hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /home/genome/SCOP/1.73/Scop1.73.bin
Sequence file:            /home/genome/FASTA/gib_20032.fasta
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: ABA56844.1
Accession:      [none]
Description:    noce0 ABA56844.1 GIB00281CH01 "diaminopimelate epimerase"

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
0046029  Diaminopimelate epimerase-like                 190.2    3.6e-58   2
0044048  Diaminopimelate epimerase-like                 198.2    5.1e-58   1
0043560  Diaminopimelate epimerase-like                 189.8      2e-53   2
0046028  Diaminopimelate epimerase-like                 171.9      3e-51   2
0043521  Diaminopimelate epimerase-like                 155.0    1.5e-42   1
0049758  Diaminopimelate epimerase-like                  60.6    6.8e-17   1
0051111  Diaminopimelate epimerase-like                  33.6    1.8e-08   1
0051110  Diaminopimelate epimerase-like                  29.4      9e-08   2
0044177  Diaminopimelate epimerase-like                  26.6    7.8e-07   2
0049368  Diaminopimelate epimerase-like                  23.0    3.5e-06   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
0043521    1/1       1   276 [.     1   260 []   155.0  1.5e-42
0044048    1/1       1   276 [.     1   332 []   198.2  5.1e-58
0046028    1/2       3   132 ..     1   130 []   166.7  1.1e-49
0044177    1/2       4   130 ..     1   129 []    24.9  2.5e-06
0043560    1/2       5   131 ..     1   140 []    94.6  3.7e-26
0051110    1/2      59   134 ..    57   128 .]    24.4  2.8e-06
0046029    1/2      62   132 ..    74   144 .]    18.7  3.4e-05
0049368    1/1     119   276 ..     1   170 []    23.0  3.5e-06
0049758    1/1     128   277 ..     1   153 []    60.6  6.8e-17
0046029    2/2     133   276 ..     1   144 []   171.5  2.1e-52
0051111    1/1     133   276 ..     1   150 []    33.6  1.8e-08
0043560    2/2     141   275 ..     1   140 []    95.2  2.5e-26
0044177    2/2     197   266 ..     1   129 []     1.7       13
0051110    2/2     200   275 ..    54   128 .]     5.0      1.7
0046028    2/2     203   276 ..    57   130 .]     5.2      1.9

Alignments of top-scoring domains:
0043521: domain 1 of 1, from 1 to 276: score 155.0, E = 1.5e-42
                   *->melpfllvdaFtdepflGNpaaVvlladg...lsdelmqaiArel..
                      m++       Ft++ +lGN+++V+   +    l+++++++iA++   
  ABA56844.1     1    MRIA------FTKMQGLGNDFVVIDALSQplsLTASQVRWIANRRlg 41   

                   .nlsetafvlppd...adfrlriFtPdg.evpfcGHatlaaaavllelgg
                   +++++++ v+p +  + df +riF+ dg ev+ cG++++++a++++e+g+
  ABA56844.1    42 iGCDQVLLVTPASlpaIDFGYRIFNADGgEVEQCGNGARCFARFVREQGL 91   

                   lpggtlvletkaGlltvrv.egglialdfplprllplllpaeladalgl.
                   +++++l+++t +G++ ++++ +g+i++d+++pr++p+ +p  + +  + +
  ABA56844.1    92 TDKNVLRVQTASGIIELQLeTDGQITVDMGVPRFAPHQIPFKVDQEADYy 141  

