hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /home/genome/SCOP/1.73/Scop1.73.bin
Sequence file:            /home/genome/FASTA/gib_20058.fasta
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: ABA59402.1
Accession:      [none]
Description:    noce0 ABA59402.1 GIB00281CH01 "Dihydrouridine synthase TIM-barrel protein yjbN"

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
0044760  FMN-linked oxidoreductases                     275.7    7.8e-80   1
0047140  FMN-linked oxidoreductases                     199.1    2.4e-60   1
0051899  FMN-linked oxidoreductases                     165.3      1e-51   1
0046599  FMN-linked oxidoreductases                     166.6    5.4e-49   1
0042445  FMN-linked oxidoreductases                     153.2    3.2e-44   1
0038429  FMN-linked oxidoreductases                     136.4    3.9e-42   1
0049708  FMN-linked oxidoreductases                     136.2    7.2e-42   1
0052481  FMN-linked oxidoreductases                     135.9    7.7e-41   1
0046721  FMN-linked oxidoreductases                     129.7    1.9e-38   1
0039781  Ribulose-phoshate binding barrel               123.4      3e-34   1
0052610  FMN-linked oxidoreductases                     116.3    9.3e-32   1
0051489  FMN-linked oxidoreductases                     110.2    1.4e-31   1
0038308  FMN-linked oxidoreductases                      96.8    9.1e-28   1
0050322  Ribulose-phoshate binding barrel                89.4    1.6e-24   1
0036258  FMN-linked oxidoreductases                      80.9    1.7e-23   1
0039992  Ribulose-phoshate binding barrel                77.6    9.4e-22   1
0051598  Ribulose-phoshate binding barrel                75.7      2e-21   1
0036457  FMN-linked oxidoreductases                      74.7    9.2e-21   1
0039482  Aldolase                                        77.6    1.5e-20   1
0049629  Ribulose-phoshate binding barrel                64.4    1.7e-18   1
0041658  Aldolase                                        64.2    5.3e-17   1
0051442  Ribulose-phoshate binding barrel                57.7    7.2e-16   1
0048029  FMN-linked oxidoreductases                      51.7    1.9e-15   1
0047026  FMN-linked oxidoreductases                      50.9    4.9e-14   1
0049661  Aldolase                                        46.8    9.6e-14   1
0050003  FMN-linked oxidoreductases                      45.2    3.7e-13   1
0047125  Ribulose-phoshate binding barrel                44.3    7.8e-13   1
0049848  Aldolase                                        48.8    3.1e-12   1
0051164  Ribulose-phoshate binding barrel                46.7    3.2e-12   1
0050135  FMN-linked oxidoreductases                      41.9    8.1e-12   1
0048661  FMN-linked oxidoreductases                      40.3    1.2e-11   1
0036628  Ribulose-phoshate binding barrel                40.7    1.5e-10   1
0048998  Ribulose-phoshate binding barrel                38.7      5e-10   1
0041152  Aldolase                                        36.6    6.2e-10   1
0047651  Enolase C-terminal domain-like                  35.8    1.6e-09   1
0045712  Ribulose-phoshate binding barrel                30.7    6.2e-09   1
0047242  FMN-linked oxidoreductases                      29.0    6.7e-09   1
0045046  Thiamin phosphate synthase                      29.2    6.5e-08   1
0042611  FMN-linked oxidoreductases                      28.4      1e-07   1
0048768  Ribulose-phoshate binding barrel                28.5    1.2e-07   1
0044803  FMN-linked oxidoreductases                      27.7    1.4e-07   1
0050201  FMN-linked oxidoreductases                      21.1    7.2e-06   1
0049739  ThiG-like                                       18.1    1.3e-05   1
0049587  FMN-linked oxidoreductases                      21.8    1.5e-05   1
0041693  Aldolase                                        19.3    6.2e-05   1
0038972  FMN-linked oxidoreductases                      17.1    0.00022   1
0048445  Enolase C-terminal domain-like                  17.6    0.00037   1
0044928  Triosephosphate isomerase (TIM)                 16.3    0.00041   1
0049146  Ribulose-phoshate binding barrel                14.2    0.00068   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
0038972    1/1       1   286 [.     1   364 []    17.1  0.00022
0044803    1/1       4   272 ..     1   361 []    27.7  1.4e-07
0046721    1/1       6   259 ..     1   336 []   129.7  1.9e-38
0049708    1/1       6   275 ..     1   409 []   136.2  7.2e-42
0036258    1/1       8   259 ..     1   367 []    80.9  1.7e-23
0047026    1/1       8   294 ..     1   359 []    50.9  4.9e-14
0038308    1/1       9   302 ..     1   374 []    96.8  9.1e-28
0042611    1/1       9   259 ..     1   380 []    28.4    1e-07
0046599    1/1       9   255 ..     1   311 []   166.6  5.4e-49
0047140    1/1       9   257 ..     1   312 []   199.1  2.4e-60
0047242    1/1       9   248 ..     1   353 []    29.0  6.7e-09
0049587    1/1       9   247 ..     1   349 []    21.8  1.5e-05
0051489    1/1       9   273 ..     1   337 []   110.2  1.4e-31
0036457    1/1      11   261 ..     1   340 []    74.7  9.2e-21
0042445    1/1      11   262 ..     1   330 []   153.2  3.2e-44
0049661    1/1      11   273 ..     1   291 []    46.8  9.6e-14
0039781    1/1      14   271 ..     1   323 []   123.4    3e-34
0044760    1/1      20   336 ..     1   305 []   275.7  7.8e-80
0050322    1/1      20   257 ..     1   239 []    89.4  1.6e-24
0038429    1/1      21   283 ..     1   364 []   136.4  3.9e-42
0041152    1/1      21   263 ..     1   225 []    36.6  6.2e-10
0052481    1/1      21   285 ..     1   311 []   135.9  7.7e-41
0051899    1/1      22   282 ..     1   312 []   165.3    1e-51
0049848    1/1      23   244 ..     1   211 []    48.8  3.1e-12
0039482    1/1      35   249 ..     1   252 []    77.6  1.5e-20
0041658    1/1      38   258 ..     1   251 []    64.2  5.3e-17
0047125    1/1      39   255 ..     1   252 []    44.3  7.8e-13
0045712    1/1      49   257 ..     1   247 []    30.7  6.2e-09
0050003    1/1      63   257 ..   128   359 .]    45.2  3.7e-13
0049629    1/1      64   271 ..    63   253 .]    64.4  1.7e-18
0048029    1/1      67   254 ..   171   414 .]    51.7  1.9e-15
0051164    1/1      68   259 ..     1   222 []    46.7  3.2e-12
0048445    1/1      69   338 ..     1   243 []    17.6  0.00037
0036628    1/1      70   256 ..     1   239 []    40.7  1.5e-10
0045046    1/1      70   257 ..     1   206 []    29.2  6.5e-08
0047651    1/1      70   330 ..     1   234 []    35.8  1.6e-09
0050135    1/1      70   247 ..    92   310 .]    41.9  8.1e-12
0052610    1/1      70   257 ..     1   231 []   116.3  9.3e-32
0039992    1/1      73   255 ..     1   251 []    77.6  9.4e-22
0051442    1/1      73   255 ..     1   230 []    57.7  7.2e-16
0051598    1/1      79   257 ..     1   254 []    75.7    2e-21
0048661    1/1      86   295 ..   171   399 .]    40.3  1.2e-11
0049739    1/1      92   261 ..   138   242 .]    18.1  1.3e-05
0041693    1/1      93   305 ..     1   295 []    19.3  6.2e-05
0048998    1/1     100   255 ..    85   241 .]    38.7    5e-10
0044928    1/1     112   247 ..     1   226 []    16.3  0.00041
0048768    1/1     132   260 ..    98   254 .]    28.5  1.2e-07
0049146    1/1     202   269 ..   189   261 .]    14.2  0.00068
0050201    1/1     202   262 ..   169   229 .]    21.1  7.2e-06

