phosphatase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.4   0.0    0.0094        29      31      73 ..     516     558 ..     502     578 .. 0.83

  Alignments for each domain:
  == domain 1    score: 6.4 bits;  conditional E-value: 0.0094
     PF06888  31 eelretlrkglwnelmdrvlkelheqgvseadikkvlrsipls 73 
                 + ++  +++ l  + +++vl++l e+gv ++d++++++s++ +
  ABA58618.1 516 KLVEGLVPEILPLSIVQKVLQQLLEEGVPIRDMRTIVESLTEH 558
                 555666777777899************************9876 PP

>> PF10550  Conantokin-G mollusc-toxin
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    9.8   0.2    0.0041        13       1      13 [.     499     511 ..     499     512 .. 0.91

  Alignments for each domain:
  == domain 1    score: 9.8 bits;  conditional E-value: 0.0041
                 --CCCCCHHHHHT CS
     PF10550   1 GEEElqkMaeeLi 13 
                 G EE+qk +e+L+
  ABA58618.1 499 GREEVQKLLENLA 511
                 67**********7 PP

>> PF04217  Protein of unknown function, DUF412
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.7   0.1     0.025        78      77      91 ..     317     331 ..     286     338 .. 0.74

  Alignments for each domain:
  == domain 1    score: 5.7 bits;  conditional E-value: 0.025
     PF04217  77 lqGlyWLGkRantpL 91 
                   G++WLGkR +  +
  ABA58618.1 317 GFGVWWLGKRQKAEV 331
                 469*******98765 PP

>> PF11984  Protein of unknown function (DUF3485)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.1   0.1     0.022        70       3      39 ..     307     343 ..     305     352 .. 0.88

  Alignments for each domain:
  == domain 1    score: 5.1 bits;  conditional E-value: 0.022
     PF11984   3 llalalllllaaaalllrplretaapprdplaiiple 39 
                 l++l+l+ll ++++++l  ++++ ++p++p a++ ++
  ABA58618.1 307 LAFLGLALLCGFGVWWLGKRQKAEVAPTPPMAAPSET 343
                 688999999*********************9998776 PP

>> PF09508  Lacto-N-biose phosphorylase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.9   0.0     0.017        54     424     472 ..     633     678 ..     626     680 .. 0.83

  Alignments for each domain:
  == domain 1    score: 3.9 bits;  conditional E-value: 0.017
     PF09508 424 entkgekalalklkvavlnsWGklrsWqasqvahalyykqvysyvgile 472
                 +++++++a     k a+l   G lr W a+ v+ha+   +v sy +i e
  ABA58618.1 633 DSVQRQEAA---GKPAILLVQGVLRPWLARFVRHAIPELKVLSYNEIPE 678
                 445555544...7889999***********************9998866 PP

>> PF02847  MA3 domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.0   0.0     0.038   1.2e+02       2      46 ..     532     576 ..     531     582 .. 0.92

  Alignments for each domain:
  == domain 1    score: 5.0 bits;  conditional E-value: 0.038
     PF02847   2 krkiflileeylssgdyeeavskleeLklpkqhheivkillecal 46 
                 ++  + +lee + ++d++  v++l+e +l +q + i+  ++ +al
  ABA58618.1 532 QKVLQQLLEEGVPIRDMRTIVESLTEHGLRSQDPAILTAIIRIAL 576
                 5677899**********************************9988 PP

>> PF04117  Mpv17 / PMP22 family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.9   0.0     0.085   2.7e+02       3      43 ..      93     138 ..      91     142 .. 0.88

  Alignments for each domain:
  == domain 1    score: 3.9 bits;  conditional E-value: 0.085
     PF04117   3 llegksleeikeklkekflptlk.....anwmvWpavqlinFafvP 43 
                 lleg++ +++  k+ + f +        ++++v+ +  linF +v 
  ABA58618.1  93 LLEGHTGSDAAGKVIQAFGEFVIggnyaVGLVVFFILVLINFVVVT 138
                 7899999999999999999998888888**************9996 PP

>> PF05628  Borrelia membrane protein P13
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.4   0.6     0.011        35      57      82 ..     196     221 ..     190     265 .. 0.76

