hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /home/genome/SCOP/1.73/Scop1.73.bin
Sequence file:            /home/genome/FASTA/gib_20045.fasta
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: ABA58119.1
Accession:      [none]
Description:    noce0 ABA58119.1 GIB00281CH01 "serine O-acetyltransferase"

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
0043743  Trimeric LpxA-like enzymes                     178.0    2.5e-49   1
0043848  Trimeric LpxA-like enzymes                     173.7    2.4e-48   1
0049600  Trimeric LpxA-like enzymes                     143.2    1.7e-43   1
0047822  Trimeric LpxA-like enzymes                     147.8    3.2e-40   1
0050899  Trimeric LpxA-like enzymes                     144.7    2.8e-39   1
0047866  Trimeric LpxA-like enzymes                     136.3    6.5e-39   1
0048541  Trimeric LpxA-like enzymes                     117.5    5.6e-34   1
0039338  Trimeric LpxA-like enzymes                     118.8    6.4e-34   1
0047206  Trimeric LpxA-like enzymes                     112.5    3.4e-30   1
0044607  Trimeric LpxA-like enzymes                     100.1      2e-27   1
0050963  Trimeric LpxA-like enzymes                      93.8    2.1e-26   1
0049025  Trimeric LpxA-like enzymes                      83.7    1.5e-25   1
0052621  Trimeric LpxA-like enzymes                      85.2    3.4e-25   1
0047244  Trimeric LpxA-like enzymes                      92.3    8.1e-25   1
0053166  Trimeric LpxA-like enzymes                      79.7    1.7e-23   1
0051363  Trimeric LpxA-like enzymes                      47.8    1.3e-12   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
0043848    1/1       1   169 [.     1   262 []   173.7  2.4e-48
0043743    1/1       3   168 ..     1   241 []   178.0  2.5e-49
0047822    1/1      12   169 ..     1   207 []   147.8  3.2e-40
0047866    1/1      12   185 ..     1   200 []   136.3  6.5e-39
0049600    1/1      12   168 ..    49   256 .]   143.2  1.7e-43
0048541    1/1      14   171 ..     1   182 []   117.5  5.6e-34
0050899    1/1      18   217 ..     1   208 []   144.7  2.8e-39
0047206    1/1      27   169 ..     1   208 []   112.5  3.4e-30
0050963    1/1      33   197 ..     1   172 []    93.8  2.1e-26
0044607    1/1      35   226 ..     1   173 []   100.1    2e-27
0052621    1/1      39   177 ..   129   320 .]    85.2  3.4e-25
0047244    1/1      52   175 ..     1   201 []    92.3  8.1e-25
0051363    1/1      58   179 ..     1   135 []    47.8  1.3e-12
0039338    1/1      60   237 ..     1   259 []   118.8  6.4e-34
0053166    1/1      61   170 ..    79   262 .]    79.7  1.7e-23
0049025    1/1      65   213 ..    74   210 .]    83.7  1.5e-25

Alignments of top-scoring domains:
0043848: domain 1 of 1, from 1 to 169: score 173.7, E = 2.4e-48
                   *->avigpgavigvnvvigpgvvigdgvvigdgtvalilpnvvllgatri
                                                                     
  ABA58119.1     -    ----------------------------------------------- -    

                   glgvvilsgavigdalfglaydllgslleilvllladllavrlrdpaars
                                                ++ +l + +  v++rdpaar 
  ABA58119.1     1 -----------------------------MFKRLQEEIKCVFERDPAARN 21   

                   llevllllkgllalllyrlahllggkvrigpavvigpgvvigggvvigpg
                    +ev+ +++g++a+ ++rl h+l++     +a+ i+  +++++g++i+pg
  ABA58119.1    22 AFEVITTYPGFHAIVWHRLSHRLWNLGAKWLARAISTLSRWLTGIEIHPG 71   

                   aeigegvvidhltgvvIghdavigdnvvigagvtlggvgdgvvkrpvtIg
                   a ig +++idh++gvvIg++a+ig+++++++gvtlgg+ +  +kr++t+g
  ABA58119.1    72 AQIGQRFFIDHGMGVVIGETAEIGNDCTLYHGVTLGGTSWQKGKRHPTLG 121  

                   dgvwIGagatilggvtIGdgavigagsvVtkdvppgsvvaGnPAkvirel
                   ++v++Gaga++lg+++IG+g++ig +svV+k+vp++++v G+P++ +   
  ABA58119.1   122 NNVVVGAGAKVLGPIHIGSGVRIGSNSVVVKSVPANTTVIGVPGRMVQ-- 169  

