hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /home/genome/SCOP/1.73/Scop1.73.bin
Sequence file:            /home/genome/FASTA/gib_20033.fasta
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: ABA56902.1
Accession:      [none]
Description:    noce0 ABA56902.1 GIB00281CH01 "response regulator receiver modulated diguanylat.."

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
0051946  EAL domain-like                                200.4    2.5e-56   1
0050343  Nucleotide cyclase                             113.9    1.3e-36   1
0037219  PYP-like sensor domain (PAS domain)             63.5    1.2e-16   1
0050109  PYP-like sensor domain (PAS domain)             57.2    1.1e-15   1
0040536  PYP-like sensor domain (PAS domain)             50.8      2e-14   1
0046377  PYP-like sensor domain (PAS domain)             51.2    5.1e-14   1
0048459  PYP-like sensor domain (PAS domain)             46.5    3.4e-13   1
0048248  PYP-like sensor domain (PAS domain)             46.5    3.5e-12   1
0048715  PYP-like sensor domain (PAS domain)             46.8    6.1e-12   1
0046045  PYP-like sensor domain (PAS domain)             43.6    5.4e-11   1
0048644  PYP-like sensor domain (PAS domain)             41.8    5.6e-11   1
0041279  PYP-like sensor domain (PAS domain)             40.4    8.8e-11   1
0046903  PYP-like sensor domain (PAS domain)             33.6    2.4e-09   1
0048579  PYP-like sensor domain (PAS domain)             35.9    3.9e-09   1
0039925  CheY-like                                       33.7    4.8e-09   1
0050342  CheY-like                                       32.9    1.6e-08   1
0047753  CheY-like                                       31.3      4e-08   1
0051573  CheY-like                                       29.6    4.3e-08   1
0048066  CheY-like                                       31.1    4.8e-08   1
0051574  CheY-like                                       31.3    7.1e-08   1
0048975  CheY-like                                       31.4    1.2e-07   1
0043525  CheY-like                                       28.1    1.4e-07   1
0051860  CheY-like                                       30.1      2e-07   1
0046299  CheY-like                                       28.3    2.2e-07   1
0046428  CheY-like                                       30.4    2.5e-07   1
0047799  CheY-like                                       28.7    2.9e-07   1
0047296  CheY-like                                       30.0    3.2e-07   1
0048465  CheY-like                                       29.7    3.2e-07   1
0050341  CheY-like                                       28.1    3.3e-07   1
0048231  CheY-like                                       28.8    3.3e-07   1
0045700  CheY-like                                       30.2    3.4e-07   1
0051386  CheY-like                                       29.5    4.1e-07   1
0048463  CheY-like                                       31.1    4.2e-07   1
0046294  CheY-like                                       27.8      8e-07   1
0047867  CheY-like                                       27.7      1e-06   1
0045852  CheY-like                                       27.9    1.1e-06   1
0050964  CheY-like                                       27.4    1.1e-06   1
0048656  CheY-like                                       26.6    1.2e-06   1
0049456  CheY-like                                       27.9    1.4e-06   1
0045682  CheY-like                                       28.1    1.5e-06   1
0048685  CheY-like                                       26.4    1.6e-06   1
0048129  CheY-like                                       27.8    2.2e-06   1
0051318  CheY-like                                       24.9    5.1e-06   1
0048997  CheY-like                                       23.5    6.8e-06   1
0049761  CheY-like                                       24.6    7.5e-06   1
0051898  CheY-like                                       23.3    1.3e-05   1
0047555  CheY-like                                       21.8    1.6e-05   1
0048705  CheY-like                                       22.1    2.8e-05   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
0039925    1/1       2   138 ..     1   149 []    33.7  4.8e-09
0048705    1/1       2   129 ..     1   129 []    22.1  2.8e-05
0047555    1/1       4   130 ..     1   128 []    21.8  1.6e-05
0048066    1/1       4   138 ..     1   135 []    31.1  4.8e-08
0045700    1/1       5   143 ..     1   140 []    30.2  3.4e-07
0046294    1/1       5   129 ..     1   123 []    27.8    8e-07
0047867    1/1       5   129 ..     1   123 []    27.7    1e-06
0045682    1/1       6   143 ..     1   138 []    28.1  1.5e-06
0047753    1/1       6   136 ..     1   140 []    31.3    4e-08
0048231    1/1       6   128 ..     1   121 []    28.8  3.3e-07
0048685    1/1       6   130 ..     1   120 []    26.4  1.6e-06
0050964    1/1       6   129 ..     1   121 []    27.4  1.1e-06
0051318    1/1       6   135 ..     1   128 []    24.9  5.1e-06
0051898    1/1       6   127 ..     1   118 []    23.3  1.3e-05
0045852    1/1       7   127 ..     1   122 []    27.9  1.1e-06
0046428    1/1       7   127 ..     1   123 []    30.4  2.5e-07
0047799    1/1       7   130 ..     1   122 []    28.7  2.9e-07
0048129    1/1       7   129 ..     1   123 []    27.8  2.2e-06
0048656    1/1       7   125 ..     1   124 []    26.6  1.2e-06
0049456    1/1       7   127 ..     1   119 []    27.9  1.4e-06
0049761    1/1       7   125 ..     1   118 []    24.6  7.5e-06
0050341    1/1       7   148 ..     1   139 []    28.1  3.3e-07
0051386    1/1       7   129 ..     1   121 []    29.5  4.1e-07
0051573    1/1       7   129 ..     1   120 []    29.6  4.3e-08
0043525    1/1       8   166 ..     1   190 []    28.1  1.4e-07
0047296    1/1       8   139 ..     1   144 []    30.0  3.2e-07
0048463    1/1       8   129 ..     1   119 []    31.1  4.2e-07
0048465    1/1       8   149 ..     1   137 []    29.7  3.2e-07
0048975    1/1       8   149 ..     1   140 []    31.4  1.2e-07
0048997    1/1       8   135 ..     1   189 []    23.5  6.8e-06
0050342    1/1       8   149 ..     1   153 []    32.9  1.6e-08
0051574    1/1       8   129 ..     1   119 []    31.3  7.1e-08
0051860    1/1       8   137 ..     1   133 []    30.1    2e-07
0046299    1/1       9   132 ..     1   134 []    28.3  2.2e-07
0048459    1/1     130   253 ..     1   125 []    46.5  3.4e-13
0037219    1/1     131   257 ..     1   130 []    63.5  1.2e-16
0048248    1/1     144   253 ..     1   110 []    46.5  3.5e-12
0050109    1/1     145   255 ..     1   113 []    57.2  1.1e-15
0040536    1/1     149   257 ..     1   114 []    50.8    2e-14
0048644    1/1     150   253 ..     1   105 []    41.8  5.6e-11
0041279    1/1     151   257 ..     1   109 []    40.4  8.8e-11
0048715    1/1     151   257 ..     1   114 []    46.8  6.1e-12
0046045    1/1     153   257 ..     1   110 []    43.6  5.4e-11
0046903    1/1     154   255 ..     1   104 []    33.6  2.4e-09
0048579    1/1     155   255 ..     1   109 []    35.9  3.9e-09
0046377    1/1     157   269 ..     1   116 []    51.2  5.1e-14
0050343    1/1     275   433 ..     1   162 []   113.9  1.3e-36
0051946    1/1     448   684 ..     1   261 []   200.4  2.5e-56

