hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /home/genome/SCOP/1.73/Scop1.73.bin
Sequence file:            /home/genome/FASTA/gib_20031.fasta
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: ABA56702.1
Accession:      [none]
Description:    noce0 ABA56702.1 GIB00281CH01 "adenine phosphoribosyltransferase"

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
0051163  PRTase-like                                    160.1    3.3e-50   1
0046909  PRTase-like                                    159.7      2e-46   1
0048919  PRTase-like                                    159.5    1.4e-45   1
0041991  PRTase-like                                    147.2    4.5e-43   1
0040356  PRTase-like                                    148.0    9.7e-43   1
0041687  PRTase-like                                    132.6    8.8e-42   1
0048249  PRTase-like                                    142.9    3.3e-40   1
0051755  PRTase-like                                    117.3    8.1e-35   1
0050136  PRTase-like                                    110.6    2.7e-34   1
0035791  PRTase-like                                    115.6    1.5e-33   1
0036900  PRTase-like                                    103.6    2.2e-32   1
0047309  PRTase-like                                    105.8    1.5e-31   1
0048678  PRTase-like                                    104.2    1.9e-31   1
0035468  PRTase-like                                    100.5    9.1e-31   1
0034851  PRTase-like                                     98.5    2.7e-30   1
0041997  PRTase-like                                    101.6    1.2e-29   1
0041576  PRTase-like                                     99.4    1.4e-29   1
0046155  PRTase-like                                    106.1      3e-29   1
0038017  PRTase-like                                    100.6    5.3e-29   1
0050151  PRTase-like                                     90.6    3.9e-28   1
0050105  PRTase-like                                     92.5    2.4e-27   1
0044334  PRTase-like                                     88.4      7e-27   1
0038588  PRTase-like                                     88.2    7.9e-26   1
0041489  PRTase-like                                     85.3    4.1e-25   1
0048493  PRTase-like                                     75.4    2.3e-23   1
0050349  PRTase-like                                     73.0    1.5e-22   1
0036560  PRTase-like                                     77.5    2.5e-22   1
0051301  PRTase-like                                     67.8    7.6e-20   1
0047030  PRTase-like                                     62.0    1.2e-18   1
0051105  PRTase-like                                     62.2      6e-17   1
0046852  PRTase-like                                     59.3    5.1e-16   1
0052114  PRTase-like                                     43.4    7.8e-12   1
0049833  PRTase-like                                     28.2      5e-08   1
0042536  PRTase-like                                     26.1    3.3e-07   1
0050435  PRTase-like                                     25.3    3.4e-07   1
0046350  PRTase-like                                     26.4    4.1e-07   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
0035468    1/1      21   213 ..     1   224 []   100.5  9.1e-31
0051755    1/1      33   213 ..     1   208 []   117.3  8.1e-35
0048493    1/1      35   214 ..     1   210 []    75.4  2.3e-23
0041687    1/1      36   213 ..     1   202 []   132.6  8.8e-42
0036560    1/1      37   202 ..     1   230 []    77.5  2.5e-22
0047309    1/1      37   213 ..     1   208 []   105.8  1.5e-31
0050105    1/1      37   213 ..     1   208 []    92.5  2.4e-27
0046909    1/1      38   211 ..     1   178 []   159.7    2e-46
0051105    1/1      38   192 ..     1   169 [.    62.2    6e-17
0035791    1/1      40   213 ..     1   214 []   115.6  1.5e-33
0041991    1/1      40   215 ..     1   179 []   147.2  4.5e-43
0036900    1/1      41   209 ..     1   243 []   103.6  2.2e-32
0040356    1/1      41   213 ..     1   181 []   148.0  9.7e-43
0051163    1/1      44   214 ..     1   191 []   160.1  3.3e-50
0050136    1/1      45   211 ..     1   174 []   110.6  2.7e-34
0048919    1/1      46   215 ..     1   236 []   159.5  1.4e-45
0048249    1/1      47   212 ..     1   216 []   142.9  3.3e-40
0041997    1/1      50   214 ..     1   213 []   101.6  1.2e-29
0046155    1/1      51   211 ..     1   228 []   106.1    3e-29
0044334    1/1      52   203 ..     1   178 []    88.4    7e-27
0034851    1/1      54   212 ..     1   178 []    98.5  2.7e-30
0050349    1/1      54   213 ..     1   182 []    73.0  1.5e-22
0050435    1/1      56   216 .]     1   208 []    25.3  3.4e-07
0048678    1/1      58   214 ..     1   210 []   104.2  1.9e-31
0051301    1/1      62   211 ..     1   178 []    67.8  7.6e-20
0038017    1/1      64   213 ..     1   177 []   100.6  5.3e-29
0038588    1/1      64   208 ..     1   173 []    88.2  7.9e-26
0042536    1/1      64   211 ..     1   183 []    26.1  3.3e-07
0041489    1/1      66   212 ..     1   179 []    85.3  4.1e-25
0050151    1/1      67   214 ..     1   153 []    90.6  3.9e-28
0041576    1/1      68   208 ..     1   150 []    99.4  1.4e-29
0046852    1/1      70   211 ..     1   233 []    59.3  5.1e-16
0047030    1/1      73   215 ..     1   231 []    62.0  1.2e-18
0052114    1/1      90   212 ..     1   140 [.    43.4  7.8e-12
0049833    1/1      92   214 ..     1   109 [.    28.2    5e-08
0046350    1/1      94   189 ..     1    84 [.    26.4  4.1e-07