Alignments of top-scoring domains:
0038972: domain 1 of 1, from 1 to 286: score 17.1, E = 0.00022
                   *->llklskLfePlklggltlknRivmaPmtryraedgvptdllleyyaq
                      +l      + +++ ++    +i +aPm ++       td++ +y+ +
  ABA59402.1     1    MLFSYDCKKTIQMADYSKAYKISVAPMMEW-------TDRHCRYFLR 40   

                   rAkgggliiteatavspegrgypgtpgiwsdeqieglkklvdavhakgak
                   +  + +l++te++                  + i+g +    a h+    
  ABA59402.1    41 LISHRALLYTEMVT---------------AGALIHGNRARFLAYHKSEHP 75   

                   iflQLwhaGrvaspdllpggllpvapsaiplplelllllllllllvvpra
                   ++lQL                                      +  +p +
  ABA59402.1    76 LALQL--------------------------------------GGSHPEE 87   

                   lteeeikeiiedfaqAArrAieAGfDgveihgAhgYLldqFlspltNkRt
                   l            a +A++A + GfD v +  +          p     +
  ABA59402.1    88 L------------ALCAQMAEDYGFDEVNLNVG---------CPSNRVQS 116  

                   DeYGGslenRaRfllevveavreavg.dfpvgvRlspldlveggldsltl
                    ++G  l     ++ e+v+a  +a+ +++ v  R++  +        +++
  ABA59402.1   117 GRFGACLMAEPELVAECVAAMAQATQiPVTVKTRIGIDEQ-------DSY 159  

                   eealelakaleelgldylhvsegrve........ipvgegyflelaelir
                   e   +++  ++++g+  + ++   ++ +    +++  ++   +++++ i+
  ABA59402.1   160 EALDHFISTVAQAGCRTFIIHARKAWlqglspkeNREKPPLRYDVVRTIK 209  

                   kav.kipviavggi.tpelaeealaegladlvalgrafladPdlvlklae
                   + + +++vi++ggi+t+e + e l+  l+d v++gra++ +P+l +++ +
  ABA59402.1   210 QDFpQLTVIINGGItTLEEISEHLE--LLDGVMIGRAAYHNPYLLAQVDR 257  

                   gl.plnpcirctfylldlalgytdypllgmskLfePlklggltlkNRivmaPmtrylaedgvptdllleyyaqrAk
                           + +++ ++    +i +aPm +        td++ +y+ ++  
  ABA59402.1     4    SYDCKKTIQMADYSKAYKISVAPMME-------WTDRHCRYFLRLIS 43   

                   gggliiteatavspegrgypgtpgiwsdeqieglkkltdavhaagakifl
                   + +l++te++   +                                    
  ABA59402.1    44 HRALLYTEMVTAGA------------------------------------ 57   