Alignments of top-scoring domains:
0039925: domain 1 of 1, from 2 to 138: score 33.7, E = 4.8e-09
                   *->plslsglrvLvVdDdplirellrrlLeklgylevvltaadgeealel
                       +s + +r+L+Vd +   +e+++ lL+k+g+  +   ++  ee+ e+
  ABA56902.1     2    LSSKNIVRLLIVDASFEDAEMVTNLLRKMGFAARASRVEKEEEFREA 48   

                   lrelgalaglelglrpdlvllDinmPgmdGlellrrlralpllpdipviv
                   ++ +           +d++++  ++P  +   +++ l +    +di  i+
  ABA56902.1    49 IEGQ----------SWDIIVCAAMLPQFSVARAAQILLQ--SEKDISLII 86   

                   lTa.ladeedrvraleaGaddyllKPfdleeLlaairallrrrrllrell
                   +  +++d +d+ +++ aG+ d++lK  ++ +L  +i++ l+  + +r ++
  ABA56902.1    87 VVDeKTDSDDIDEMYVAGVRDVVLKS-RPLRLQSVIKRELQDLENRRARR 135  

                   elellllsglriLvVdDdplirellallLeslgye.vvltaadgeealel
                      l + + +r+L+Vd +   +e+++ lL+++g+ +    ++  ee  e+
  ABA56902.1     2    LSSKNIVRLLIVDASFEDAEMVTNLLRKMGFAaRASRVEKEEEFREA 48   

                   lrelppdlvllDlmmPgmdGlellrrlrelpllpdipvillTa.ladeed
                   ++ + +d++++  m+P+ +   ++++l + +  +di  i++  + +d +d
  ABA56902.1    49 IEGQSWDIIVCAAMLPQFSVARAAQILLQSE--KDISLIIVVDeKTDSDD 96   

                   avraleagaddyllKPfdleeLlaalrallrrlrllsglriLvVdDdpllrellrllLeklgye.vvleaadgeealellr
                        + +r+L+Vd +   +e+++ lL+k+g+ +    ++  ee  e+++
  ABA56902.1     4    SKNIVRLLIVDASFEDAEMVTNLLRKMGFAaRASRVEKEEEFREAIE 50   

                   elrpdlvllDlmmPgmdGlellrrlrelpllpdipvillTa.ladeedav
                    + +d++++  m+P  +   ++++l + +  +di  i++  +++d +d+ 
  ABA56902.1    51 GQSWDIIVCAAMLPQFSVARAAQILLQSE--KDISLIIVVDeKTDSDDID 98   

                   raleagaddyllKPfdleeLlaalrallrrlrllrsklrilivdddpalrellrrlLeaegyq..vlvaesgeealelle
                        + +r+livd +   +e+++ lL++ g+ +    +e  ee+ e++e
  ABA56902.1     4    SKNIVRLLIVDASFEDAEMVTNLLRKMGFAarASRVEKEEEFREAIE 50   

                   ehrpdlvlldlmlPgmdglellrqLreeglllPvill....tarddrvaa
                    ++ d+++   mlP+ +   +++ L++   ++  i++++++t+ dd+  +
  ABA56902.1    51 GQSWDIIVCAAMLPQFSVARAAQILLQSEKDISLIIVvdekTDSDDIDEM 100  

                   ldagaddyltkPfllpvdqleeLlaridaalrrflllapscalplsklriliVdDdplirellrrlLeslgdlyvvltaadgeealellre
                       + +r+liVd +   +e+++ lL+++g   +   ++  ee+ e+++ 
  ABA56902.1     5    KNIVRLLIVDASFEDAEMVTNLLRKMGFAARASRVEKEEEFREAIEG 51   