Alignments of top-scoring domains:
0035468: domain 1 of 1, from 21 to 213: score 100.5, E = 9.1e-31
                   *->elllmidalksakritvvi..pyhplarqlltilrdkptsaklfrdl
                       +l+  +++k +++i+v++ + ++  ++ +++ ++d+p++++lf d+
  ABA56702.1    21    ICLFNPNHIKCLPQILVYLgkASMERLKTKIRDIPDFPKPGVLFKDI 67   

                   ldrlgrllvyeallhlpqiqgffdtpvdnlyagvldldnlvvVsilrgGv
                   ++++g++ +              +  v++l + +l+ d+++v +i+++G+
  ABA56702.1    68 TPLVGDPAT-------------LRLAVHQLLHPFLEQDITAVGGIEARGF 104  

                   llaaalakllgdaplgfilirrdek..........tlepvlyylklpgdv
                   +++a +a +lg   +gfi++r+ +k  +++  + + le+++  l+ + d 
  ABA56702.1   105 IFGALVAWELG---VGFIPLRKSGKlpyevrsisyQLEYGSASLEAHTDS 151  

                   ..kgrrVllvDdmlaTGgTllaAielLkelGakvvriavlhllasgegie
                     +g++VllvDd+laTGgT+ a +el+ +lGa+v  +a++++l++++g+e
  ABA56702.1   152 lgPGDNVLLVDDLLATGGTAKASCELVESLGATVAACAFVIELDFLHGRE 201  

                   rlleafpdvvivtatidlelneklyivpglgdagdrlfgtePitaklvadlllelladriltfglftlksglqspgffdirvllldpe
                      P    ++ +  +e l+++i+ +++f+++++l    f di++l+ dp+
  ABA56702.1    33    PQILVYLGKASMERLKTKIRDIPDFPKPGVL----FKDITPLVGDPA 75   

                   llrllarllaelikdlgleidvvvgpdagGiplaaalalalgvplvfvrk
                    lrl++++l++ + ++  +i++v g++a+G++++a +a +lgv++++ rk
  ABA56702.1    76 TLRLAVHQLLHPFLEQ--DITAVGGIEARGFIFGALVAWELGVGFIPLRK 123  

                   erk..............ghgeveliegalvkgkrVlivDDvitTGgTlla
                    +k  +++  + ++ ++g   +e + + l +g++Vl+vDD+++TGgT++a
  ABA56702.1   124 SGKlpyevrsisyqleyGSASLEAHTDSLGPGDNVLLVDDLLATGGTAKA 173  

                   aaellkeaGaevvgvavlvdllsggarerledagipvlsltdlidllevl
                    +el++++Ga+v+++a++++l ++++rerl d+ ++ l+           
  ABA56702.1   174 SCELVESLGATVAACAFVIELDFLHGRERLSDYTVHSLVH---------- 213  

                   kelgkikplsvapllaeaidrlfgdalkrvsaldiplvkplltylrddrtpggdfrlgsgrlstlllyealf
                      +l ++   +   +k +++ ++d+++pg  f++++++++         
  ABA56702.1    35    ILVYLGKASMERLKTKIRDIPDFPKPGVLFKDITPLVG--------- 72   

                   dlpvddlealtplaeelaell.dlkidvvvgilrgGlplaaglaralpga
                        d+  l++ +++l + +   +i++v gi+++G++++a +a +l g+
  ABA56702.1    73 -----DPATLRLAVHQLLHPFlEQDITAVGGIEARGFIFGALVAWEL-GV 116  

                   plgfirkrrkgatl....gpvleygklpgdv......kgkrVllvDDvia
                   +++++rk+ k++ ++  ++++leyg    + +++   +g++VllvDD++a
  ABA56702.1   117 GFIPLRKSGKLPYEvrsiSYQLEYGSASLEAhtdslgPGDNVLLVDDLLA 166  

                   TGgTllaaielLkeaGakvvivavlvar..pegldrlgaagpdvvivtyg
                   TGgT++a +el+++ Ga v  +a++++++ + g++rl +  +   +++  
  ABA56702.1   167 TGGTAKASCELVESLGATVAACAFVIELdfLHGRERLSDYTVHSLVHY-- 214  

                   idlplnekgyilpglgdagdrlfgtelvakllldagalkfgiftlpsgpisgi.fvdllkllvdpellrrlae
                      lv+    +++ lk  i+++p++p++g+ f d+++l++dp  lr+  +
  ABA56702.1    36    LVYLGKASMERLKTKIRDIPDFPKPGVlFKDITPLVGDPATLRLAVH 82   

                   elaeriagldidvvvgvprgGiplaaalaralgvplvivrkkaklpgddt
                   +l   + ++di++v g++++G++++a++a +lgv++++ rk +klp  ++
  ABA56702.1    83 QLLHPFLEQDITAVGGIEARGFIFGALVAWELGVGFIPLRKSGKLPY-EV 131  

                   lsvgyvlerstgvleillilgalvegkrVllVDDviatGgTlraaielLr
                    s++y+le+++  le +   ++l +g++VllVDD++atGgT++a +el++
  ABA56702.1   132 RSISYQLEYGSASLEAH--TDSLGPGDNVLLVDDLLATGGTAKASCELVE 179  

                   eaGakvvgvavlvdkpggrellilpdvpvislptddelvgygldypelgr
                   ++Ga+v+ +a+++++   + +++l d++v+sl+                 
  ABA56702.1   180 SLGATVAACAFVIELDFLHGRERLSDYTVHSLVH---------------- 213  

                   aldaislrepitaklvadlllragadflipgdlhvdisdlllswevikalire
                      ++ +  +   ++  +r+++df++pg l++di+ l+ ++ ++++++ +
  ABA56702.1    37    VYLGKASMERLKTKIRDIPDFPKPGVLFKDITPLVGDPATLRLAVHQ 83   

                   laeeiaedykdgvepdvivgvlrgGlpfaallarelgvplavdrkrvksy
                   l + ++e      +++++ g++ +G++f+al+a elgv ++  rk  k++
  ABA56702.1    84 LLHPFLEQ-----DITAVGGIEARGFIFGALVAWELGVGFIPLRKSGKLP 128  