                   QLwhaGrvaspalllggllpvaPsaiplplelllallllllllvpralte
                    L h  r  + a+      + +  +++l+          l+  +p +l  
  ABA59402.1    58 -LIHGNRARFLAY------HKSEHPLALQ----------LGGSHPEEL-- 88   

                   eeieeiiedfaqAArraieaGfDgveihgAhgyLldqFlspltNkRtDeY
                             a +A++a + GfD v ++ ++         p     + ++
  ABA59402.1    89 ----------ALCAQMAEDYGFDEVNLNVGC---------PSNRVQSGRF 119  

                   GGslenRarfllevveavreavgadfvlgvrlsatdfvegglsltleeal
                   G  l     ++ e+v+a+++a+  ++++  r+++++       +++e   
  ABA59402.1   120 GACLMAEPELVAECVAAMAQATQIPVTVKTRIGIDEQ------DSYEALD 163  

                   elaklleeagldylhvsegrveg........pvgegyflelaelireav.
                   ++++ +++ag+  + ++ +  + +    +++   +   +++++ i++ + 
  ABA59402.1   164 HFISTVAQAGCRTFIIHARKAWLqglspkenREKPPLRYDVVRTIKQDFp 213  

                   kipviavggi.tpelaeealeegladlvalgRaflanPdlvlklaegl..
                   +++vi++ggi+t+e + e le  l+d v++gRa++ nP+l +++ ++++ 
  ABA59402.1   214 QLTVIINGGItTLEEISEHLE--LLDGVMIGRAAYHNPYLLAQVDRNFyg 261  

                   plnpcirctfyllglllgytdypllgalrrllrpllfylddevtlrlnllafddilllprvlpdvsldvdlst
                                                               d+  ++
  ABA59402.1     6    -----------------------------------------DCKKTI 11   

                   tllgltlknPlvlapm.tvtdaelaialaalgagl.ivlgtvtveplegn
                   ++ ++  ++ + +apm+ +td  ++  l+  ++ + +++++vt  +l   
  ABA59402.1    12 QMADYSKAYKISVAPMmEWTDRHCRYFLRLISHRAlLYTEMVTAGALIHG 61   

                   vsprllrlpedeaiinlyglndpgleellervkaagikipvganlgvdei
                                               ++++  ++ ++p++ +lg    
  ABA59402.1    62 NR--------------------------ARFLAYHKSEHPLALQLG---- 81   

                   lplgarvedfaeaarlaee.gadaielnfssPnlpnlrsdeyggslenrp
                      g+ +e++a +a++ae++g+d + ln+++P    + s ++g++l+ +p
  ABA59402.1    82 ---GSHPEELALCAQMAEDyGFDEVNLNVGCP-SNRVQSGRFGACLMAEP 127  

                   rllleiikavreavgedvpvivKlspgldvedied....lakaleeaGad
                   +l++e+++a+ +a+   +pv+vK+++g+d +d +++ ++++  +++aG+ 
  ABA59402.1   128 ELVAECVAAMAQATQ--IPVTVKTRIGIDEQDSYEaldhFISTVAQAGCR 175  

                   aiivsngigggtgltplelagvhgglsglplapaslevlaelreavggri
                    +i++++  ++ gl+p+e         ++  +p+ ++v++ +++ ++  +
  ABA59402.1   176 TFIIHARKAWLQGLSPKE---------NREKPPLRYDVVRTIKQDFPQ-L 215  

                   pviadGGirsgedaakalalGAdaVmigrallyagpdlvrkilegllnlldlralalrrllrpllfyldgetahrltlaflrigllprvlvvs
                                                                     
  ABA59402.1     -    ----------------------------------------------- -    

                   dvdlstellglklknPfglapmgdknlelaralaal..gaglvvtgtvtp
                   d+  ++++++++ ++ + +apm+ ++ +++r + +l+   +l++t++vt+
  ABA59402.1     6 DCKKTIQMADYSKAYKISVAPMMEWTDRHCRYFLRLisHRALLYTEMVTA 55   

                   vpqegnpkprlfrlpedealinlyglnnegldallerlkalkalllllll
                    ++++  + r+ ++++                                  
  ABA59402.1    56 GALIHGNRARFLAYHK---------------------------------- 71   

                   eaggplivqiggsglfgsrpedlaeaaellepl.adaielnlscPakpgl
                    +++pl++q+gg     s+pe+la +a+++e++ +d+++ln++cP  ++ 
  ABA59402.1    72 -SEHPLALQLGG-----SHPEELALCAQMAEDYgFDEVNLNVGCPSNRVQ 115  

                   ggllgaalledfiaaarraveagadiielgiasgylldgfliplanlral
                   +g++ga+l+++                                       
  ABA59402.1   116 SGRFGACLMAE--------------------------------------- 126  

                   eyGndpelllelikalreavgvPlvivKirpglsved....ieeiakale
                        pel++e+++a+ +a+ +P v+vK+r+g++++d +++++ ++  ++
  ABA59402.1   127 -----PELVAECVAAMAQATQIP-VTVKTRIGIDEQDsyeaLDHFISTVA 170  

                   eaGadgiivsnttagghgrtslegv.tgglsglpllpasleliaalreal
                   +aG+  +i++      ++ ++l+g  +++++++p  p  +++++ +++ +
  ABA59402.1   171 QAGCRTFIIH------ARKAWLQGLsPKENREKP--PLRYDVVRTIKQDF 212  