                   lrpdlvllDlmmPgmdGlellrrlre..lpdipvivlTalddelledavr
                   + +d++++  m+P+ +   +++ l + +     +iv+  ++d   +d+ +
  ABA56902.1    52 QSWDIIVCAAMLPQFSVARAAQILLQseKDISLIIVVDEKTDS--DDIDE 99   

                   aleagaddyllKPfdleeLlaairallrrlrllsellalllllellsklriliVdDdplvrellallLeslgy..vvltaadgeealellre
                       + +r+liVd +   +e+++ lL+++g++++   ++  ee+ e+++ 
  ABA56902.1     5    KNIVRLLIVDASFEDAEMVTNLLRKMGFaaRASRVEKEEEFREAIEG 51   

                   lrpdlvllDlrmPgmdGlellrrlrell.pdipvillTayddeedaveal
                   + +d++++  ++P ++   ++++l +  +    +i++  ++d +d+ e++
  ABA56902.1    52 QSWDIIVCAAMLPQFSVARAAQILLQSEkDISLIIVVDEKTDSDDIDEMY 101  

                   eagaddyllKPfdleeLlaairallrrlrlsglrilvvdDdpllrellallLeslgy..vvltaadgeealellre
                       + +r+l+vd +   +e+++ lL+++g++++   ++  ee+ e+++ 
  ABA56902.1     5    KNIVRLLIVDASFEDAEMVTNLLRKMGFaaRASRVEKEEEFREAIEG 51   

                   lrpdlvllDlrmPgmdGlellrrlrell.pdlpvillTaladeedavral
                   + +d++++  ++P+++   ++++l + ++    +i++  ++d +d+ +++
  ABA56902.1    52 QSWDIIVCAAMLPQFSVARAAQILLQSEkDISLIIVVDEKTDSDDIDEMY 101  

                   eagaddyllKPfdleeLlaairallrrlrkklriliVdDdplirellrrlLeslgdlyvvleaadgeealellrel
                      + +r+liVd +   +e+++ lL+++g   +   ++  ee+ e+++ +
  ABA56902.1     6    NIVRLLIVDASFEDAEMVTNLLRKMGFAARASRVEKEEEFREAIEGQ 52   

                   rpdlvllDlmmPgmdGlellrrlrell.pdipvivlTayddeedavrale
                    +d++++  m+P  +   ++++l + ++    +iv+  ++d +d+ +++ 
  ABA56902.1    53 SWDIIVCAAMLPQFSVARAAQILLQSEkDISLIIVVDEKTDSDDIDEMYV 102  

                   agaddyllKpfdleeLlaairallrrlrllsellaelllellkglriLiVdDdplirellrrlLeklgllyvvltaadgeealellrel
                      + +r+LiVd +   +e+++ lL+k+g+  +   ++  ee  e+++ +
  ABA56902.1     6    NIVRLLIVDASFEDAEMVTNLLRKMGFAARASRVEKEEEFREAIEGQ 52   

                   lalgslerpdlvllDlnmPgmdGlellrrlrelpllpdip.vivlTaldd
                           +d++++  ++P  +   +++ l + +  +di  +iv+  ++d
  ABA56902.1    53 -------SWDIIVCAAMLPQFSVARAAQILLQSE--KDISlIIVVDEKTD 93   

                   eedavraleagaddyllKPfdleeLlaairallrrlrllsellasglrilvvdDdpllrellallLeklgy..vvltaadgeealellrel
                      + +r+l+vd +   +e+++ lL+k+g++++   ++  ee+ e+++ +
  ABA56902.1     6    NIVRLLIVDASFEDAEMVTNLLRKMGFaaRASRVEKEEEFREAIEGQ 52   

                   rpdlvllDimmPgmdGlellrrlrelg.pdipvillTalddeedavrale
                    +d++++  m+P+++   ++++l + ++    +i++  ++d +d+ +++ 
  ABA56902.1    53 SWDIIVCAAMLPQFSVARAAQILLQSEkDISLIIVVDEKTDSDDIDEMYV 102  

                   agaddyllKPfdleeLlaalrallrrrsglrilivdDdpllrellallLeslgy..vvltaadgeealelle..
                      + +r+livd +   +e+++ lL+++g++++   ++  ee+ e++e +
  ABA56902.1     6    NIVRLLIVDASFEDAEMVTNLLRKMGFaaRASRVEKEEEFREAIEgq 52   

                   .pdlvllDilmPgmdGlellrrlrell.pdipvillTalddeedaveale
                    +d++++  ++P+++   ++++l + ++    +i++   +d +d+ e++ 
  ABA56902.1    53 sWDIIVCAAMLPQFSVARAAQILLQSEkDISLIIVVDEKTDSDDIDEMYV 102  

                   agaddyllKPfdleeLlaairallrrlrlsglrilvVdDdpllrellrllLeslgy..evltaadgeealelleel
                      + +r+l+Vd +   +e+++ lL+++g++++   ++  ee+ e++e +
  ABA56902.1     6    NIVRLLIVDASFEDAEMVTNLLRKMGFaaRASRVEKEEEFREAIEGQ 52   

                   rpdlvllDimmPgmdGlellrrlre..lpdipvillTaladeedavrale
                    +d++++  m+P  +   ++++l + +     +i++   +d +d+ +++ 
  ABA56902.1    53 SWDIIVCAAMLPQFSVARAAQILLQseKDISLIIVVDEKTDSDDIDEMYV 102  

                   agaddyllKPfdleeLlaalrallrrrrsglrilvVdDdplirellrllLeslgye..vltaadgeealellrel
                      + +r+l+Vd +   +e+++ lL+++g+ +    ++  ee+ e+++ +
  ABA56902.1     6    NIVRLLIVDASFEDAEMVTNLLRKMGFAarASRVEKEEEFREAIEGQ 52   