                   gg........trstgelkilkdldgdlegkkVLiVDDiidtGgTllaaae
                    ++  + ++ ++++  l+ + d   +  g++VL+VDD+++tGgT++a +e
  ABA56702.1   129 YEvrsisyqlEYGSASLEAHTDS--LGPGDNVLLVDDLLATGGTAKASCE 176  

                   lLkeagaksvkvavvll.dkpegrkvdikpdyvgfevptdtfivGygldy
                   l+++ ga++  +a+v+  d+ +gr+                         
  ABA56702.1   177 LVESLGATVAACAFVIElDFLHGRER------------------------ 202  

                   aedyrnlpyiavlkpegyevlsladllaeaidgviidesissitvvvpylpylrqdltiirdkltsgilfrdyvdrlltlldlealril
                      + +    +  l+ +++ i+d++++g+lf+d+++++++          
  ABA56702.1    37    VYLGKASMERLKTKIRDIPDFPKPGVLFKDITPLVGD---------- 73   

                   gffdipvdtplaelllalrglkqlvvvgilrgGvplaaalaralpgaplg
                      + +++  +++ll  +++ ++++v gi+++G++++a +a +l g++++
  ABA56702.1    74 ---PATLRLAVHQLLHPFLEQDITAVGGIEARGFIFGALVAWEL-GVGFI 119  

                   fvrkrrklpglgpvleylllpgdv..........egrrVllvDDvlaTGg
                   ++rk++klp + +++ y l++g+   +++++   +g++VllvDD+laTGg
  ABA56702.1   120 PLRKSGKLPYEVRSISYQLEYGSAsleahtdslgPGDNVLLVDDLLATGG 169  

                   TllaaieaLkeaGakvvgvavlvd..apegldrlgeavpdvvvvtatidl
                   T++a +e+++++Ga+v  +a++++ +++ g++rl  + ++ +v       
  ABA56702.1   170 TAKASCELVESLGATVAACAFVIEldFLHGRERLSDYTVHSLVH------ 213  

                   elnevlyilpglgdagdrlfgtekrasaldiplvipyltylrddrtpgirfrdladrlatlllhealfdl
                       ++   +   ++ +++ ++d+++pg++f+d++++++           
  ABA56702.1    37    VYLGKASMERLKTKIRDIPDFPKPGVLFKDITPLVG----------- 72   

                   pvddlealtplaeelaelr.glkqlvvvgilrgGvplaaalaralpgapl
                      d+  l++ +++l++ +   ++++v gi+++G++++a +a +l g+++
  ABA56702.1    73 ---DPATLRLAVHQLLHPFlEQDITAVGGIEARGFIFGALVAWEL-GVGF 118  

                   giirkrrk............eyglgpvliyldlpgdvegrrVllvDDvla
                   +++rk++k  +++  + ++ eyg++ +++++d  g  +g++VllvDD+la
  ABA56702.1   119 IPLRKSGKlpyevrsisyqlEYGSASLEAHTDSLG--PGDNVLLVDDLLA 166  

                   TGgTllaaaelLkeaGakvvivavlva..apeglerlgkavpdvvvvtag
                   TGgT++a +el++++Ga+v  +a++++ ++  g+erl  + ++ +v+   
  ABA56702.1   167 TGGTAKASCELVESLGATVAACAFVIEldFLHGRERLSDYTVHSLVH--- 213  

                   idlelnekgyilpglgdagdrlfgtelvaelllelladriltvglfplksglyfditkllldpelllelarll
                      ++ +  +e l+++i+++++fp++++l++dit+l++dp+ l++++++l
  ABA56702.1    38    YLGKASMERLKTKIRDIPDFPKPGVLFKDITPLVGDPATLRLAVHQL 84   

                   aeeiaellpgldidvvvgiergGiplaaalaralgvplvlvrkkgklhgt
                    + ++e+    di++v gie++G++++a++a +lgv+++++rk+gkl+++
  ABA56702.1    85 LHPFLEQ----DITAVGGIEARGFIFGALVAWELGVGFIPLRKSGKLPYE 130  

                   tlsveyrlenvegalklpkdalvkgkrVllVDDvlaTGgTllaaaellke
                   ++s++y le+++  l+ + d l +g++VllVDD+laTGgT++a +el+++
  ABA56702.1   131 VRSISYQLEYGSASLEAHTDSLGPGDNVLLVDDLLATGGTAKASCELVES 180  

                   aGakvvgvavlvdrpegggrelleeagvdlylvvvpdhpllkhlltilrdkntssidfrflldrlgrllvyealrilp
                      ++   +   lk +++ + d++ ++++f                +i+p
  ABA56702.1    38    YLGKASMERLKTKIRDIPDFPKPGVLFK---------------DITP 69   

                   leeievetplgatligellkdlkklvvvsilrgGlplaaglarllpsapv
                   l++ + +  l++++  + +++ + ++v +i+++G++++a +a  l+   v
  ABA56702.1    70 LVGDPATLRLAVHQLLHPFLEQDITAVGGIEARGFIFGALVAWELG---V 116  

                   gfilirrygetvvevllelepvlyylk....lpgdilkgknVllvDdmia
                   gfi +r+ g+ ++ev + +++++y+    +++ +++ +g+nVllvDd++a
  ABA56702.1   117 GFIPLRKSGKLPYEVRSISYQLEYGSAsleaHTDSLGPGDNVLLVDDLLA 166  