                   ggripviavGGIrtgedaakalaaGAdgVmvgrallyagpelvleileel
                   +  + vi++GGI+t e + ++l++  dgVm+gra+++ +p+l++++ +++
  ABA59402.1   213 PQ-LTVIINGGITTLEEISEHLEL-LDGVMIGRAAYH-NPYLLAQVDRNF 259  

                   kallallgvssleelvgsdHmerlaelmlpkrlipyllvgldrevthrlnlkaldrvalipevtagd
                                                                     
  ABA59402.1     -    ----------------------------------------------- -    

                   pdlsttilglelknPlvlapmag.gnaelaaalaa.gGagaievgtvtpd
                     +++++++++ ++ + +apm   +++ +   l+ ++  +++++ +vt+ 
  ABA59402.1     8 -KKTIQMADYSKAYKISVAPMMEwTDRHCRYFLRLiSHRALLYTEMVTAG 56   

                   pqagnpvprlarlralagginrmglnnlgldalleelravrlavvkraap
                                                     ++++  r  +++ ++ 
  ABA59402.1    57 ----------------------------------ALIHGNRARFLAYHKS 72   

                   dvpvgvnlggnkpaefgvddyelarraleaGadaivlnvsapnlpglrkd
                   + p+ ++lgg++p+e +      a+ a+++G+d + lnv++p + ++ + 
  ABA59402.1    73 EHPLALQLGGSHPEELA----LCAQMAEDYGFDEVNLNVGCP-SNRVQSG 117  

                   qgggallpdpelvlelikalkeavglpvivklapgltgvdtvelakraee
                    +g+ l+  pelv+e ++a+++a+ +pv vk + g+++ d++e+++  + 
  ABA59402.1   118 RFGACLMAEPELVAECVAAMAQATQIPVTVKTRIGIDEQDSYEALDHFIS 167  

                   ....aGadavvvsnttggrgldgttrrv..aeagglsGaplkpaslellr
                   ++++aG+   +++     r ++++   ++++           p+ ++++r
  ABA59402.1   168 tvaqAGCRTFIIHA----RKAWLQGLSPkeNREKP-------PLRYDVVR 206  

                   eiaeavggdipviadGGIrtgedaakalaaGAdaVqvgsallyagpalve
                    i++ ++ ++ vi +GGI t e + ++l++  d+V++g+a + ++p+l++
  ABA59402.1   207 TIKQDFP-QLTVIINGGITTLEEISEHLEL-LDGVMIGRAAY-HNPYLLA 253  

                   elakelkaameltglaslaelrgkllriesllnladlealarrrlpkrkfdyldggagdevtlrrnrlafddvll
                      ++ + +ad+ ++++                                 
  ABA59402.1     8    KKTIQMADYSKAYK--------------------------------- 21   

                   vprvlpdvsdvdlsttllglklslPliiapmagvtllhpdgeaalaraaa
                                            + +apm   t  h ++ ++l    a
  ABA59402.1    22 -------------------------ISVAPMMEWTDRHCRYFLRLISHRA 46   

                   raGglgv.lgsgslapeeevrkaapg..pfgvnlyglkdpellaellrra
                    + + +v+ g+     + ++ +++++++p++ +l+g ++pe+la  +++a
  ABA59402.1    47 LLYTEMVtAGALIHGNRARFLAYHKSehPLALQLGG-SHPEELALCAQMA 95   

                   eaagadaivltvglpvlgvrerdlrlgfllppaaggalladlaralalvl
                   e++g+d + l+vg+p           +++  ++ g+ l+a          
  ABA59402.1    96 EDYGFDEVNLNVGCPS----------NRVQSGRFGACLMA---------- 125  

                   agadelvlvvsdgdpeglleliealreatgvpvivkgvatved.......
                                 pe+++e ++a+++at +pv+vk+++++++++ +++ 
  ABA59402.1   126 -------------EPELVAECVAAMAQATQIPVTVKTRIGIDEqdsyeal 162  

                   ...araaaeaGadaivvsggggggl........dvgvptlealpevaeav
                   ++ +  +a+aG+   +++ + +       +++    +   ++++ +++ +
  ABA59402.1   163 dhfISTVAQAGCRTFIIHARKAWLQglspkenrEKPPLRYDVVRTIKQDF 212  

                   ggdipviadGGIrtgedvakalalGAdgVlvGtaflyaleapge......
                   + ++ vi++GGI t e + + l+l  dgV++G+a+++++ + ++++ + +
  ABA59402.1   213 P-QLTVIINGGITTLEEISEHLEL-LDGVMIGRAAYHNPYLLAQvdrnfy 260  

                   ..........egvkealealleelrltmallGapsieelrgkllvvrit<
                    + +   + +e ++++l + +e+l++   l  ++                
  ABA59402.1   261 gdfhpfltrhEIIEAFLPYVAEQLVQGVYLNHMT---------------  294  