                   ..........pvlvstglphlvvvldsle..avlalrpdleallelplrv
                     + + +++++ +vs+g+ph+v++++ +++++v++++p le ++++p+rv
  ABA56844.1   142 sleldgqqveIGAVSMGNPHCVLRVPAVDtaPVAHWGPLLESHPRFPQRV 191  

                   gvvvvalysdadfvsRvfapglgvaeDpaTGsaaaalaaylaarllklll
                   +v +++++s+ ++++Rv+++g+g  e+pa+G++a+a+a+   +r++    
  ABA56844.1   192 NVGFAQIVSPGHLRLRVYERGAG--ETPACGTGACAAAVIGKRRGWLSGQ 239  

                   vqgqasgrgglllvevd..dgrvlvgGravlvlegtlllmrssvrlrvvdvhtgGnplrvvldgvpalpgglllekrqaiarldnl
                      mr    + ++++ ++Gn+++v++               q +  +   
  ABA56844.1     1    MR----IAFTKMQGLGNDFVVIDAL------------SQPLSLTASQ 31   

                   retlllePrGhgvmvgalllpptdpdadagvlffnpdg.elpmcGhgtig
                    ++++++  G+g+++++l++p++ p  d+g+++fn+dg e++ cG+g ++
  ABA56844.1    32 VRWIANRRLGIGCDQVLLVTPASLPAIDFGYRIFNADGgEVEQCGNGARC 81   

                   vatallelGlvpkeepvgrlvletpaGlvevevevdggkvesvtflnvpa
                   +a+++ e+Gl++k    ++l+++t +G++e+ +e+dg    ++t++++ +
  ABA56844.1    82 FARFVREQGLTDK----NVLRVQTASGIIELQLETDG----QITVDMGVP 123  

                   flaaldvsvevp..........glgtvtvdivygGnpyavvdvadlglsl
                   ++a+++++++v+++++++  + +   v +++v++Gnp++v++v ++    
  ABA56844.1   124 RFAPHQIPFKVDqeadyyslelDGQQVEIGAVSMGNPHCVLRVPAV---- 169  

                   elsnaaellalgpairaalleqllvvhpedpllhnvyfvilvgllddded
                      ++a+++ +gp+++          hp++p ++nv f ++v++      
  ABA56844.1   170 ---DTAPVAHWGPLLES---------HPRFPQRVNVGFAQIVSP------ 201  

                   adernvvvfedgaidrsPcGtgtsArlAllaakgllalgeefvlesiigs
                     + +++v+e+ga+++++cGtg++A++++  ++g+l+             
  ABA56844.1   202 -GHLRLRVYERGAGETPACGTGACAAAVIGKRRGWLSGQ----------- 239  

                   lfegrvvqvtlvggvgavipeidgr.awvtGlatllldgddplpaGflkFtkmhglGNdfvvvdlrdllldltaeliaalcdrrfgigadglll
                      + Ftkm+glGNdfvv+d+++++l lta +++++++rr+gig+d++ll
  ABA56844.1     3    IAFTKMQGLGNDFVVIDALSQPLSLTASQVRWIANRRLGIGCDQVLL 49   

                   vlpsldegadfrmrifnaDgseaemCGNGtrcvarfllekglvgkdeitv
                   v+p+  + +df +rifnaDg e+e+CGNG+rc+arf++e+gl++k+ ++v
  ABA56844.1    50 VTPASLPAIDFGYRIFNADGGEVEQCGNGARCFARFVREQGLTDKNVLRV 99   

                   etlaglllvtvlgdglvsvdmglprllpveiPlalkfylvdaFtdepfgGnpaaVvlladg...lsdalmqaiarel...
                              aFt++   Gn   V+   +    l+  + + ia +   +
  ABA56844.1     4    --------AFTKMQGLGNDFVVIDALSQplsLTASQVRWIANRRlgi 42   

                   nlsetaFvlppsdpa.dyrvriftpag.elpfcGhatlgaahallelggl
                   +  +   v+p+s pa+d++ rif+ +g e++ cG++ ++ a +++e+g+ 
  ABA56844.1    43 GCDQVLLVTPASLPAiDFGYRIFNADGgEVEQCGNGARCFARFVREQGLT 92   

                   vpdttlvleletgsgpvevrregdg.lvldfplprpefgatlpllalklelmmlldvlvvdvFtdvhflGNPaaVvlladl...lsde
                                           Ft++ +lGN+++V+++ ++   l+++
  ABA56844.1     5    ---------------------FTKMQGLGNDFVVIDALSQplsLTAS 30   