                   TGgTllaaielLkkagpkriivavlldlhagqilgffdfpldslcispyyyddrpdllldpeliyelvrrlae
                         + + l+  ++ +++++++++++ d+++l+ dp  ++ +v++l +
  ABA56702.1    40    GKASMERLKTKIRDIPDFPKPGVLFKDITPLVGDPATLRLAVHQLLH 86   

                   elaeklggkpdvvvgvprgGvplaaalaralgvplvivrkrrklpvdfls
                    ++e    ++++v g++++G++++a++a +lgv+++++rk +klp+++ s
  ABA56702.1    87 PFLEQ---DITAVGGIEARGFIFGALVAWELGVGFIPLRKSGKLPYEVRS 133  

                   vssyvgrtliegnvilrlrldgdvkGkrVllVDDvidTGgTlraaaelLr
                   +s+    +l++g+  l+ + d++ +G++VllVDD+++TGgT++a +el++
  ABA56702.1   134 ISY----QLEYGSASLEAHTDSLGPGDNVLLVDDLLATGGTAKASCELVE 179  

                   eaGakvvgvavlvdkpsgravdilpdyygievpttdligygldveekyrn
                   ++Ga+v  +a+++++ +  ++++l dy +++++                 
  ABA56702.1   180 SLGATVAACAFVIELDFLHGRERLSDYTVHSLVH---------------- 213  

                   lpsiapllaeallravgrvltldlllkqirffldspvdgllyiditkllldpellrelarllae
                          ++ l+  ir ++d+p++g+l++dit+l++dp+ lr+++++l +
  ABA56702.1    40    GKASMERLKTKIRDIPDFPKPGVLFKDITPLVGDPATLRLAVHQLLH 86   

                   elaellpleidvvvgiprgGfplaaalaralgvplvlvrkrrklpgttls
                    ++e    +i++v gi+++Gf+++a++a +lgv+++++rk++klp +++s
  ABA56702.1    87 PFLEQ---DITAVGGIEARGFIFGALVAWELGVGFIPLRKSGKLPYEVRS 133  

                   reerlenlkvalelslgadvegkrVllVDDvlaTGgTlraaaelLkeaGa
                   ++++le++   le + +++ +g++VllVDD+laTGgT++a +el++++Ga
  ABA56702.1   134 ISYQLEYGSASLEAHTDSLGPGDNVLLVDDLLATGGTAKASCELVESLGA 183  

                   kvvgvavlvdkpeggarlrlegvdveslvgydkacafelly..ydlpdsqiigffkydvdpll.....grllaeelaer
                      ka + +l+++++d+pd++++g+++ d++pl  + +++rl +++l++ 
  ABA56702.1    41    KASMERLKTkiRDIPDFPKPGVLFKDITPLVgdpatLRLAVHQLLHP 87   

                   lkdldidvvvgvprgGiplaaalaralgvplvivrkrrkyygrtqiglgr
                   + ++di++v g++++G++++a++a +lgv++++ rk  k++ ++ ++++ 
  ABA56702.1    88 FLEQDITAVGGIEARGFIFGALVAWELGVGFIPLRKSGKLPYEVRSISY- 136  

                   eerekgvrlkllpldadvkgkrVllVDDviatGgTlraaielLreaGAkv
                    ++e+g   ++ + d++ +g++VllVDD++atGgT++a +el++ +GA+v
  ABA56702.1   137 -QLEYGSASLEAHTDSLGPGDNVLLVDDLLATGGTAKASCELVESLGATV 185  

                   vgvavlvdkpsgpafegidlsgreeliatgtiveelaeiigadslvvlsl
                     +a+++        e+ +l gre+l  + +                   
  ABA56702.1   186 AACAFVI--------ELDFLHGRERLSDYTVH------------------ 209  

                   ddllaavglripglgslsdllftdyygfeipdefvvgygldyaelyrnlp
                                                                     
  ABA56702.1     - -------------------------------------------------- -    

                   yigdlllelladriltvglfgkpgflyidilkllgdpellrlladllaer
                      +  +e l+++i+++++f+kpg+l+ di++l gdp +lrl++++l++ 
  ABA56702.1    41    KASMERLKTKIRDIPDFPKPGVLFKDITPLVGDPATLRLAVHQLLHP 87   

                   lkdldidvvvgiprgGfplaaalaralgvplvivrkkrklpvqvillsye
                   + ++di++v gi+++Gf+++a++a +lgv+++++rk +klp++v ++sy+
  ABA56702.1    88 FLEQDITAVGGIEARGFIFGALVAWELGVGFIPLRKSGKLPYEVRSISYQ 137  

                   leygldvafelklpadvkgkrVllvDDvlaTGgTllaaielLkeaGakvv
                   leyg +  +e + +++ +g++VllvDD+laTGgT++a +el++++Ga+v 
  ABA56702.1   138 LEYGSA-SLEAHTDSLGPGDNVLLVDDLLATGGTAKASCELVESLGATVA 186  

                   gvavladrpllslggrerlveagvdvviltdtidlkellelireigalpkggfllfidilsllldpellrllgellaerla
                      +++l+ +ir+i+++pk+g+l f di++l+ dp+ lrl++++l + + 
  ABA56702.1    44    MERLKTKIRDIPDFPKPGVL-FKDITPLVGDPATLRLAVHQLLHPFL 89   

                   glkidvvvgveagGiplaaalaralgvplvfvrkegklhgegrtiegsvy
                   +++i++v g+ea+G++++a++a +lgv+++++rk gkl++e    + s++
  ABA56702.1    90 EQDITAVGGIEARGFIFGALVAWELGVGFIPLRKSGKLPYE----VRSIS 135  

                   srleygvdllllsldallkgkrVlivDDvlatGgTllaaiellkeaGakv
                   + leyg + l+ ++d+l +g++Vl+vDD+latGgT++a +el++++Ga+v
  ABA56702.1   136 YQLEYGSASLEAHTDSLGPGDNVLLVDDLLATGGTAKASCELVESLGATV 185  

                   vgvavlidkpelggreklvgagvpveslvgldlllnelvrilpgelleldllkfgdfvltyglhsdsyidffkvlvdpellrrlarllaer
                           +l+  ++ ++++++++ ++ d++++ +dp+ lr+++++l++ 
  ABA56702.1    45    ----ERLKTKIRDIPDFPKPGVLFKDITPLVGDPATLRLAVHQLLHP 87   

                   lkd.didvvvgvplgGfplaaalaralglplvivrkrrkyvlpgfiglss
                   + ++di++v g++++Gf+++a++a +lg+++++ rk +k  lp ++ + s
  ABA56702.1    88 FLEqDITAVGGIEARGFIFGALVAWELGVGFIPLRKSGK--LPYEVRSIS 135  