                   deeelalllesllgglldpllalalllallllelelllgillsagildrallaealaillla
                                                                     
  ABA58119.1     -    ----------------------------------------------- -    

                   viedlavigvtvvigagvvigkdveigedvvidpnvviigdvaigdgvvi
                                              + +  ++ +v+++d+a+++ +++
  ABA58119.1     3 ---------------------------KRLQEEIKCVFERDPAARNAFEV 25   

                   llgaviggalqryrlahlllkkagvgpavrigdgveiganitIgpgarIg
                   +  +++++a++++rl+h+l++ + +++a+ i+  ++++++i+I+pga+Ig
  ABA58119.1    26 ITTYPGFHAIVWHRLSHRLWNLGAKWLARAISTLSRWLTGIEIHPGAQIG 75   

                   dgvkidhgtgvvighdavigdnvtigagvtlggtldglgkrhvtIgdgvw
                    +++idhg+gvvig++a+ig+++t+++gvtlggt++ +gkrh+t+g++v+
  ABA58119.1    76 QRFFIDHGMGVVIGETAEIGNDCTLYHGVTLGGTSWQKGKRHPTLGNNVV 125  

                   IGagatilggvtIGdgavigagsvVtkdvppgsvvvGnPArvialiggdpviignvtillsvvigngvtiiggaviiylgaliglapgigp
                      ++ +dp+++++++++  +++++++++++ +++++ +   +la+ i  
  ABA58119.1    12    VFERDPAARNAFEVITTYPGFHAIVWHRLSHRLWNLGAKWLARAIST 58   

                   yirilpgvvigdnveIGenvtidrgtviviggnvtigdnvnighgvvign
                    +r+l+g++i++++ IG +++id+g+++vig++++ig++++++hgv++g+
  ABA58119.1    59 LSRWLTGIEIHPGAQIGQRFFIDHGMGVVIGETAEIGNDCTLYHGVTLGG 108  

                   hdhplviaggvviaggvtIgdnvwIGagavilpgvtIGdgavigagsvVt
                   +++          ++++t+g+nv++Gaga++l++++IG+g+ ig++svV+
  ABA58119.1   109 TSW-------QKGKRHPTLGNNVVVGAGAKVLGPIHIGSGVRIGSNSVVV 151  

                   kdvppgslvaGnPakvirerfeeevillllslawydwllekilellelll
                   k+vp++++v+G+P + +                                 
  ABA58119.1   152 KSVPANTTVIGVPGRMVQ-------------------------------- 169  

                   sldleelelllpellellaqgelyltddigllalllralllllllnlliglatlihp
                      + e  +     ++++t ++g++a+++++l ++l+ +   +la+ i+ 
  ABA58119.1    12    VFERDPAARNAFEVITTYPGFHAIVWHRLSHRLWNLGAKWLARAIST 58   

                   tavilggveigegvvIgpgvvidhggnvvIGdnvvigpnvvildggdvvI
                     + l+g+ei++g++Ig +++idhg++vvIG+              +++I
  ABA58119.1    59 LSRWLTGIEIHPGAQIGQRFFIDHGMGVVIGE--------------TAEI 94   

                   GdnvligpgvvigtdnhglgtitrnydgvlkgpvvIgdnvwiGanatilp
                   G+++++++gv++g++++  g           +++++g+nv++Ga+a +l+
  ABA58119.1    95 GNDCTLYHGVTLGGTSWQKGK----------RHPTLGNNVVVGAGAKVLG 134  

                   gvtIgdgavigagsvVtkdvppgslvvGnParvirllleglarlllldll
                   +++Ig+g+ ig++svV+k+vp++++v+G+P r ++   ++++r  +++ +
  ABA58119.1   135 PIHIGSGVRIGSNSVVVKSVPANTTVIGVPGRMVQ--SKDQRREAKHQAM 182  

                   lkevldldpaagllklaillyfglpalafarvavllgndklilklayilp
                      v+++dpaa+  +++i +y+g++a++++r+ + l+n +  ++++ i+ 
  ABA58119.1    12    VFERDPAARNAFEVITTYPGFHAIVWHRLSHRLWNLGAKWLARAIST 58   

                   sagigtgvrigpgavigkgavigegtvimpavinagayigentiintgav
                     ++ tg+ i+pga ig +++i++g+                     g+v
  ABA58119.1    59 LSRWLTGIEIHPGAQIGQRFFIDHGM---------------------GVV 87   

                   ighdavIGdnvhigpgvtiggdlfglqagpviIgdnvlIGagatilggvv
                   ig++a+IG+++++++gvt+gg+ +  +++++++g+nv++Gaga +lg ++
  ABA58119.1    88 IGETAEIGNDCTLYHGVTLGGTSWQKGKRHPTLGNNVVVGAGAKVLGPIH 137  