                   lmqaiar...elnlsetafvlppdda..dfrlriftpgg.evpfCGhgtl
                   + + ia+   +++++++++v p + +++df +rif+++g ev++CG+g++
  ABA56844.1    31 QVRWIANrrlGIGCDQVLLVTPASLPaiDFGYRIFNADGgEVEQCGNGAR 80   

                   aaaaallelgllsggtltletpaGlltvellledglvtvdfpaplveege
                   ++a++++e+gl+++++l+++t +G++++ l   dg++tvd+++p++ +++
  ABA56844.1    81 CFARFVREQGLTDKNVLRVQTASGIIELQL-ETDGQITVDMGVPRFAPHQ 129  

                   ipdyrlriFtPtg.EvplaGhatlaaaavllelgll..gvlvletlagl
                      d+  riF+ +g Ev+ +G++  + a +++e+gl++++vl+++t +g+
  ABA56844.1    59    DFGYRIFNADGgEVEQCGNGARCFARFVREQGLTdkNVLRVQTASGI 105  

                   ltvel.dgglilldlpapllepllipelllrvyErGageTlaCGtGacAaavaalllglldskv.tvllpgGllli
                      +r+++ + ge   CG+Ga+++a +++ +gl+d++v +v++ +G++ +
  ABA56844.1    62    YRIFNADGGEVEQCGNGARCFARFVREQGLTDKNVlRVQTASGIIEL 108  

                   lildddgsvlmtGpaelvfegeieleldlpallaaalgldlddllsgl.........ppvvvstglrfllvv
                      ++++p+++++ + + +d+ ++ +  + + +++++ +vs+g+++++++
  ABA56844.1   119    DMGVPRFAPHQIPFKVDQEADYYsleldgqqvEIGAVSMGNPHCVLR 165  

                   leslea..llalrpdlealaelleelgvlgvivtalgdegadfvsRmFaP
                   ++ ++++ ++ + p le + ++ ++++v +  ++++g+  ++++ R    
  ABA56844.1   166 VPAVDTapVAHWGPLLESHPRFPQRVNVGFAQIVSPGHLRLRVYER---- 211  

                   algilEDPvTGsahaaLapyllwagllgkdegllrlvaeQGvasgrggll
                     g  E P++G+ ++a a    + g+l  +      v +       gg+l
  ABA56844.1   212 --GAGETPACGTGACAAAVIGKRRGWLSGQV----NVDLP------GGRL 249  

                   lvellgdggkilrvlvgGravtvlegtlllpleegdfp.slellaaalglalldllglppvvvstgldfllvll...slea
                      +++p  +++ a++++l+l++   +++ +vs+g++++++++ +++ + 
  ABA56844.1   128    HQIPfKVDQEADYYSLELDGQQ-VEIGAVSMGNPHCVLRVpavDTAP 173  

                   llalrpdleal.klldglgvivtalfdlddfvsRvFpalgilEDpaTGsa
                   ++++ p le + +++++++v +++++++ ++++Rv+++ g  E pa+G++
  ABA56844.1   174 VAHWGPLLESHpRFPQRVNVGFAQIVSPGHLRLRVYER-GAGETPACGTG 222  

                   aaalapylaelglllgklelvaeQGvasgrgGlllvellgdg.rvlvgGr
                   a+a a+   ++g+l g++++ +        gG+l ++++gdg++v+++G+
  ABA56844.1   223 ACAAAVIGKRRGWLSGQVNVDL-------PGGRLGIHWEGDGkSVWMSGP 265  

                   avtvlegellldllgglelkllllvlgllllltavnvGnPHlvifvddldkldleklgp
                        ++   ++ l+++g+ +++ av++GnPH+v+ v+ +d+++++++gp
  ABA56844.1   133    KVDQEADYYSLELDGQQVEIGAVSMGNPHCVLRVPAVDTAPVAHWGP 179  