                   ysrdygvggalellkgllgdvegkrVllVDDvittGgTlraaaelLkeaG
                   y+++yg++  le + + lg  +g++VllVDD+++tGgT++a +el++++G
  ABA56702.1   136 YQLEYGSA-SLEAHTDSLG--PGDNVLLVDDLLATGGTAKASCELVESLG 182  

                   akvvgvavlvdk..pegr..lpdyslvvlpvltaviPylgyarqdrkllpleaisaklvgrfildsgkksiifvdlrkl
                                            ++k  +r i+d++k++++f+d+++l
  ABA56702.1    46    ----------------------RLKTKIRDIPDFPKPGVLFKDITPL 70   

                   lsdpellllladllaelikelllkidvvvgvelgGiplAaalalrlglpl
                   ++dp+ l+l++++l++ + e   +i++v g+e++G++++a++a +lg+++
  ABA56702.1    71 VGDPATLRLAVHQLLHPFLEQ--DITAVGGIEARGFIFGALVAWELGVGF 118  

                   vivrkrrklpgttvviellyryeleygavtlelklgalvkgkrVllvDDv
                   ++ rk +klp ++++i+    y leyg+++le + ++l +g++VllvDD+
  ABA56702.1   119 IPLRKSGKLPYEVRSIS----YQLEYGSASLEAHTDSLGPGDNVLLVDDL 164  

                   laTGgTalaaaellkeaGakvvgvavlvdllslggrerleeagidlvslt
                   laTGgTa+a +el++++Ga+v  +a++++l +l+grerl ++ ++ ++ +
  ABA56702.1   165 LATGGTAKASCELVESLGATVAACAFVIELDFLHGRERLSDYTVHSLVHY 214  

                   dtidllevalllglitleslelllellldplewseengecavipylgyarqdrcakclehplaklklrflldsgkpsiifidllkl
                                             +k k+r ++d++kp+++f d+++l
  ABA56702.1    47    -----------------------LKTKIRDIPDFPKPGVLFKDITPL 70   

                   lgdpellealadllaelikellldidvvvgvplrGfplaaalalrlglpl
                    gdp+ l+++ ++l+  + e+  di++v g+++rGf+++a++a +lg+++
  ABA56702.1    71 VGDPATLRLAVHQLLHPFLEQ--DITAVGGIEARGFIFGALVAWELGVGF 118  

                   vivrkkrklpgtrvtieglylselergpnllllklpalvkgkrVllvDDv
                   ++ rk +klp ++++i++     le+g   l+ + ++l +g++VllvDD+
  ABA56702.1   119 IPLRKSGKLPYEVRSISY----QLEYGSASLEAHTDSLGPGDNVLLVDDL 164  

                   ltTGgTalaaaelLkeaGakvvgvlvlvdlpegggrerladpgvkllilt
                   l+TGgTa+a +el+++ Ga+v  ++++++l ++ grerl d+ v+ l+  
  ABA56702.1   165 LATGGTAKASCELVESLGATVAACAFVIELDFLHGRERLSDYTVHSLV-- 212  

                   ddidlnevgyivpglgdeeepitakllaellleagalrvgefdlhsgqispiffdi.kvlldpell
                                       +r ++++++ g +   f di+++++dp+ l
  ABA56702.1    50    ----------------KIRDIPDFPKPGVL---FKDItPLVGDPATL 77   

                   ralgrllaelirelgldidvvvgvplgGiplaaalaralglplnrgvpfv
                   r+++++l++ + e   di++v g++++G++++a++a +l      gv+f+
  ABA56702.1    78 RLAVHQLLHPFLEQ--DITAVGGIEARGFIFGALVAWEL------GVGFI 119  

                   firkerk............eygevvllig...lvkgkrVllVDDvittGg
                   + rk +k  +++  + ++ eyg   l+ +++ l +g++VllVDD+++tGg
  ABA56702.1   120 PLRKSGKlpyevrsisyqlEYGSASLEAHtdsLGPGDNVLLVDDLLATGG 169  

                   TlraaaelLreaGakvvgvavlvdrpelggpaiedleellvtigvpvlsl
                   T++a +el++++Ga+v  +a+++++++l+g+        +++ +++v+sl
  ABA56702.1   170 TAKASCELVESLGATVAACAFVIELDFLHGR--------ERLSDYTVHSL 211  

                   lsldvlieflvgagllaeeilrilpgigvyplrqdrklcgrelisaklvadllallgydfvltsdlhslkyqdifillv
                                               ++ +++++++++ ++di++l  
  ABA56702.1    51    -------------------------IRDIPDFPKPGVLFKDITPLVG 72   

                   dilallailaaiiekdlgpkplvvvgilrgGfpfaaalarelglplviir
                   d+++l+  +++++  +l  ++ +v gi+++Gf+f+a++a elg+ ++++r
  ABA56702.1    73 DPATLRLAVHQLLHPFLEQDITAVGGIEARGFIFGALVAWELGVGFIPLR 122  

                   kvgklprvtvtisqsslygktrsegvvvilldldgdlkGkhVllVDDvid
                   k gklp+ + +is++++yg++  e       + d++  G++VllVDD+++
  ABA56702.1   123 KSGKLPYEVRSISYQLEYGSASLE------AHTDSLGPGDNVLLVDDLLA 166  