                   IgegavigagsvvtkdvpigslvvGvpakvvviagsvvvagslligdgvl
                   Ig+g+ ig +svv+k+vp++++v+Gvp + v                   
  ABA58119.1   138 IGSGVRIGSNSVVVKSVPANTTVIGVPGRMV------------------- 168  

                   llgqavivghvlklleyllqgewylvgtpelalealrlllllllllllglallihpta
                      ++  +   + e++ +++ ++a+ ++rl + l+ l   +la+ i ++ 
  ABA58119.1    14    ERDPAARNAFEVITTYPGFHAIVWHRLSHRLWNLGAKWLARAISTLS 60   

                   lillgakigegvvigpgavigyggnvvigdnvvigpgvvildvggvvIgd
                   + l+g++i++g+ ig++++i++g++vvig              +++ Ig+
  ABA58119.1    61 RWLTGIEIHPGAQIGQRFFIDHGMGVVIG--------------ETAEIGN 96   

                   nvligpgvtighdshigdnvtigngveiagpvvigdnvwigagavilpgv
                   ++++++gvt+g ++   ++         ++++++g+nv++gaga +l+++
  ABA58119.1    97 DCTLYHGVTLG-GTSWQKG---------KRHPTLGNNVVVGAGAKVLGPI 136  

                   tIgdgavigagsvVtkdvppgsvvvGnParvirelcvigplvvigdgtvlhalvvirggtrigllnlillgagigvlvqilp
                      +  + ++vi +++++ha+v++r+++r+++l  ++l++ i+ l+++l+
  ABA58119.1    18    AARNAFEVITTYPGFHAIVWHRLSHRLWNLGAKWLARAISTLSRWLT 64   

                   yadigggviIGdnvsigagvtivdgggttiGdnvligpgvtighdvhigd
                   +++i++g+ IG +++i++g+ +v+g++++iG+++++++gvt+g++++  +
  ABA58119.1    65 GIEIHPGAQIGQRFFIDHGMGVVIGETAEIGNDCTLYHGVTLGGTSWQKG 114  

                   nviigvvlaghvtIgddvwIGagatilpgvtIGdgavigagsvVtkdvpp
                           ++h+t+g++v++Gaga++l++++IG+g+ ig++svV+k+vp+
  ABA58119.1   115 --------KRHPTLGNNVVVGAGAKVLGPIHIGSGVRIGSNSVVVKSVPA 156  

                   ysvvaGnPakvirlrfeglkrllllelaiwdlraaylllflslllledil
                   +++v+G+P++ +   +    + ++  ++   ++a+   +  ++ +   i 
  ABA58119.1   157 NTTVIGVPGRMVQSKDQRREAKHQAMAKRIGFDAYGTPQDTPDPIERAIH 206  

                   ellellleedaltllipptavidggvvigedvvigpnvviggnvvigdnvvigpnvvi
                                                                  +++
  ABA58119.1    27    --------------------------------------------TTY 29   

                   rgtvigdnvrilsglvigagifgaayigpfarllggvvIgdnvsigagvt
                   +g++++ ++r+ + l+     ++a+ i+  +r+l+g++I++++ ig  ++
  ABA58119.1    30 PGFHAIVWHRLSHRLWNLGAKWLARAISTLSRWLTGIEIHPGAQIGQRFF 79   

                   idrgtlggtvigdnvligdnvhighdvtigdgviiangvgviaggvtIgd
                   id+g+  g+vig+++ ig++++++h+vt+g+ ++  + ++     +t+g+
  ABA58119.1    80 IDHGM--GVVIGETAEIGNDCTLYHGVTLGGTSWQKGKRH-----PTLGN 122  

                   nvwiGagatilpgvtIGdgavigagsvVtkdvppgslvvGnPakvirerf
                   nv++Gaga +l++++IG+g+ ig++svV+k+vp++++v+G+P + +    
  ABA58119.1   123 NVVVGAGAKVLGPIHIGSGVRIGSNSVVVKSVPANTTVIGVPGRMVQ--- 169  