  Alignments for each domain:
  == domain 1    score: 6.4 bits;  conditional E-value: 0.011
     PF05628  57 GiGsfvqGdyiGGgavlGfqllGlil 82 
                 G G fv+Gd i G ++l  ++ G+  
  ABA58618.1 196 GAGKFVRGDAIAGILILLINVAGGLA 221
                 88*******************99743 PP

>> PF02656  Domain of unknown function DUF
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.8   0.1     0.017        53      21      66 ..     258     303 ..     253     306 .. 0.89

  Alignments for each domain:
  == domain 1    score: 6.8 bits;  conditional E-value: 0.017
     PF02656  21 aalGiallqlfrldsssssatlrlrslgkplgltfiglailvllyg 66 
                  a Gi+++++++ + ++s+  ++l ++ k l+++ ++l+ + l+ g
  ABA58618.1 258 TAAGILVTRVSHAQDMGSQILAQLFKNPKSLAVVAVVLGSMGLIPG 303
                 589***********************************98877755 PP

>> PF04420  CHD5-like protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.4   0.0      0.11   3.5e+02       1      38 [.     123     160 ..     123     196 .. 0.84

  Alignments for each domain:
  == domain 1    score: 3.4 bits;  conditional E-value: 0.11
     PF04420   1 llaiflvlvlkfLvntigkstiekllwklylkvptsks 38 
                 l++ f++++++f+v t g+  i+++  ++ l   + k+
  ABA58618.1 123 LVVFFILVLINFVVVTKGATRISEVSARFTLDAMPGKQ 160
                 56788899999***************999988766444 PP

>> PF06120  Tail length tape measure protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.8   0.3      0.13   4.1e+02      12      33 ..     292     312 ..     284     332 .. 0.76

  Alignments for each domain:
  == domain 1    score: 2.8 bits;  conditional E-value: 0.13
     PF06120  12 tllktGatGlvGGlPGllmlGa 33 
                 + +  G++Gl+ G+P l  lG 
  ABA58618.1 292 A-VVLGSMGLIPGMPNLAFLGL 312
                 3.55699********9988874 PP

>> PF05240  APOBEC-like C-terminal domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.4   0.0      0.21   6.5e+02       5      22 ..     532     549 ..     529     550 .. 0.90

  Alignments for each domain:
  == domain 1    score: 2.4 bits;  conditional E-value: 0.21
                 HHHHHHHHH---EEEE-- CS
     PF05240   5 qegLrkLrsagvqvriMk 22 
                 q+ L++L ++gv++r M+
  ABA58618.1 532 QKVLQQLLEEGVPIRDMR 549
                 899***********9997 PP

>> PF05095  Protein of unknown function (DUF687)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.6   0.0      0.15   4.7e+02     468     526 ..      78     136 ..      51     144 .. 0.82

  Alignments for each domain:
  == domain 1    score: 1.6 bits;  conditional E-value: 0.15
     PF05095 468 eacrlnrtsnatstvipentttvydgdelrnaseawqtGdvlaisqtislilcllvlli 526
                  ++rl  +   t  v+ e++t+     ++ +a+ +++ G  +a++ ++ +il l+ +++
  ABA58618.1  78 TLMRLALNVASTRVVLLEGHTGSDAAGKVIQAFGEFVIGGNYAVGLVVFFILVLINFVV 136
                 555655555667778889999988888999999******************99998776 PP

>> PF00981  Rotavirus RNA-binding Protein 53 (NS53)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.8   0.0      0.16   4.9e+02     417     457 ..     511     551 ..     488     560 .. 0.86

  Alignments for each domain:
  == domain 1    score: 1.8 bits;  conditional E-value: 0.16
     PF00981 417 ynvikqilegevPkiltlkdvksilkaiiedWfdirklrel 457
                 +++  + +eg vP+il l+ v+++l+ ++e+ + ir +r++
  ABA58618.1 511 AKTAPKLVEGLVPEILPLSIVQKVLQQLLEEGVPIRDMRTI 551
                 55555678888**************************9976 PP