                   rpdlvllDirmPgmdGlellrrlrell.pdipvillTayddeedavrale
                    +d++++  ++P+ +   ++++l +  +    +i++  ++d +d+ +++ 
  ABA56902.1    53 SWDIIVCAAMLPQFSVARAAQILLQSEkDISLIIVVDEKTDSDDIDEMYV 102  

                   agaddyllKPfdleeLlaairallrrlrllsenlsglrilvvdDdpllrellallLeslgyevv..taadgeealellrel
                      + +r+l+vd +   +e+++ lL+++g+   +  ++  ee+ e++++ 
  ABA56902.1     6    NIVRLLIVDASFEDAEMVTNLLRKMGFAARasRVEKEEEFREAIEG- 51   

                   erpdllvllD.llPgmdGlellrrlrellpdlpvillTaldde...avra
                   + +d ++++ ++lP+ +   ++++l +  +d+  i++    ++ +++ ++
  ABA56902.1    52 QSWD-IIVCAaMLPQFSVARAAQILLQSEKDISLIIVVDEKTDsddIDEM 100  

                   leag.ddyllKPfdleeLlaalrrrlllglriLvVdDdpllrellallLeslgy..vvltaadgeealellrelr
                       +r+L+Vd +   +e+++ lL+++g++++   ++  ee+ e+++ + 
  ABA56902.1     7    IVRLLIVDASFEDAEMVTNLLRKMGFaaRASRVEKEEEFREAIEGQS 53   

                   pdlvllDlmmPgmdGlellrrlrellllpdip.villTaladeedavral
                   +d++++  m+P  +   ++++l + +  +di  +i++  ++d +d+ +++
  ABA56902.1    54 WDIIVCAAMLPQFSVARAAQILLQSE--KDISlIIVVDEKTDSDDIDEMY 101  

                   eagaddyllKPfdleeLlaairallrrrklrilivdDdpllrellrllLeslgllyvvltaadgeealelleelr
                       +r+livd +   +e+++ lL+++g+  +   ++  ee+ e++e + 
  ABA56902.1     7    IVRLLIVDASFEDAEMVTNLLRKMGFAARASRVEKEEEFREAIEGQS 53   

                   pdlvllDimmPgmdGlellrrlrelplpdipvivlTaladeedavralea
                   +d++++  m+P  +   ++++l + +     +iv+   +d +d+ +++ a
  ABA56902.1    54 WDIIVCAAMLPQFSVARAAQILLQSEKDISLIIVVDEKTDSDDIDEMYVA 103  

                   gaddyllKPfdleeLlaalrallrrrglrilvvdDdpllrellallLeklgy..vvltaadgeealellrelp
                       +r+l+vd +   +e+++ lL+k+g++++   ++  ee+ e+++ + 
  ABA56902.1     7    IVRLLIVDASFEDAEMVTNLLRKMGFaaRASRVEKEEEFREAIEGQS 53   

                   pdlvllDimmPgmdGlellrrlrelg.pdipvillTaladeedavralea
                   +d++++  m+P ++   ++++l + ++    +i++  ++d +d+ +++ a
  ABA56902.1    54 WDIIVCAAMLPQFSVARAAQILLQSEkDISLIIVVDEKTDSDDIDEMYVA 103  

                   gaddyllKPfdleeLlaalrallrrlrlglriLvvdDdpllrellallLeklgy..vvltaadgeealellrelr
                       +r+L+vd +   +e+++ lL+k+g++++   ++  ee  e+++ + 
  ABA56902.1     7    IVRLLIVDASFEDAEMVTNLLRKMGFaaRASRVEKEEEFREAIEGQS 53   

                   pdlvllDimmPgmdGlellrrlrelpalpdipvillTa.ladeedavral
                   +d++++  m+P  +   ++++l + +  +di  i++  + +d +d+ +++
  ABA56902.1    54 WDIIVCAAMLPQFSVARAAQILLQSE--KDISLIIVVDeKTDSDDIDEMY 101  

                   eagaddyllKPfdleeLlaalrallrrlrglrilvvdDdpllrellkllLeklgyev.vlvaadgeealellrell
                       +r+l+vd +   +e+++ lL+k+g+      ++  ee  e+++   
  ABA56902.1     7    IVRLLIVDASFEDAEMVTNLLRKMGFAArASRVEKEEEFREAIEG-- 51   

                   esglrpdlvllDilmPgmdGlellrrlrelllpdipvillTaladeedav
                      + +d++++  ++P  +   ++++l + +     +i++   +d +d+ 
  ABA56902.1    52 ---QSWDIIVCAAMLPQFSVARAAQILLQSEKDISLIIVVDEKTDSDDID 98   

                   raleagaddyllKPfdleeLlaalralLklrilivdDdpllrellallLeslgy..vvltaadgeealellrelr
                       +r+livd +   +e+++ lL+++g++++   ++  ee  e+++ + 
  ABA56902.1     7    IVRLLIVDASFEDAEMVTNLLRKMGFaaRASRVEKEEEFREAIEGQS 53   

                   pdlvllDllmPgmdGlellrrlrell.pdipvillTayadledavralea
                   +d++++  ++P+ +   ++++l + ++    +i++   +d +d+ +++ a
  ABA56902.1    54 WDIIVCAAMLPQFSVARAAQILLQSEkDISLIIVVDEKTDSDDIDEMYVA 103  