                   eeevillllpellihptaligpgavigegvviapnavi...ggnvvigdgvvigpgvv
                        i ++ l ++ + +g      + +++   + +++i++g+ ig +++
  ABA58119.1    33    HAIVWHRLSHRLWNLGAKWLARAISTLsrwLTGIEIHPGAQIGQRFF 79   

                   irgdvglvvIgdnvvigdgvtihtgthkdtvigdgvkighlvvigdvvIg
                   i++++g vvIg+ ++ig+++t++    +++++g+ ++ ++    +++++g
  ABA58119.1    80 IDHGMG-VVIGETAEIGNDCTLY----HGVTLGGTSWQKGK---RHPTLG 121  

                   dnvwigagavilggvtigdgavigagsvVtkdtvvppgslvvGnPakvir
                   +nv++gaga +lg+++ig+g+ ig +svV+k+  vp++++v+G+P +++ 
  ABA58119.1   122 NNVVVGAGAKVLGPIHIGSGVRIGSNSVVVKS--VPANTTVIGVPGRMVQ 169  

                   elseeelallllalkllvlllkrllealipptalidlgakigegvvigpgavi...ggnvvigdgavigpgvvir
                      i  + l ++ + +g +    + +++   + +++i++ga+ig +++i+
  ABA58119.1    35    IVWHRLSHRLWNLGAKWLARAISTLsrwLTGIEIHPGAQIGQRFFID 81   

                   gdvglvvIGdnvvigdgvtihlhvghdsvigdgvtigngvviggviIgdn
                   +++g vvIG+ ++ig+++t++    h++++g+    + +  ++++++g+n
  ABA58119.1    82 HGMG-VVIGETAEIGNDCTLY----HGVTLGG---TSWQKGKRHPTLGNN 123  

                   vwigagavilggvtigdgavigagsvVtggkdvppgslvvGnPakvi...
                   v++gaga++lg+++ig+g+ ig +svV+  k+vp++++v+G+P+++++ +
  ABA58119.1   124 VVVGAGAKVLGPIHIGSGVRIGSNSVVV--KSVPANTTVIGVPGRMVqsk 171  

                   .......................rglsdeeiallrkaakllvrllkllle
                   ++  +++++++++ +  +++ +  + +d+  ++++ ++++++rl +++++
  ABA58119.1   172 dqrreakhqamakrigfdaygtpQDTPDPIERAIHGLIEHIQRLDERIEQ 221  

                   llaelrildgavigellgllpligellliapnaviyenvvigdnvvigsgav
                      r+++ ++ ++++ l++ i+ l+++ ++  i+ ++ ig++++i     
  ABA58119.1    39    RLSHRLWNLGAKWLARAISTLSRWLTGIEIHPGAQIGQRFFIDH--- 82   

                   ilelallgadgfgfalikipqlgnviigdnveiganttidrgtlldagvk
                          g                                          
  ABA58119.1    83 -------GMG---------------------------------------- 85   

                   lnhltvigdgakidnlvqighnvvigdntiian.gsvtigdnvligggat
                       +vig++a i+n ++++h+v++g+ ++  +++++t+g+nv++g+ga 
  ABA58119.1    86 ----VVIGETAEIGNDCTLYHGVTLGGTSWQKGkRHPTLGNNVVVGAGAK 131  

                   ilggvtIgdnavigagsvVtkdvppgvvvvGvParvikewlknlkklalligptavidegvvigkdvvigpnvviggnvligdnvvigpnvvi
                                                                     
  ABA58119.1     -    ----------------------------------------------- -    

                   ggtiigdnvriksgaviggvgiglavrigpfarirggvvigdnvvigagv
                                          la  i+  +r ++g++i+++++ig  +
  ABA58119.1    52 -----------------------LARAISTLSRWLTGIEIHPGAQIGQRF 78   

                   tidrgtiggtvigdnvsiggnvvighnvhigdgviiangvgvlaggvvIg
                   +id+g+  g+vig+++ ig++++++h+v++g+ ++  +     ++++++g
  ABA58119.1    79 FIDHGM--GVVIGETAEIGNDCTLYHGVTLGGTSWQKG-----KRHPTLG 121  

                   dnvfiGagavilpgvtIgdgavigagsvVtkdvppgslvaGnPakvirel
                   +nv++Gaga +l++++Ig+g+ ig++svV+k+vp++++v+G+P +++   
  ABA58119.1   122 NNVVVGAGAKVLGPIHIGSGVRIGSNSVVVKSVPANTTVIGVPGRMVQSK 171  