>> PF02671  Paired amphipathic helix repeat
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.4   0.0      0.25   7.8e+02       9      42 ..     488     521 ..     485     522 .. 0.93

  Alignments for each domain:
  == domain 1    score: 2.4 bits;  conditional E-value: 0.25
     PF02671   9 eiLhdyskeiisrtelyqeVadLlgghpdLleeF 42 
                 +iL+    +   r+e++ +  +L +  p L+e++
  ABA58618.1 488 QILQNHAHGLLGREEVQKLLENLAKTAPKLVEGL 521
                 89999999********************999985 PP

>> PF05567  Neisseria PilC protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.5   0.0      0.19   5.8e+02     338     367 ..     447     476 ..     435     516 .. 0.75

  Alignments for each domain:
  == domain 1    score: 0.5 bits;  conditional E-value: 0.19
     PF05567 338 kapspaltapalwfgpvqngkvqmysasvs 367
                  a+ pa+   alw+ p+q  ++qm+  +v 
  ABA58618.1 447 PAQDPAFGLEALWIEPAQREQAQMHGYTVV 476
                 5789********************987775 PP

>> PF06673  Lactococcus lactis bacteriophage major capsid protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.5   0.0      0.21   6.6e+02       6      31 ..     531     556 ..     527     563 .. 0.90

  Alignments for each domain:
  == domain 1    score: 1.5 bits;  conditional E-value: 0.21
     PF06673   6 tqeimkqaieagvkvreleakveeln 31 
                  q++++q +e gv +r++ + ve l 
  ABA58618.1 531 VQKVLQQLLEEGVPIRDMRTIVESLT 556
                 6999*******************986 PP

>> PF04808  Citrus tristeza virus (CTV) P23 protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.6   0.0       0.3   9.4e+02     142     162 ..     325     345 ..     318     348 .. 0.90

  Alignments for each domain:
  == domain 1    score: 1.6 bits;  conditional E-value: 0.3
     PF04808 142 erektrlarrhpmrspeetpe 162
                 +r+k+ +a   pm +p etpe
  ABA58618.1 325 KRQKAEVAPTPPMAAPSETPE 345
                 799*****************9 PP

>> PF12606  Tumour necrosis factor receptor superfamily member 19
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.1   2.6      0.44   1.4e+03       8      22 ..     124     138 ..     119     139 .. 0.83

  Alignments for each domain:
  == domain 1    score: 1.1 bits;  conditional E-value: 0.44
     PF12606   8 siffvmglLgllict 22 
                  +ff+++l+ ++++t
  ABA58618.1 124 VVFFILVLINFVVVT 138
                 489999999999997 PP

>> PF00128  Alpha amylase, catalytic domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.9   0.0      0.25   7.8e+02      16      40 ..     453     477 ..     451     483 .. 0.90

  Alignments for each domain:
  == domain 1    score: 1.9 bits;  conditional E-value: 0.25
                 ----EEEES--EECCGTTCGGSECE CS
     PF00128  16 lGvtaiwlsPifespqsyhgYditd 40 
                  G +a+w+ P  +++ + hgY + d
  ABA58618.1 453 FGLEALWIEPAQREQAQMHGYTVVD 477
                 5899*********999*****9877 PP

>> PF12040  Domain of unknown function (DUF3526)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.7   0.0      0.55   1.7e+03      76      97 ..     385     406 ..     380     408 .. 0.89

  Alignments for each domain:
  == domain 1    score: 1.7 bits;  conditional E-value: 0.55
     PF12040  76 qqrlarrvgllsPvlalqellm 97 
                 +++l++ +g+l P++++++ l+
  ABA58618.1 385 RKKLSQDWGFLIPPVHIRDNLN 406
                 68899************98775 PP

>> PF01749  Importin beta binding domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.5   0.2      0.35   1.1e+03      17      31 ..     170     185 ..     168     187 .. 0.83

  Alignments for each domain:
  == domain 1    score: 2.5 bits;  conditional E-value: 0.35
                 -.--HHHHHHHCCCCH CS
     PF01749  17 g.vdaeelRrrReeee 31 
                 g +d+ee+R rRee++
  ABA58618.1 170 GlIDQEEARLRREEVM 185
                 5589**********86 PP