                   gaddyllKPfdleeLlaalrallrrglrilivdDdpllrellallLeklgyevvg.eaadgeealellrelr
                       +r+livd +   +e+++ lL+k+g+   +  ++  ee+ e+++ + 
  ABA56902.1     7    IVRLLIVDASFEDAEMVTNLLRKMGFAARAsRVEKEEEFREAIEGQS 53   

                   pdlvllDllmPgmdGlellrrlrell.pdlpvivlTaladeedavealea
                   +d++++  ++P+++   ++++l + ++    +iv+   +d +d+ e++ a
  ABA56902.1    54 WDIIVCAAMLPQFSVARAAQILLQSEkDISLIIVVDEKTDSDDIDEMYVA 103  

                   gaddyllKPfdleeLlaalralLglriLvVdDdpllrellrllLeklgy..evltaadgeealellrelr
                       +r+L+Vd +   +e+++ lL+k+g++++   ++  ee  e+++ + 
  ABA56902.1     7    IVRLLIVDASFEDAEMVTNLLRKMGFaaRASRVEKEEEFREAIEGQS 53   

                   pdlvllDimmPgmdGlellrrlrelpllpdipvillTa.lddeedavral
                   +d++++  m+P  +   ++++l + +  +di  i++  +++d +d+ +++
  ABA56902.1    54 WDIIVCAAMLPQFSVARAAQILLQSE--KDISLIIVVDeKTDSDDIDEMY 101  

                   eagaddyltK..PfdleeLlarirallrrlrllsellllleeleldlglrilvvdDdpllrellallLeslgy..vvltaadgeealellrelr
                       +r+l+vd +   +e+++ lL+++g++++   ++  ee+ e+++ + 
  ABA56902.1     7    IVRLLIVDASFEDAEMVTNLLRKMGFaaRASRVEKEEEFREAIEGQS 53   

                   pdlvllDlmmPgmdGlellrrlrelg.pdipvivlTaladeedavralea
                   +d++++  m+P ++   ++++l + ++    +iv+  ++d +d+ +++ a
  ABA56902.1    54 WDIIVCAAMLPQFSVARAAQILLQSEkDISLIIVVDEKTDSDDIDEMYVA 103  

                   gaddyllKPfdleeLlaalrallrrlrglriliVdDdpllrellallLeklgy..vvltaadgeealellrelr
                       +r+liVd +   +e+++ lL+k+g++++   ++  ee+ e+++ + 
  ABA56902.1     7    IVRLLIVDASFEDAEMVTNLLRKMGFaaRASRVEKEEEFREAIEGQS 53   

                   pdlvllDimmPgmdGlellrrlre..lpdipvillTaladeedavralea
                   +d++++  m+P+ +   ++++l + +     +i++  ++d +d+ +++ a
  ABA56902.1    54 WDIIVCAAMLPQFSVARAAQILLQseKDISLIIVVDEKTDSDDIDEMYVA 103  

                   gaddyllKPfdleeLlaalrallrrlrmsglrvLvVDDdplirellrrlLerlgy..evvgtaadgeeAlelle
                          r+L+VD + + +e+++ lL+++g++++    ++  ee  e++e
  ABA56902.1     8    ---VRLLIVDASFEDAEMVTNLLRKMGFaaRAS-RVEKEEEFREAIE 50   

                   elppdlvllDirmPgmdGlellrrlre.lpdipvillTa.yadeedavra
                    + +d++++  ++P  +   +++ l +  +di  i++  + +d +d+ ++
  ABA56902.1    51 GQSWDIIVCAAMLPQFSVARAAQILLQsEKDISLIIVVDeKTDSDDIDEM 100  

                   leaGaddyltKPfdleeLlaalrralerrrllrelrlllellelllelrl
                   + aG+ d+++K  ++ +L+ +++r l+  + +r +r+    l +   +++
  ABA56902.1   101 YVAGVRDVVLKS-RPLRLQSVIKRELQDLENRRARRHSEMVLGESERQVR 149  

                   llldallllliglslallellallrklilgesgtgkelvaralhrlslsglriLiVdDdplirellrrlLeklgllyevleaadgeealellre
                         +r+LiVd +   +e+++ lL+k+g+  +   ++  ee  e+++ 
  ABA56902.1     8    ---VRLLIVDASFEDAEMVTNLLRKMGFAARASRVEKEEEFREAIEG 51   

                   llelgdllrpdlvllDlnmPgmdGlellrrlrelpalpdip.vivlTald
                   +        +d++++  ++P  +   ++++l + +  +di  +iv+  ++
  ABA56902.1    52 Q-------SWDIIVCAAMLPQFSVARAAQILLQSE--KDISlIIVVDEKT 92   

                   deedavraleagaddyltKPfdleeLlaairallrrlrllselvalrllrilivdDdpllrellallLeklgy..vvltaadgeealellrelrp
                      +r+livd +   +e+++ lL+k+g++++   ++  ee+ e+++ + +
  ABA56902.1     8    VRLLIVDASFEDAEMVTNLLRKMGFaaRASRVEKEEEFREAIEGQSW 54   

                   dlvllDimmPgmdGlellrrlre..lpdipvillTalddeedavraleag
                   d++++  m+P+ +   ++++l + +     +i++  ++d +d+ +++ ag
  ABA56902.1    55 DIIVCAAMLPQFSVARAAQILLQseKDISLIIVVDEKTDSDDIDEMYVAG 104  

                   addyllKPfdleeLlaalrallrrlrlriLiVdDdplirellrllLeklgye..vltaadgeealelleelrp
                       r+LiVd +   +e+++ lL+k+g+ +    ++  ee+ e++e + +
  ABA56902.1     8    VRLLIVDASFEDAEMVTNLLRKMGFAarASRVEKEEEFREAIEGQSW 54   