                   feeetsarilppaviigdvligegvvigpgavinvvigdnvvigdgavied
                      t  r+l +  i+++++ig+  +i +g   +vvig+ + ig+++++++
  ABA58119.1    58    TLSRWLTGIEIHPGAQIGQRFFIDHGM--GVVIGETAEIGNDCTLYH 102  

                   dvvigdnvligpgaviggnvvigdnvtIganavilnaiigkgvlIgdnvv
                   +v++g  ++  +      + ++g+nv++ga+a++l     + ++Ig++v+
  ABA58119.1   103 GVTLGGTSWQKGKR----HPTLGNNVVVGAGAKVL-----GPIHIGSGVR 143  

                   igagavvlnddtvigdnvi.vgggavvvkgvvigdgvlilrihptavidpgavigegvvigpgaviggnvvigdgvvigpgvvigg
                      +r++++++i+pga+ig++++i++g+                gvvig+
  ABA58119.1    60    SRWLTGIEIHPGAQIGQRFFIDHGM----------------GVVIGE 90   

                   divIGdnvvigdgaviggdgfglpkaglrggviIgdnvtIgenvtihrgt
                   +++IG+++++++g+++gg+++ ++k                         
  ABA58119.1    91 TAEIGNDCTLYHGVTLGGTSWQKGK------------------------- 115  

                   hpldgvtrigdgvkidhlvyighdcvigdnviigagvvlaggvtigddvw
                                                           +++t+g++v+
  ABA58119.1   116 ----------------------------------------RHPTLGNNVV 125  

                   iGagavilpgvtIgdgavigagsvVtkdvppgslvvGnParvirlllegl
                   +Gaga++l++++Ig+g++ig++svV+k+vp++++v+G+P+r ++  ++  
  ABA58119.1   126 VGAGAKVLGPIHIGSGVRIGSNSVVVKSVPANTTVIGVPGRMVQSKDQRR 175  

                   lrllfssalialllalklllrslelleealelllelllellellllldfl
                    + ++  a      a+       + +e+a++ l+e++ +l e ++++   
  ABA58119.1   176 EAKHQAMAKRIGFDAYGTPQDTPDPIERAIHGLIEHIQRLDERIEQMTAE 225  

                   kkslrgilrllkgllggviIgdnvtIgegvtihggthpldgvtvigdgvkidhlvhigh
                      + l+g++I++++ Ig+   i++                 + +v+ig+
  ABA58119.1    61    RWLTGIEIHPGAQIGQRFFIDH-----------------GMGVVIGE 90   

                   dvvigdgviiangvglag........hvtigdnvwiGgnavilpgvtIgd
                   +++ig+++++++gv+l+g+  ++ + h+t+g+nv++G++a +l++++Ig+
  ABA58119.1    91 TAEIGNDCTLYHGVTLGGtswqkgkrHPTLGNNVVVGAGAKVLGPIHIGS 140  

                   gavigagsvVtkdvppgslvvGnParvirlrleglarlgllpelierlla
                   g+ ig++svV+k+vp++++v+G+P+r ++                     
  ABA58119.1   141 GVRIGSNSVVVKSVPANTTVIGVPGRMVQS-------------------- 170  

                   ayklllrlglsleealellelllsldlevlllldfiedskrgilrgvvihlrgaligdgtvigdgvidngvvig.dviIGdnvtigpgvtlg
                      g+ ih +ga ig++++i++g   +gvvig++++IG+++t+++gvtlg
  ABA58119.1    65    GIEIH-PGAQIGQRFFIDHG---MGVVIGeTAEIGNDCTLYHGVTLG 107  

                   ........gpvtIgdnvwiGagavilp.vtIgdgavigagsvvtevt.vp
                    +  ++ ++++t+g+nv++Gaga +l+ ++Ig+g+ ig +svv  v+ vp
  ABA58119.1   108 gtswqkgkRHPTLGNNVVVGAGAKVLGpIHIGSGVRIGSNSVV--VKsVP 155  

                   pgsslvvGnvarrlfdeelialllkalkl........llllealkllell
                   ++ ++v+G+  r++ ++++ +  ++ ++ + +  +++ + ++  + +e  
  ABA58119.1   156 AN-TTVIGVPGRMVQSKDQRREAKHQAMAkrigfdayGTPQDTPDPIERA 204  

                   leellelll