                   TGgTlaaaaelLkkagaksvkvavlldkpsgralpilpdyvgfeipdsfv
                   TGgT++a +el++++ga +  +a+++++    ++++l dy ++++     
  ABA56702.1   167 TGGTAKASCELVESLGATVAACAFVIELDFLHGRERLSDYTVHSL----- 211  

                   vgygldyaelyrnlpyiyvlkpevleklkaagaqsdiffdgelvrdlarllae.........eiaerlkgldpdvvvg
                      ++++d++ +g l++d+++l+++ ++   +++++++ + + d+ +v g
  ABA56702.1    52    RDIPDFPKPGVLFKDITPLVGDpatlrlavhQLLHPFLEQDITAVGG 98   

                   iprgGvplaaalaralglplvivrkvgklgrtryrdeqkelslgerlkll
                   i+++G++++a++a +lg+ ++++rk gkl++++   ++ +l++g   ++ 
  ABA56702.1    99 IEARGFIFGALVAWELGVGFIPLRKSGKLPYEVRSISY-QLEYGSASLEA 147  

                   rlpadlkgkrVllVDDvidTGgTlraaielLreaGrakvvgvavlvdrp.
                   + +++ +g++VllVDD+++TGgT++a +el++++G a+v  +a+++++  
  ABA56702.1   148 HTDSLGPGDNVLLVDDLLATGGTAKASCELVESLG-ATVAACAFVIELDf 196  

                   .egraklrpdyvglsipdeflvgygldvpelrdlddllvlslfsdilldgllirdlarllad.........eiaerlkglkpdvvvgil
                      ++d++ +g+l++d+++l++d ++   +++++++ + + ++++v gi+
  ABA56702.1    54    IPDFPKPGVLFKDITPLVGDpatlrlavhQLLHPFLEQDITAVGGIE 100  

                   rgGvplaaalaralgvplvivrkvgklgvtsytddqyalergegnliigf
                   ++G++++a++a +lgv ++++rk gkl+ ++ + + y+le+g++ l+ ++
  ABA56702.1   101 ARGFIFGALVAWELGVGFIPLRKSGKLPYEVRSIS-YQLEYGSASLEAHT 149  

                   dlpgdvkgkrVllVDDviaTGgTlraaidlLkeagrakvvgvavlvdkp.
                   d +g  +g++VllVDD++aTGgT++a ++l++++g a+v  +a+++++  
  ABA56702.1   150 DSLG--PGDNVLLVDDLLATGGTAKASCELVESLG-ATVAACAFVIELDf 196  

                   .egrkrlradyvgvliptdfvvgygldydeflrnlpyivpglrpdvlldgedirelgrllar..elaedlalllveveglkpdvvvgip
                      +pd++ +g +++++++l+++ + l+ ++ +ll+ +   ++++v gi+
  ABA56702.1    54    IPDFPKPGVLFKDITPLVGDpaTLRLAVHQLLHPFLEQDITAVGGIE 100  

                   rgGvplaaalaralglplvlvrklgvlgitfyrdeqkllgrgavleglkl
                   ++G++++a++a +lg+ ++++rk g+l++++   ++ l+++ a le + +
  ABA56702.1   101 ARGFIFGALVAWELGVGFIPLRKSGKLPYEVRSISYQLEYGSASLEAHTD 150  

                   pfdvegkrVllVDDvltTGgTlraaidaLreaGrakvvgvavlvdrp..e
                     + +g++VllVDD l+TGgT++a ++++++ G a+v  +a++++    +
  ABA56702.1   151 -SLGPGDNVLLVDDLLATGGTAKASCELVESLG-ATVAACAFVIELDflH 198  

                   grkplapdyvglevptsldefvvgygldydefgrilpgillFedrpiaaklladlLeaagadrvltldlhrggvpvaaeiagfldi
                                                  d++++gv++ + +  + d 
  ABA56702.1    56    ----------------------------DFPKPGVLFKDITPLVGDP 74   

                   pldlllarkilapyldelv..lvaialggvvv...lspdlg.gvlragel
                      +l++  +l+p+l+++++++++i  +g+++ + ++ +lg+g++++++ 
  ABA56702.1    75 ATLRLAVHQLLHPFLEQDItaVGGIEARGFIFgalVAWELGvGFIPLRKS 124  

                   divly..rdyaeldkrrplvrevrlpgdvegktVllVDDvidTGgTlraa
                   +++ y++r++ + ++++ +  e + +    g++VllVDD+++TGgT+ a 
  ABA56702.1   125 GKLPYevRSISYQLEYGSASLEAHTDSLGPGDNVLLVDDLLATGGTAKAS 174  

                   ldaLrelgaksvvaavlvlspralrrlpisadvvglntpplfvevgvgld
                   ++++ +lga+ v a++ v   + l   +   d+ ++ ++ +         
  ABA56702.1   175 CELVESLGAT-VAACAFVIELDFLHGRERLSDYTVHSLVHYXX------- 216  

                   efdqlrdleviellaealsPkpyiafrdilldlleirealrrlaellaerlkglelldlgkpdvvv
                      Pkp+++f+di ++l  +++ lr+ +++l++ + + +      +++v 
  ABA56702.1    58    PKPGVLFKDI-TPLVGDPATLRLAVHQLLHPFLEQD------ITAVG 97   

                   gilrgGvplaaalaralgllgvpvpl.gfllvssyrdetr.elgvvrlle
                   gi+++G++++a++a +lg++++p+++ g+l++++ + +++ e+g + l+ 
  ABA56702.1    98 GIEARGFIFGALVAWELGVGFIPLRKsGKLPYEVRSISYQlEYGSASLEA 147  

                   glpadvkgkrVllVDDviaTGgTlraaielLreaGakvvgvavlvdkpeg
                   + +++ +g++VllVDD++aTGgT++a +el++++Ga+v  +a+++++ ++
  ABA56702.1   148 HTDSLGPGDNVLLVDDLLATGGTAKASCELVESLGATVAACAFVIELDFL 197  

                   raleilpdyvgielpdkfvigygldagerlrglpliavlklevllklkll
                   +++e+l dy +++l  +                                 
  ABA56702.1   198 HGRERLSDYTVHSLVHY--------------------------------- 214  