                   -*
                     
  ABA59402.1     -    -    

0038308: domain 1 of 1, from 9 to 302: score 96.8, E = 9.1e-28
                   *->lslkmskLfePlklggltlknRivmaPmtryraedgvptdlllryya
                               + +++ ++    +i +aPm +       +td++ ry+ 
  ABA59402.1     9    ---------KTIQMADYSKAYKISVAPMME-------WTDRHCRYFL 39   

                   qra.gagliiteatavspegrgypgtlgiwsdeqieglkkltdavhaegg
                   ++    +l++te++  ++  +g++  +                 +h+ ++
  ABA59402.1    40 RLIsHRALLYTEMVTAGALIHGNRARFLA---------------YHKSEH 74   

                   kiflQLahaGrvaspalllgglppvaPSaipapllllllllllgllalla
                   +++lQL                                            
  ABA59402.1    75 PLALQLG------------------------------------------- 81   

                   gavpralteeeieeiiedfaeAArraieaGfDgveihgAhgyLldqFlsp
                   g+ p++l            a +A++a ++GfD v ++ ++         p
  ABA59402.1    82 GSHPEEL------------ALCAQMAEDYGFDEVNLNVGC---------P 110  

                   ltnkrtdeyGGslenrarfllevveavraavgdfpvgvRlspldlveggl
                      + ++++G+ l+  ++++ e+v a+ +a+  +pv+v+ +++ + ++  
  ABA59402.1   111 SNRVQSGRFGACLMAEPELVAECVAAMAQAT-QIPVTVKTRIGIDEQDS- 158  

                   dsltleealelakaleeagvdylhvsggtve.........gvpegafldl
                       +e   +++  +++ag+  + ++ +  + +    +++   + + +d+
  ABA59402.1   159 ----YEALDHFISTVAQAGCRTFIIHARKAWlqglspkenREKPPLRYDV 204  

                   aaavrkav.kipviavggi.dpelaeealeeggaDlvaigRaflanPdlv
                   ++ +++ + +++vi++ggi+++e + e+le   +D+v+igRa++ nP+l 
  ABA59402.1   205 VRTIKQDFpQLTVIINGGItTLEEISEHLE--LLDGVMIGRAAYHNPYLL 252  

                   lklaeglplnirdcitfylgl...........avgytdypllgeelelll
                   +++ +++  + ++  t +  +++   +++++ + g +++ ++ + l+l +
  ABA59402.1   253 AQVDRNFYGDFHPFLTRHEIIeaflpyvaeqlVQGVYLNHMTRHILGLFQ 302  

                   kmskLfePlklggltlknRivmaPmtryraedgvptdllleyyaqrA
                            + +++ ++    +i +aPm          td++ +y+ ++ 
  ABA59402.1     9    ------KTIQMADYSKAYKISVAPMM-------EWTDRHCRYFLRLI 42   

                   kgggliiteatavspegrgypgtpgiwsdeqveglkkltdavhaaggkif
                    + +l++te               +++  + + g +  + a h+ +++++
  ABA59402.1    43 SHRALLYTE---------------MVTAGALIHGNRARFLAYHKSEHPLA 77   

                   lQLwhaGrvaspslllggllpvaPSaiplpgglllllldlgllllvvtpr
                   lQL                                               
  ABA59402.1    78 LQLGGS-------------------------------------------- 83   

                   alteeeieeiiedfaqAArrAieaGfDgveihgAhgYLldqFlspltNkR
                              e+ a +A++A + GfD v +  +          p     
  ABA59402.1    84 ---------HPEELALCAQMAEDYGFDEVNLNVG---------CPSNRVQ 115  

                   tDeYGGslenRarfllevveavreavg.dfpvgvRlspldlveglldldp
                   + ++G  l     ++ e+v+a ++a+ +++ v  R++ ++   +      
  ABA59402.1   116 SGRFGACLMAEPELVAECVAAMAQATQiPVTVKTRIGIDEQDSY------ 159  

                   lelgltleealelakaleeagldylhvsegrveglvlliasilvgegyfl
                          e   +++  +++ag+  + ++ + ++   l     ++++   +
  ABA59402.1   160 -------EALDHFISTVAQAGCRTFIIHARKAWLQGLSPKENREKPPLRY 202  

                   elaeaireav.kipviavggi.tpelaeealeegladlvalgRaflanPd
                   ++++ i++ + +++vi++ggi+t+e + e le  l+d v++gRa++ nP+
  ABA59402.1   203 DVVRTIKQDFpQLTVIINGGItTLEEISEHLE--LLDGVMIGRAAYHNPY 250  

                   lvlklaeglplnpcirctfylldlalgytdypllgepkdvpllstlilglklknPiilApmadvtdaelaaalalaggggvlg
                            +++++++++  + i +Apm+ +td++++++l+l   +++l+
  ABA59402.1     9    ------KTIQMADYSKAYKISVAPMMEWTDRHCRYFLRLISHRALLY 49   

                   ktmtpepqagnpvprarrldeaginrlgfndlgaaaelrrllkllvksia
                   ++m++++++ +                            + ++ l+++  
  ABA59402.1    50 TEMVTAGALIH---------------------------GNRARFLAYHKS 72   

                   evpiivnlvgggireldaedarllleagadavelnigcpntpv....lga
                   e+p++++l+g+ ++el a++a++++++g d v+ln+gcp+++v+   +ga
  ABA59402.1    73 EHPLALQLGGSHPEEL-ALCAQMAEDYGFDEVNLNVGCPSNRVqsgrFGA 121  

                   llakdpelvaivvaavkkavkvpvvvkivpgvdd......lveiakalee
                   +l+++pelva++vaa+++a+++pv+vk+++g+d+++ +++l+ ++  +++
  ABA59402.1   122 CLMAEPELVAECVAAMAQATQIPVTVKTRIGIDEqdsyeaLDHFISTVAQ 171  

                   aGadaiivtnttagghlglellkpilkvgigglsgrplrplalelvpqla
                   aG+  +i++++ a+  ++            +++++r+ +pl +++v+ ++
  ABA59402.1   172 AGCRTFIIHARKAWLQGL------------SPKENREKPPLRYDVVRTIK 209  