                   dlvllDlmmPgmdGlellrrlrelg.pdipvillTayadeedavealeag
                   d++++  m+P+ +   ++++l + ++    +i++  ++d +d+ e++ ag
  ABA56902.1    55 DIIVCAAMLPQFSVARAAQILLQSEkDISLIIVVDEKTDSDDIDEMYVAG 104  

                   addyllK..PfdleeLlaairallrrlrllrelllllellelllglriliVdDdplirellrllLerlgye..vltaadgeealellrelrp
                       r+liVd +   +e+++ lL+++g+ +    ++  ee+ e+++ + +
  ABA56902.1     8    VRLLIVDASFEDAEMVTNLLRKMGFAarASRVEKEEEFREAIEGQSW 54   

                   dlvllDirmPgmdGlellrrlrelg.pdlpvillTayddeedavraleag
                   d++++  ++P ++   +++ l +  +    +i++  ++d +d+ +++ ag
  ABA56902.1    55 DIIVCAAMLPQFSVARAAQILLQSEkDISLIIVVDEKTDSDDIDEMYVAG 104  

                   addyllKPfdleeLlaairallrrlrllrellllllllellldllaltllllknlrglrilvvdddplvrellrrlLerlgyevva..aadge
                                  r+l+vd + + +e++++lL+++g+  +a  ++  e
  ABA56902.1     8    -----------VRLLIVDASFEDAEMVTNLLRKMGFAARAsrVEKEE 43   

                   eale....lrpdlvlldlrmpdmdglellallre..lpdlpvivltayed
                   e+ e+++ ++ d++++  ++p+ +   ++++l + ++    +iv+ +  d
  ABA56902.1    44 EFREaiegQSWDIIVCAAMLPQFSVARAAQILLQseKDISLIIVVDEKTD 93   

                   pelleaaleagaldylvkPldpeeLlaalelalarfrrlrrlreelakle
                    +++ + + ag+ d+++k               + +r+++ +++el++le
  ABA56902.1    94 SDDIDEMYVAGVRDVVLKS--------------RPLRLQSVIKRELQDLE 129  

                   ekleerklierakgllmkrrglseeeAyrllrklAmdsgtsleevAeaii
                   ++ + r                                            
  ABA56902.1   130 NRRARR-------------------------------------------- 135  

                   llllllsllllsglriLvVdDdplirellarlLeklgyev....aad
                                   +r+L+Vd +   +e+++ lL+k+g+   +  ++ 
  ABA56902.1     8    -------------VRLLIVDASFEDAEMVTNLLRKMGFAArasrVEK 41   

                   geealellrelppdlvllDlmmPgmdGlellrrlrelpalpdipvillTa
                    ee+ e+++ + +d++++  m+P  +   +++ l + +  +di  i++  
  ABA56902.1    42 EEEFREAIEGQSWDIIVCAAMLPQFSVARAAQILLQSE--KDISLIIVVD 89   

                   .lddeedrvraleaGaddyltKPfdpeeLlarirallrrrrllrelllll
                   +++d +d+ +++ aG+ d+++K  +p +L  +i++ l+  + +r++++ +
  ABA56902.1    90 eKTDSDDIDEMYVAGVRDVVLK-SRPLRLQSVIKRELQDLENRRARRHSE 138  

                   ellellllldklriLvvdDdpllrellrllLeslgy..vvleaadgeealellrelrp
                      +r+L+vd +   +e+++ lL+++g++++   ++  ee+ e+++ + +
  ABA56902.1     8    VRLLIVDASFEDAEMVTNLLRKMGFaaRASRVEKEEEFREAIEGQSW 54   

                   dlvllDlmmPgmdGlellrrlre..lpdipvivlTalddeedavraleag
                   d++++  m+P  +   ++++l + +     +iv+  ++d +d+ +++ ag
  ABA56902.1    55 DIIVCAAMLPQFSVARAAQILLQseKDISLIIVVDEKTDSDDIDEMYVAG 104  

                   addyllKPfdleeLlaalrallrrlrealsslsglrilvVdDdplvrellrrlLerlgyevv..taadgeeal
                              +r+l+Vd +   +e+++ lL+++g+  ++  ++  ee+ 
  ABA56902.1     8    --------VRLLIVDASFEDAEMVTNLLRKMGFAARasRVEKEEEFR 46   

                   ellrelppdlvllDlrmpgmdGlellrrlrellpdip.villTayadeed
                   e+++ + +d++++  ++p  +   +++ l + ++di  +i++   +d +d
  ABA56902.1    47 EAIEGQSWDIIVCAAMLPQFSVARAAQILLQSEKDISlIIVVDEKTDSDD 96   

                   avraleagaddyllK..PfdleeLlaalrallrrlrllleslllelsglrvLvVdDnplnrellkalLeklgy..evltasngeeale
                              r+L+Vd +   +e+++ lL+k+g++++   ++  ee  e
  ABA56902.1     9    --------RLLIVDASFEDAEMVTNLLRKMGFaaRASRVEKEEEFRE 47   

                   ll.elppdlvllDiqmPgmdGlellrrirelellpllpdipiialtayad
                   +++++ +d++++  ++P  +   +++ + +     +     ii++   +d
  ABA56902.1    48 AIeGQSWDIIVCAAMLPQFSVARAAQILLQ----SEKDISLIIVVDEKTD 93   

                   eedreraleagaddyltKPvsleeLlaalrrllrrleeegDiterkraeeelreseerlralldslpdgiivlDadgrilyvNpaae
                      +  +r++ e  l ese++ rall+s+ d++  + ++g  +y+N+a++
  ABA56902.1   130    NRRARRHSEMVLGESERQVRALLESSRDAVGYV-HEGMHIYANRAYL 175  