                   lelkakllaelelgllhyfdiqklllspedileairllaeeiaedlggkpdvvvgvlrgGvp
                      + + di+ l+ +p+ ++ a+ +l + ++e+   ++++v g+  +G++
  ABA56702.1    62    VLFKDITPLVGDPATLRLAVHQLLHPFLEQ---DITAVGGIEARGFI 105  

                   laaalaralglplavgfkrrksygddlstlgeverlkdlpg.....dveg
                   ++a++a +lg+ ++ ++k  k+ ++  s++ ++e+++   +++++    g
  ABA56702.1   106 FGALVAWELGVGFIPLRKSGKLPYEVRSISYQLEYGSASLEahtdsLGPG 155  

                   kdVllVDDvidTGgTlraaaeaLkeagaksvkvavlvdkpegraleilpd
                   ++VllVDD+++TGgT++a +e+++++ga++  +a ++ +      e+l d
  ABA56702.1   156 DNVLLVDDLLATGGTAKASCELVESLGATVAACAFVIELDFLHGRERLSD 205  

                   yvgfevpdefvvgygldydellrnlpyivvllgdagYfdiqgllidpedilaaiellaeeiaeklkgglepdvvvgvprgGvp
                      ++di++l+ dp  ++ a+ +l + ++e+     ++++v g++++G++
  ABA56702.1    64    FKDITPLVGDPATLRLAVHQLLHPFLEQ-----DITAVGGIEARGFI 105  

                   laaalaralgvplaivrkrrksyggtfslsgeleil.....ldlrgdvkg
                   ++a++a +lgv+++  rk  k+++++ s+s++le++ +  + + +++ +g
  ABA56702.1   106 FGALVAWELGVGFIPLRKSGKLPYEVRSISYQLEYGsasleAHTDSLGPG 155  

                   krVllVDDvidtGgTlraaaelLkeagakvvgvavlldkpsgraverlpd
                   ++VllVDD+++tGgT++a +el++++ga+v  +a+++++ + +++erl d
  ABA56702.1   156 DNVLLVDDLLATGGTAKASCELVESLGATVAACAFVIELDFLHGRERLSD 205  

                   yvgieipttdligygldyeeilrnlpaislllldlyldffkllvdpeliralarllaeeilelyggepdvvvgvprgGvpla
                      ++d+++l+ dp+ +r ++++l + +le+   ++++v g++++G++++
  ABA56702.1    64    FKDITPLVGDPATLRLAVHQLLHPFLEQ---DITAVGGIEARGFIFG 107  

                   aalaralgvplvivrkrrksygd......terrgnvkilkdlpgdvegkr
                   a++a +lgv+++++rk  k+++++  + +++++g   +  + +++ +g++
  ABA56702.1   108 ALVAWELGVGFIPLRKSGKLPYEvrsisyQLEYGSASLEAHTDSLGPGDN 157  

                   VllVDDvidTGgTlraaaelLkeagakvvgvavlvdkpsggaelklkpdy
                   VllVDD+++TGgT++a +el++++ga+v  +a+++++ + +++++l +  
  ABA56702.1   158 VLLVDDLLATGGTAKASCELVESLGATVAACAFVIELDFLHGRERLSDYT 207  

                   vglevptdfvvgypldyfeklrnlpviallaeydrlldvllseeqiqgfidiladelaedyllldyiglepdvvvgvlr
                      ++++  ++ + + +  ++ +l +   e          +   v g+  
  ABA56702.1    64    FKDITPLVGDPATLRLAVHQLLHPFLEQ---------DITAVGGIEA 101  

                   gGvvfaadlaralgllg........lplpldfidksryggdtsslgnvvi
                   +G++f a++a +lg+ ++   +  +lp+++  i  +  +g++      ++
  ABA56702.1   102 RGFIFGALVAWELGVGFiplrksgkLPYEVRSISYQLEYGSA------SL 145  

                   vkdligdvegkhVllVDDiidtGgTlraaaelLkeagaksvkvavlldkp
                     + ++   g +VllVDD++ tGgT +a +el+ ++ga++  +a ++   
  ABA56702.1   146 EAHTDSLGPGDNVLLVDDLLATGGTAKASCELVESLGATVAACAFVIELD 195  

                   sgravdiipdyvgfelpdkfvvgygldyaekyrnlpyigvlkpediipllldyevirelgrllaeeiaerlkglkpdvvvgiprgGfplaa
                      di+pl+ d+  +r+++ +l + +     + ++++v gi+++Gf+++a
  ABA56702.1    66    DITPLVGDPATLRLAVHQLLHPF----LEQDITAVGGIEARGFIFGA 108  

                   alaralglpl.....ggklpvgfvrkerylegglsrlerlknvlgafklp
                   ++a +lg+ ++   + gklp+ +  +++ le+g+++le +         +
  ABA56702.1   109 LVAWELGVGFiplrkSGKLPYEVRSISYQLEYGSASLEAHT--------D 150  

                   adlkgkrVllVDDvitTGgTlraaielLreaGrakvvgvavlvdkp.egr
                   ++ +g++VllVDD+++TGgT++a +el++++G a+v  +a+++++     
  ABA56702.1   151 SLGPGDNVLLVDDLLATGGTAKASCELVESLG-ATVAACAFVIELDfLHG 199  

                   aklladyvgveiptnddeligyglddaedrrnlpviglifkllvdpelilrlgrllaeeikdlkpdvvvgvprgGfplaaalara
                      i++l  dp+ ++ ++++l + +++ ++++v g++++Gf+++a++a +
  ABA56702.1    67    ITPLVGDPATLRLAVHQLLHPFLEQDITAVGGIEARGFIFGALVAWE 113  

                   lgiplvivlkrrkytget......lelggvvlllnldgdvkgkrvllVDD
                   lg+++++ +k +k++ e   + ++le+g + l+ + d + +g++vllVDD
  ABA56702.1   114 LGVGFIPLRKSGKLPYEVrsisyqLEYGSASLEAHTDSLGPGDNVLLVDD 163  