                   kav.diPviasGGIrsgedaaealaaGAdaVqvGtaflytpealaeikvk
                   + + ++ vi++GGI+++e + e+l++  d+V++G+a++++p++la++   
  ABA59402.1   210 QDFpQLTVIINGGITTLEEISEHLEL-LDGVMIGRAAYHNPYLLAQV--- 255  

                   lalllakdgdtsitelvGglslellLstellgltlknPlvlApmadvtdlelrraaar.ggaglvvtemvta
                       ++++++++  +++ +Apm+ +td+++r++++ ++  +l++temvta
  ABA59402.1     9    KTIQMADYSKAYKISVAPMMEWTDRHCRYFLRLiSHRALLYTEMVTA 55   

                   eqpqegnpkprlfrlpedevllvaevlglinrmglnnlglealleeiral
                    ++++g                                      ++ r+l
  ABA59402.1    56 GALIHG--------------------------------------NRARFL 67   

                   kdaagdlpvivqlgvgsdpedlaeaarraeeaGadaielnlgcPntkvlr
                    +++ ++p+++qlg gs pe+la +a++ae++G+d+++ln+gcP+++v++
  ABA59402.1    68 AYHKSEHPLALQLG-GSHPEELALCAQMAEDYGFDEVNLNVGCPSNRVQS 116  

                   g.ggaallqdpellleivkavreavgipvivKlrpggd......dtvela
                   g +ga+l+++pel++e+v+a+++a+ ipv+vK+r+g+d+++ ++++ +++
  ABA59402.1   117 GrFGACLMAEPELVAECVAAMAQATQIPVTVKTRIGIDeqdsyeALDHFI 166  

                   raaeeaGadgiivhnrtgtqlidvearkallglglgsinetgglsgpaip
                     +++aG+  +i+           +arka+l+++++++n       +  p
  ABA59402.1   167 STVAQAGCRTFII-----------HARKAWLQGLSPKEN-------REKP 198  

                   paaleliaevreavpgipvianGGIrtgedalealaaGAdaVmvgsallg
                   p+ +++++ +++ +p++ vi+nGGI+t+e++ e+l++  d+Vm+g+a+++
  ABA59402.1   199 PLRYDVVRTIKQDFPQLTVIINGGITTLEEISEHLEL-LDGVMIGRAAYH 247  

                   tgpalveeileglrelleergfgdllnladlealakrrlpkrafdyldggagdevtlrrnrlafddvllv
                      + + +ad+ +++k                                  
  ABA59402.1     9    KTIQMADYSKAYK---------------------------------- 21   

                   prvlvdvsdvdlsttllglklslPlviapmagvtllhpdgeaalaiaaae
                                           + +apm   t  h ++ ++l    a 
  ABA59402.1    22 ------------------------ISVAPMMEWTDRHCRYFLRLISHRAL 47   

                   aGglgvlgtgssas.ieevkkaapg..plivqlyvldretteellkraea
                   + + +v+  + ++ + ++  +++++++pl  ql++ ++e ++  +++ae+
  ABA59402.1    48 LYTEMVTAGALIHGnRARFLAYHKSehPLALQLGGSHPEELALCAQMAED 97   

                   agadalvltvdapllgirerdlrlgfglppglgglntldlvvipegrllg
                   +g+d + l+v++p   +r+   r+g+ l                      
  ABA59402.1    98 YGFDEVNLNVGCP--SNRVQSGRFGACLMA-------------------- 125  

                   advilldaahgdplllleliealrealgvpvivkgvatved.........
                               p+l++e ++a+++a+ +pv vk+ +  ++++ +++ ++
  ABA59402.1   126 -----------EPELVAECVAAMAQATQIPVTVKTRIGIDEqdsyealdh 164  

                   .arraleaGadaivvsghggggldvgipt....laalpevveav.....d
                    +  +++aG+   +++ + +   + +++ + ++  + ++vv+ ++++  +
  ABA59402.1   165 fISTVAQAGCRTFIIHARKAWLQGLSPKEnrekPPLRYDVVRTIkqdfpQ 214  

                   vpviadGGirtggdvakalalGAdaVlvGtaflyaleapgeegvknvlea
                   ++vi++GGi t + + + l+l  d+V++G+a+++                
  ABA59402.1   215 LTVIINGGITTLEEISEHLEL-LDGVMIGRAAYHN--------------- 248  

                   llgelrltmallGapslaeLrgkllvlrnllsladlealakrrlpkrkfdyldggagdevtlrenrlafddvllv
                      + + +ad+ +++k                                  
  ABA59402.1     9    KTIQMADYSKAYK---------------------------------- 21   

                   prvlpdvsdvdlsttllgiklslPliiapmggvtllspdgepalaraaar
                                           + +apm   t  + +  ++l    a 
  ABA59402.1    22 ------------------------ISVAPMMEWTDRHCRYFLRLISHRAL 47   

                   aGglgvlgsgslglee..evrkakpdgplivnlyaskdrgvlaellerae
                   + + +v+  + ++  ++ +++ +k ++pl  +l  ++ ++ la  +++ae
  ABA59402.1    48 LYTEMVTAGALIHGNRarFLAYHKSEHPLALQL-GGSHPEELALCAQMAE 96   

                   eagadaivltvdspllgqrardlrggfllglkvtaeilalrlvppgeali
                   ++g+d + l+v++p  ++r+  +r+g+ l +                   
  ABA59402.1    97 DYGFDEVNLNVGCP--SNRVQSGRFGACLMA------------------- 125  