                   ellGy.speeliGknlfellhpedlreavleallealatg.epvrgelrl
                   el+Gy++ +e+ G++l+++++pe+ + ++ + l e+ a++ ++ ++ lr 
  ABA56902.1   176 ELFGYhELDEIEGMPLLDMIAPEE-HNRFKAFLKEYGASEgKSAHFTLRA 224  

                   rrkdGsrrwv..svspirdedGevvgvvgvfrIterkraeealreseerlrallesapdgiivldldgrilyvNpaaer
                         r++ e  l ese++ ralles+ d++  + ++g  +y+N+a+++
  ABA56902.1   131    RRARRHSEMVLGESERQVRALLESSRDAVGYV-HEGMHIYANRAYLE 176  

                   llGy.speellGkslldllppedrervlealrralaggeplllgvslelr
                   l+Gy++ +e+ G++lld++ pe++ r+ + l+++ a+++      ++ lr
  ABA56902.1   177 LFGYhELDEIEGMPLLDMIAPEEHNRFKAFLKEYGASEGKS---AHFTLR 223  

                   lrrkdGelrwvevsaspirdeggrgvvgvvrDITseerlralldaapdgiivlDadGrilyvNraaerllGy.speeviGr
                      se++ rall+++ d++  + ++G+ +y+Nra+++l+Gy++ +e+ G+
  ABA56902.1   144    SERQVRALLESSRDAVGYV-HEGMHIYANRAYLELFGYhELDEIEGM 189  

                   nlfsellppedrpafeaallralatgep...lelrlrrkdGsrrwvlvtv
                   +l  + ++pe   +f a+l ++ a+++  +++ lr++ +dG+++++ +  
  ABA56902.1   190 PL-LDMIAPEEHNRFKAFLKEYGASEGKsahFTLRAHKADGHTFTAAWEF 238  

                   splrdedGevvgvvgvia.rlralleaapdgiivldldgrilyvNpaaerllGy.speellGkp
                      + + ralle++ d++  + ++g  +y+N+a+++l+Gy++ +e+ G+p
  ABA56902.1   145    ErQVRALLESSRDAVGYV-HEGMHIYANRAYLELFGYhELDEIEGMP 190  

                   lldllhpedrervlealeralaggepvllgvegelrlrrkdGevrwvevs
                   lld++ pe+++r+ + l+++ a+++      ++ lr + +dG+++   + 
  ABA56902.1   191 LLDMIAPEEHNRFKAFLKEYGASEGKS---AHFTLRAHKADGHTFTAAWE 237  

                   aspirdedgvgvvgvirDrllleaapdgilvldldtgrilyvNdaaerllGys.peellGkslld
                      r+lle++ d++  + ++ g  +y+N+a+++l+Gy + +e+ G++lld
  ABA56902.1   149    RALLESSRDAVGYV-HE-GMHIYANRAYLELFGYHeLDEIEGMPLLD 193  

                   llhpedreavlealeralaggevvtlllllelrlrrkdGsvrwvevsasp
                   ++ pe++ ++ + l++  a+++      ++ lr   +dG+++++ + ++p
  ABA56902.1   194 MIAPEEHNRFKAFLKEYGASEGKSA---HFTLRAHKADGHTFTAAWEFTP 240  

                   irdeggrv.vgvvrDITeRallenapdgiivlDadgrilyvNpaaeellGy.speeviGknlfdll
                      alle++ d++  +  +g  +y+N+a++el+Gy++ +e+ G++l+d +
  ABA56902.1   150    ALLESSRDAVGYV-HEGMHIYANRAYLELFGYhELDEIEGMPLLD-M 194  

                   ippedreevlealrealagge...svelrlrrkdGslrwvevsaspirde
                   i pe++ ++ + l+e+ a++ + +++ lr +++dG+++++ +  +p    
  ABA56902.1   195 IAPEEHNRFKAFLKEYGASEGksaHFTLRAHKADGHTFTAAWEFTPAS-I 243  

                   dGevvgvvgvlrlleaapdgiwitdldgrilyvNpaferllGy.speellgknlrelvh
                      lle++ d++  +  +g  +y+N+a+++l+Gy++++e+ g++l++++ 
  ABA56902.1   151    LLESSRDAVGYV-HEGMHIYANRAYLELFGYhELDEIEGMPLLDMIA 196  

                   pedrervlealrralagg.epfsgelrlrrkdGslrwvllsispirdedG
                   pe+++r+ + l++  a++ ++ ++ lr  ++dG+++ + +  +p    +G
  ABA56902.1   197 PEEHNRFKAFLKEYGASEgKSAHFTLRAHKADGHTFTAAWEFTPAS-IEG 245  

                   evvgvvgiarDITllleaapdgifvldldgrilyvnpaflellGy.speellgkslldlih
                      lle++ d++  +  +g  +y+n+a+lel+Gy++++e+ g++lld+i 
  ABA56902.1   151    LLESSRDAVGYV-HEGMHIYANRAYLELFGYhELDEIEGMPLLDMIA 196  

                   pedrervlealeealagg.epfsgeyrlrrkdGsyrwvevsaspirdeld
                   pe+++r+++ l+e+ a++ ++ ++ +r +++dG+++   + ++p    ++
  ABA56902.1   197 PEEHNRFKAFLKEYGASEgKSAHFTLRAHKADGHTFTAAWEFTPAS--IE 244  