                   llenhplfPegvNvefvevldkneirlrvyErGageTlaCGtGacAaava
                   lle hp+fP++vNv+f+++++++++rlrvyErGageT aCGtGacAaav+
  ABA56844.1   180 LLESHPRFPQRVNVGFAQIVSPGHLRLRVYERGAGETPACGTGACAAAVI 229  

                   alllglldskvtvllpgGlllilildddgsvlmtGpaelvfegeiellleelaaalglslddl..ppvvvstglpfllvplks..leallalrp
                       +++ a++ +l+ld  ++ +  vs+g+p+++++++ ++ + +++  p
  ABA56844.1   133    KVDQEADYYSLELDGQqvEIGAVSMGNPHCVLRVPAvdTAPVAHWGP 179  

                   dlaalaellllvvivta..gddadfvsRmFapalgipEDPaTGsaaaaLa
                    l+ + +++++v + +a++ ++ ++++R++  + g  E Pa+G+ a+a a
  ABA56844.1   180 LLESHPRFPQRVNVGFAqiVSPGHLRLRVYERGAG--ETPACGTGACAAA 227  

                   aylaelllldgklslvieQGvamgrpglllvevdgdggeilrvlvgGrav
                   +   ++++l+g++++ +         g+l ++++gdg+   +v+++G a 
  ABA56844.1   228 VIGKRRGWLSGQVNVDLPG-------GRLGIHWEGDGK---SVWMSGPAE 267  

                   tvlegtllllpllalklelmmlldvlvvdvFtdvhflGNPaaVvlladl...lsde
                                 + l++    v ++ +++GNP++V+ ++++++++++ 
  ABA56844.1   141    -----------YSLELDGQQVEIGAVSMGNPHCVLRVPAVdtaPVAH 176  

                   lmqaiarelnlseta...fvlppddadfrlriftpgg.evpfCGhgtlaa
                   +++++++++++++++++ f + ++++++rlr++++g+ e+p+CG+g++aa
  ABA56844.1   177 WGPLLESHPRFPQRVnvgFAQIVSPGHLRLRVYERGAgETPACGTGACAA 226  

                   aaallelgllsggtltletpaGlltvellledglvtvdfpaplveegeip
                   a+++ ++g+l +g++ +++p+G l +++++++  v++++pa +v+ g i+
  ABA56844.1   227 AVIGKRRGWL-SGQVNVDLPGGRLGIHWEGDGKSVWMSGPAEIVFKGSIE 275  

                   alkfylvdaFtdepfgGnpaaVvlladglsdalmqaiarelnlseta
                                                                     
  ABA56844.1     -    ----------------------------------------------- -    

                   Fvlppsdpadyrvriftp.agelpfcGhatlgaahallelgglvpdttlv
                      +  +p+ +r+r++   age p cG +  +aa++  ++g+l ++    
  ABA56844.1   197 ---QIVSPGHLRLRVYERgAGETPACGTGACAAAVIGKRRGWLSGQ---- 239  

                   leletgsgpvevrregdglvldfplprpefgatdgadyrlriFtPtg.EvplaGhatlaaaavllelgll.gvlvletla
                      ++++ rlr++   + E p +G +  aaa++  ++g+l g++ ++++ 
  ABA56844.1   200    SPGHLRLRVYERGAgETPACGTGACAAAVIGKRRGWLsGQVNVDLPG 246  

                   glltvel..dgglilldlpapllepllipelldfrmrifnaDgseaemCGNGtrcvarfllekglvgkdeitvetlagl
                      + r+r++     e ++CG G+ ++a +  ++g+++ +++ v+  +g 
  ABA56844.1   203    HLRLRVYERGAGETPACGTGACAAAVIGKRRGWLS-GQVNVDLPGGR 248  

                   llvtvlgdg.lvsvdmglprllpveiPl