>> PF02384  N-6 DNA Methylase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.1   0.0      0.34   1.1e+03     239     282 ..     158     201 ..     132     209 .. 0.86

  Alignments for each domain:
  == domain 1    score: 1.1 bits;  conditional E-value: 0.34
     PF02384 239 kevlfidaseefkkkdrkknklteediekivdtykekedvaefa 282
                 ++ + ida  ++   d+++ +l+ e++ + +d y++ ++  +f 
  ABA58618.1 158 GKQMAIDADLNAGLIDQEEARLRREEVMQEADFYGSMDGAGKFV 201
                 5667899****************************998887775 PP

>> PF00245  Alkaline phosphatase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.6   0.0      0.36   1.1e+03     188     241 ..     466     519 ..     459     529 .. 0.90

  Alignments for each domain:
  == domain 1    score: 0.6 bits;  conditional E-value: 0.36
                 HHHCH---EE--SHHHHHHHHH-TTSSSEE----------CCCTSTTTS--HHH CS
     PF00245 188 eeakkagyqyvsdrkeLlkakeensvkplLGLFadgdlkvelerdekeePsLke 241
                 e+a+ +gy +v+  + ++ + ++  +++  GL   +++++ le+  k+ P+L e
  ABA58618.1 466 EQAQMHGYTVVDAGTVIATHLSQILQNHAHGLLGREEVQKLLENLAKTAPKLVE 519
                 78999******9999998888888999************************987 PP

>> PF03742  PetN
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.7   0.3     0.046   1.4e+02      11      23 ..      42      54 ..      40      54 .. 0.86

  Alignments for each domain:
  == domain 1    score: 4.7 bits;  conditional E-value: 0.046
     PF03742 11 lmavFTfSlALVV 23
                l+ +F  SlALVV
  ABA58618.1 42 LLFTFNISLALVV 54
                5668999*****9 PP

>> PF12522  Cytomegalovirus glycoprotein N terminal
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.1   0.2       1.3     4e+03       4      11 ..     254     261 ..     254     261 .. 0.95

  Alignments for each domain:
  == domain 1    score: 0.1 bits;  conditional E-value: 1.3
     PF12522   4 LVLSVaag 11 
                 LVLS aag
  ABA58618.1 254 LVLSTAAG 261
                 9******8 PP

>> PF09777  Osteopetrosis-associated transmembrane protein 1 precursor
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -0.1   0.0      0.87   2.7e+03       2      34 ..     504     536 ..     503     547 .. 0.91

  Alignments for each domain:
  == domain 1    score: -0.1 bits;  conditional E-value: 0.87
     PF09777   2 eklleefakaqaklvaclvtkarPvklCqkcve 34 
                 +klle++ak+  klv+ lv +  P  + qk ++
  ABA58618.1 504 QKLLENLAKTAPKLVEGLVPEILPLSIVQKVLQ 536
                 689**********************99998776 PP

>> PF08259  Periviscerokinin family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -0.1   1.1       3.3     1e+04       1       7 [.     296     302 ..     296     305 .. 0.86

  Alignments for each domain:
  == domain 1    score: -0.1 bits;  conditional E-value: 3.3
     PF08259   1 gSSGLIp 7  
                 gS GLIp
  ABA58618.1 296 GSMGLIP 302
                 899***9 PP



Internal pipeline statistics summary:
-------------------------------------
Query sequence(s):                         1  (690 residues)
Target model(s):                       11912  (2158902 nodes)
Passed MSV filter:                       357  (0.0299698); expected 238.2 (0.02)
Passed bias filter:                      214  (0.0179651); expected 238.2 (0.02)
Passed Vit filter:                        39  (0.00327401); expected 11.9 (0.001)
Passed Fwd filter:                        39  (0.00327401); expected 0.1 (1e-05)
Initial search space (Z):             100000  [as set by --Z on cmdline]
Domain search space  (domZ):              32  [number of targets reported over threshold]
# CPU time: 0.44u 0.04s 00:00:00.48 Elapsed: 00:00:01
# Mc/sec: 3385.55
//