                   vidTGgTlraaaelLkeagakvvkvavlvdkpsgparpdlygidipeliv
                   +++TGgT++a +el++++ga+v  +a+++++ + ++r++l  +++ +l++
  ABA56702.1   164 LLATGGTAKASCELVESLGATVAACAFVIELDFLHGRERLSDYTVHSLVH 213  

                   ygldyaedrrnlltllldpeqiqalidelaeklkelykidvvvgvlrgGlplaaalara
                      ++l+ dp+ ++ ++ +l + ++e+ +i++v g++++G++++a +a +
  ABA56702.1    68    TPLVGDPATLRLAVHQLLHPFLEQ-DITAVGGIEARGFIFGALVAWE 113  

                   lgvplvivrkvgkyp..........etgnvklvldldadvegkrvliVDD
                   lgv++++ rk gk+p+++  + ++ e+g  +l+ + d++ +g++vl+VDD
  ABA56702.1   114 LGVGFIPLRKSGKLPyevrsisyqlEYGSASLEAHTDSLGPGDNVLLVDD 163  

                   iidTGgTllaaaellkeagakvvgvavlldkppdyagerlpdefvvlytl
                   +++TGgT++a +el++++ga+v  +a+++++ +++++erl d+ v     
  ABA56702.1   164 LLATGGTAKASCELVESLGATVAACAFVIELDFLHGRERLSDYTV----- 208  

                   dlaeklrnlpyivPylgyarqdrkclpgepisaklvalllylagldrlltsdkhsgqlql
                                                                     
  ABA56702.1     -    ----------------------------------------------- -    

                   alisaeeileairelaeeieddigpkplvvvgilrgGfnfaallaralgl
                      +  +++ +    +++++ ++  ++ +v gi  +Gf+f+al+a +lg+
  ABA56702.1    70 ---LVGDPATLRLAVHQLLHPFLEQDITAVGGIEARGFIFGALVAWELGV 116  

                   pliiilkvdllprvrltitqssyyrktrskgvvvilldldgdvkgkhVLl
                    +i+ +k ++lp+ ++ i+++  y+ ++ +       + d++ +g++VLl
  ABA56702.1   117 GFIPLRKSGKLPYEVRSISYQLEYGSASLE------AHTDSLGPGDNVLL 160  

                   VDDvvdTGgTlraaaelLkkaGaksvkvavlldkpsgraldikpdyvgfe
                   VDD++ TGgT +a +el+++ Ga +  +a ++ +      +++ dy++++
  ABA56702.1   161 VDDLLATGGTAKASCELVESLGATVAACAFVIELDFLHGRERLSDYTVHS 210  

                   ipdwfvvgygldynelyrnlpyiyvlkeevleklekrcifedlyfarpdsffdgpvvylllarllaelarel.dleadvvvgv
                                          ++++l+   ++l+  +   ++++v g+
  ABA56702.1    73    --------------------DPATLRLAVHQLLHPFlEQDITAVGGI 99   

                   plggiplAaalaralgiplaivlkrnryvgrtfirpsqelrekgvrvkln
                   +++g++++a +a +lg+++++ +k ++++ ++ ++++q   e+g      
  ABA56702.1   100 EARGFIFGALVAWELGVGFIPLRKSGKLPYEVRSISYQ--LEYGSASLEA 147  

                   alvglveGkrVllVDDvittGtTlraaaeaLreaGAkevhvavlvprlsg
                   + ++l +G++VllVDD+++tG+T++a +e+++ +GA++  +a ++++ + 
  ABA56702.1   148 HTDSLGPGDNVLLVDDLLATGGTAKASCELVESLGATVAACAFVIELDFL 197  

                   pavygidmssldeliatdtivdeiaeaigadslaylsledllaalirrin
                    +++++  +++ +l+++                                 
  ABA56702.1   198 HGRERLSDYTVHSLVHYX-------------------------------- 215  

                   ndesgfclacftGeYptglidelllelleelrndedlendvvvgpdrggvpraaaladalglplavvlkrrkragvvpilra
                      + + + v g+ ++g+++ a +a +lg++++ ++k +k + +v     
  ABA56702.1    90    EQDITAVGGIEARGFIFGALVAWELGVGFIPLRKSGKLPYEV----- 131  

                   gllrldgvllllsylrelerlgnveellrlvgdvkgrtVllVDDiidtGg
                              + +++ +  +  +e + +  g   g +VllVDD+++tGg
  ABA56702.1   132 ----------RSISYQLEYGSASLEAHTDSLG--PGDNVLLVDDLLATGG 169  

                   TliaaaelLkeaGakevyvavthgllsgpalerleeaaidevvd.dvvvgvdrggvplaagladllglplavlrkrry............
                      d+  v g+   g+++ a +a +lg++++ lrk+ +  +++  + ++ 
  ABA56702.1    92    DiTAVGGIEARGFIFGALVAWELGVGFIPLRKSGKlpyevrsisyql 138  

                   edgvvrklnlvgdv.kgkrVllvDDiidtGgTllaaadaLreagAkevha
                   e+g         ++  g +VllvDD+++tGgT +a ++++ ++gA++  +
  ABA56702.1   139 EYGSASLEAHTDSLgPGDNVLLVDDLLATGGTAKASCELVESLGATVAAC 188  

                   avlhpvlagpaverldgaaidelvvtndvvvgpddggvpraalladrlglplavilkrr............rs
                         v g+ + g+++ al+a +lg++++ ++k  +  +++  + ++ +
  ABA56702.1    94    -TAVGGIEARGFIFGALVAWELGVGFIPLRKSGklpyevrsisyqLE 139  

                   lgvvrklnivgdv.kgkrvllvDDiidtGgTllaaaeaLreagAkevhaa
                   +g +      +++  g +vllvDD+++tGgT +a +e++ ++gA++  +a
  ABA56702.1   140 YGSASLEAHTDSLgPGDNVLLVDDLLATGGTAKASCELVESLGATVAACA 189