hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /home/genome/SCOP/1.73/Scop1.73.bin
Sequence file:            /home/genome/FASTA/gib_20049.fasta
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: ABA58511.1
Accession:      [none]
Description:    noce0 ABA58511.1 GIB00281CH01 "Transposase"

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
0048742  Homeodomain-like                                35.1    3.2e-09   1
0053365  Homeodomain-like                                18.9    0.00064   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
0053365    1/1       4    54 ..    18    68 .]    18.9  0.00064
0048742    1/1       5    98 ..     1   123 []    35.1  3.2e-09

Alignments of top-scoring domains:
0053365: domain 1 of 1, from 4 to 54: score 18.9, E = 0.00064
                   *->lpldlrekivelvkeglrpreiarrlgvslscvskllkryretGsle
                       ++dlr++++++v++g ++ e+arr++v +  + ++l++ ++    +
  ABA58511.1     4    CSIDLRKRVIDFVRGGGSKAEAARRFQVGRASIYRWLSQDDALCYER 50   

                   PgaillrvnqlgglfvmgrplsvelRlkivllaaeGlspreiarrlgvsrs
                                       s++lR ++++++  G s++e+arr++v r 
  ABA58511.1     5    -----------------SIDLRKRVIDFVRGGGSKAEAARRFQVGRA 34   

                   tvskwlkryretGsvglkprgggrprkltpeqverilellrenpdltlwe
                   ++++wl+      +   +   +  pr+    + e+++ +++++  lt++e
  ABA58511.1    35 SIYRWLS------QDDALCYERPGPRRSHKLDWEALRVHVEDKAALTYKE 78   

                   lrellaeeggvdvsvstvsriLrrlG