                   gkvvgvvgvarDiTerKqaeaapdgivitdldgrilyvNpaferllGy.sreellgkslllldllh
                      e++ d++  +  +g  +y+N+a+++l+Gy++ +e+ g++l  ld++ 
  ABA56902.1   153    ESSRDAVGYV-HEGMHIYANRAYLELFGYhELDEIEGMPL--LDMIA 196  

                   pedrervlaalrralagg.epfsgelrlrrkdGslfwvllsvspirdedG
                   pe++ r+ a l +  a++ ++ ++ lr +++dG++f + +  +p    +G
  ABA56902.1   197 PEEHNRFKAFLKEYGASEgKSAHFTLRAHKADGHTFTAAWEFTPAS-IEG 245  

                   evvgvvgvvrDiTeRnapdgiiitdldgrilyvNdaflellGy.sreellgknlrdlvhped
                       + d++  + ++g  +y+N+a+lel+Gy++++e+ g++l+d++ pe+
  ABA56902.1   154    SSRDAVGYV-HEGMHIYANRAYLELFGYhELDEIEGMPLLDMIAPEE 199  

                   reavlaalwealrgg.epwsgelrlrrkdGelrwvelsispirdedGevv
                   ++++ a l+e  +++ ++ ++ lr +++dG+++   +  +p    +Ge  
  ABA56902.1   200 HNRFKAFLKEYGASEgKSAHFTLRAHKADGHTFTAAWEFTPAS-IEGE-F 247  

                   gfvgvarDIlddfifvldadGriiyvneaalrallGy.speeliGksiydfvhped
                      + d++ ++  +G  iy+n+a+l+ l+Gy++ +e+ G++++d++ pe+
  ABA56902.1   155    SRDAVGYV-HEGMHIYANRAYLE-LFGYhELDEIEGMPLLDMIAPEE 199  

                   reesalrealeevla.kgevrsfeyrflrkdGsyvwletsatpildpdtg
                   ++  +++ +l+e  a +g+  +f +r   +dG+++++ ++ tp       
  ABA56902.1   200 HN--RFKAFLKEYGAsEGKSAHFTLRAHKADGHTFTAAWEFTP------A 241  

                   klegvvgiarditeDgiivldldgrilyvNpaaerllGy.saeellgknlldlippedrer
                      D++  + ++g  +y+N+a+ +l+Gy++ +e+ g++lld+i pe++ r
  ABA56902.1   157    DAVGYV-HEGMHIYANRAYLELFGYhELDEIEGMPLLDMIAPEEHNR 202  

                   llaalrralaggeplllgvelelrlrrkdGslfwvelsisplrdeggegv
                   + a+l ++ a+++      ++ lr+  +dG++f + +  +p   eg+ + 
  ABA56902.1   203 FKAFLKEYGASEGKS---AHFTLRAHKADGHTFTAAWEFTPASIEGEFCT 249  

                   vgvlrDiTerkraeeeLrelLTglpnrraflerlerllararrsglplalllldldnfklindtyGh
                      LTg ++r ++le++e+++  ar  ++  +ll++ +d+f ++  + G 
  ABA56902.1   275    LTGFFSRPHYLELMEKWVIAARAGDRESSLLYIAIDQFNRVRARVGI 321  

                   aagDevLkevaerlksllregdlvaRlggdeFavllpdtdleealalaer
                    a D v + va++l+++++e  ++aR+g++ F +llp+ + e+  alae+
  ABA56902.1   322 GASDLVVVDVARILQQYCDEKVILARFGDEVFTLLLPHGSDEQEDALAEQ 371  

                   lrealeelllpflldglellvtvsiGvalypddgedleellkrAdlalyr
                   lr+a++++   +++d+++++vt+siG++ + +++   +++l+rA++a+ +
  ABA56902.1   372 LRQAVDRH--LVEMDERSINVTCSIGICRIGESAPGGQQILERAHKACLK 419  

                   aKragrnrvvlydeeeddLrralen.gelvlyyQPivdlrtgrvvgyEallRwrhpegglis
                      e +Lr+a++n+++++l+yQPiv+l++++   +E+llR+ ++ gg+i 
  ABA56902.1   448    EVQLREAMNNkDGFCLFYQPIVSLHGETEEIFEVLLRMTDDAGGYIL 494  

                   pdefiplaeetgliveldrwvleqalrqlaaw...gldlrlsvNlsarql
                   p  f++ a ++ l+ e+drwv+ +a+  l+  +++g+ +r++v ls  ++
  ABA56902.1   495 PEKFLEPAAQLKLMGEIDRWVIAKAMSVLHSRhqvGQLIRFFVKLSDPSI 544  

                   ldpdfvegllllelleelglppsrlvlEitEsallddlelllellerlre
                   +d +++   +l+++l+e+gl+++ l++Ei Es +l+ l+++++l+e lr 
  ABA56902.1   545 HDKNLLP--WLKKHLQESGLDARSLIFEISESSALNYLKRVQQLVEGLRV 592  

                   lGvrialDdfgtgysslsylkrlpvdilKiDrsfvrdiltdpldlaivra
                   lG+++al+++gtg    + lk+++vd+lKiD+ f+ ++l+d+++++ v+ 
  ABA56902.1   593 LGCQFALEHVGTGLDTSNCLKHINVDYLKIDGAFIENLLQDEQNQEAVKI 642  

                   iialakslglkvvaEgVEteeqlellrelgcdlaQGylfskPlpaeella
                   ii++ak+ g  ++aE V +++ l+ll+++g d+aQG ++ +P        
  ABA56902.1   643 IIEMAKEAGKPTIAEFVSDANTLALLWQFGLDYAQGRYIQEP-------- 684  

                   lllellllellllllsek