                   spahgdpilsledlkalrealgvpvivkgvltved..........allaa
                         p l+ e ++a+++a+ +pv vk  +  ++++ +++ ++ +  +a
  ABA59402.1   126 -----EPELVAECVAAMAQATQIPVTVKTRIGIDEqdsyealdhfISTVA 170  

                   eaGadaivvsghggggl........dvgvptlealpevaeavggdipvia
                   +aG+   +++ + +       +++    +   ++++ + +  + +++vi+
  ABA59402.1   171 QAGCRTFIIHARKAWLQglspkenrEKPPLRYDVVRTIKQDFP-QLTVII 219  

                   dGGirtggDvakalalGAdaVmiGraflyaleapgeegvknlleallgel
                    GGi t + + + l+l  d+VmiGra+ +                     
  ABA59402.1   220 NGGITTLEEISEHLEL-LDGVMIGRAAYH--------------------- 247  

                   rlamallGarsleelrgkllvllslLfeplklggltlkNRivmaPmtrylaldedgvptdlllayyaqr
                           + +++ ++    +i +aPm+++           ++ +y+ ++
  ABA59402.1     9    -----KTIQMADYSKAYKISVAPMMEWTD---------RHCRYFLRL 41   

                   AkggaGliiteatavsplgrgypgvlglwsdeqieglkkltdavhaagal
                                                                ++ al
  ABA59402.1    42 I--------------------------------------------SHRAL 47   

                   iaiqLwhaGrvallgllpvaPsaipldlllevpraltleeigeiiedfae
                   ++ +++ aG   ++++         +    e+p al+l+  g+ +e+ a 
  ABA59402.1    48 LYTEMVTAGALIHGNRAR-----FLAYHKSEHPLALQLG--GSHPEELAL 90   

                   aAkraieaGfdgvelhgahgyLldqFlspltnvrtdeyGgslenrarfll
                   +A++a+++Gfd v+l+++         +p+ +v+++++G++l+ ++++++
  ABA59402.1    91 CAQMAEDYGFDEVNLNVG---------CPSNRVQSGRFGACLMAEPELVA 131  

                   evveavreavgfpvgvrlspldlvegglnleeavelakaleeagvdllhv
                   e+v+a+ +a+ +pv+v+ ++   +++  ++e + +++  +++ag+  + +
  ABA59402.1   132 ECVAAMAQATQIPVTVKTRI--GIDEQDSYEALDHFISTVAQAGCRTFII 179  

                   shg.....rtsglstpaipgafldlaaavkkavs.ipviavggitspeda
                   +++++  +++s+++++++p++ +d+++ +k+ +++++vi++ggit++e++
  ABA59402.1   180 HARkawlqGLSPKENREKPPLRYDVVRTIKQDFPqLTVIINGGITTLEEI 229  

                   eealeeggadlvalgRallanPdlvlkiaegleleildcitfdlllletlslskLfePlklggltLknRivmaPmtryr.dgvptdllleyya
                                  +++ ++    +i +aPm ++++           y 
  ABA59402.1    11    ------------IQMADYSKAYKISVAPMMEWTdR-------HCRYF 38   

                   lralggagliiteatavspegrgttpgtpglwsdeqieglkklvdavhaa
                   lr  +   l++te++++ +  +g  ++ +  ++ e+  +l+         
  ABA59402.1    39 LRLISHRALLYTEMVTAGALIHGNRARFLAYHKSEHPLALQ--------- 79   

                   galifiqLwhaGrvaspsllgllpvapsaiplplllllvpraltveeiae
                                                     l+  +p++l       
  ABA59402.1    80 ----------------------------------LGGSHPEEL------- 88   

                   iiedfaeaArraieaGfdgveihgahgYLldqFlspltnkrtdeyGgsle
                        a +A++a+++Gfd v ++ ++         p   + ++++G  l+
  ABA59402.1    89 -----ALCAQMAEDYGFDEVNLNVGC---------PSNRVQSGRFGACLM 124  

                   nrarfllevveavraavgadfpvgvRlspddlvegggltledavelakal
                     ++++ e v+a+++a+  +++v++R++ d+      +++e   +++  +
  ABA59402.1   125 AEPELVAECVAAMAQATQIPVTVKTRIGIDEQ-----DSYEALDHFISTV 169  

                   eeagldylhvsggtreglvlliatlilvrggydldlakavkeavk.ipvi
                   ++ag+  + ++ +  +  + l +   + ++ + +d+++ +k+ +++++vi
  ABA59402.1   170 AQAGCRTFIIHARKAWL-QGLSPKENREKPPLRYDVVRTIKQDFPqLTVI 218  

                   avggittpedaeealeaggadlvavgraflanPdlvlkikeglpekmsrLfeplklggltlknRivmaPmtryladdgvptdlllayyaqra
                              +++ ++    +i +aPm+        +td++++y+ ++ 
  ABA59402.1    11    --------IQMADYSKAYKISVAPMM-------EWTDRHCRYFLRLI 42   

                   kggagliiteatavspegrgypgtlglwsdeqieglkkltdavhaeggki
                   +   +l++te+++++++++g +++++ ++++               ++++
  ABA59402.1    43 S-HRALLYTEMVTAGALIHGNRARFLAYHKS---------------EHPL 76   

                   fiqLahagrvasgllpvapsaipaplglvvpraltleeieeiiedfaeaa
                   ++qL+++ +                                  e++a +a
  ABA59402.1    77 ALQLGGSHP----------------------------------EELALCA 92   

                   rraleaGfdgveihgahgyLldqFlsplsnvrtdeyGgslenrprlllev
                   ++a++ Gfd v++++++         p+ +v+++++G++l+ +p+l++e+
  ABA59402.1    93 QMAEDYGFDEVNLNVGC---------PSNRVQSGRFGACLMAEPELVAEC 133  

                   veavreavgadfivgvRlspddlvgggltleeavelakaleeaGadyihv
                   v+a+++a  ++++v++R+++d+++    ++e + +++  +++aG+  +++
  ABA59402.1   134 VAAMAQATQIPVTVKTRIGIDEQD----SYEALDHFISTVAQAGCRTFII 179  

                   sgg..tleglvplestpvpggadlelaravreavsipviavggirtpeda
                   ++++++l+gl+p+e++  p++ +  +     ++ +++vi++ggi+t+e +
  ABA59402.1   180 HARkaWLQGLSPKENREKPPLRYDVVRTIKQDFPQLTVIINGGITTLEEI 229  

                   eealeaggadlvavgraflanPdlvaklkeglplegkllrlerlsnrdgrllilAiDqrvslgpmlalkdgkavrlvsgled
                       +++++++ ++             +s+ pm+ ++d+++ + ++ +  
  ABA59402.1    11    IQMADYSKAYK-------------ISVAPMMEWTDRHCRYFLRLISH 44   

                   fktvvsealeagasailldpglalaaaldfvalgadvgllvdldgafvla
                    +++++e+++aga                   ++++++  +++ +   ++
  ABA59402.1    45 RALLYTEMVTAGA------------------LIHGNRARFLAYHK--SEH 74   

                   ptngdlggllslesveaav...eaGadavklglyygsdkeaeq.....al
                   p+  +lgg+ + e++  a ++++ G d v+l+++++s+ +++    + ++
  ABA59402.1    75 PLALQLGGSHPEELALCAQmaeDYGFDEVNLNVGCPSNRVQSGrfgacLM 124  

                   edlervrelcralglplvvelvarggrlgwakvdpeliad.aareaaelG
                   +++e+v+e ++a+  +  + +v++++r+g +++d+  ++d+++   a++G
  ABA59402.1   125 AEPELVAECVAAMAQATQI-PVTVKTRIGIDEQDSYEALDhFISTVAQAG 173  

                   adilkvevptdagtlegpn...........lealrevveavgiPwvilsG
                      ++++ ++    l+g + +++ ++    ++ +r +++ ++   vi++G
  ABA59402.1   174 CRTFIIHARKA--WLQGLSpkenrekpplrYDVVRTIKQDFPQLTVIING 221  

                   Gv.sspefleavkaaieaGAsGvivGRavwqgplplvealealvtegasv
                   G+++ +e+ e+++ +     +Gv++GRa++ +p  l+++ + ++ + ++ 
  ABA59402.1   222 GItTLEEISEHLELL-----DGVMIGRAAYHNPYLLAQVDRNFYGDFHPF 266  

                   eealnelleelaslwgllglelpiriaPmldvtdglvvrllqgkygaalvykemvfsdllll
                        +   ++i +aPm+ +td++++ +l+    +al+y+emv +++l++
  ABA59402.1    14    ADYSKAYKISVAPMMEWTDRHCRYFLRLISHRALLYTEMVTAGALIH 60   

                   gdpvelakayeeaGadalhvldldaafaggvtrgvllelikeiaeavpip
                   g                                   ++ ++  ++++p+ 
  ABA59402.1    61 G---------------------------------NRARFLAYHKSEHPLA 77   

                   vqvgggirsledlaaaiivfleaaiillnaGadaviigsaaltnpdeahg
                   +q+gg+++++++l a ++++++++++ ln G++   +             
  ABA59402.1    78 LQLGGSHPEELALCAQMAEDYGFDEVNLNVGCPSNRV------------- 114  

                   yllsqfllpllaelakeygaqaivvgidakrgkggaallddpelveaive
                                                  g++ga+l+  pelv+++v+
  ABA59402.1   115 -----------------------------QSGRFGACLMAEPELVAECVA 135  

                   avkeavpvpvtvkirggtelgd..idavelakaleeaGadailvtgrtr.
                   a+ +a+ +pvtvk+r+g +++d ++++  +   +++aG+  +++++r + 
  ABA59402.1   136 AMAQATQIPVTVKTRIGIDEQDsyEALDHFISTVAQAGCRTFIIHARKAw 185  

                   .dgtls.......gadlelirevkeav.kiPViasGGigtpedaaaalee
                     g+ ++++ ++ ++ ++ +r +k+    + Vi +GGi+t+e++ + le 
  ABA59402.1   186 lQGLSPkenrekpPLRYDVVRTIKQDFpQLTVIINGGITTLEEISEHLEL 235  

                   lGadgvlvgsallggpeileeakalleeggllvrpllvnrlvlAPMvgvtdlpfrlllarl.gaglvytemvtakdllrgglkrl
                       ++++APM+ +td+++r++l+ +    l+ytemvta +l++g+++r+
  ABA59402.1    20    YKISVAPMMEWTDRHCRYFLRLIsHRALLYTEMVTAGALIHGNRARF 66   

                   llavdeegrplvvqlagsdpedlaeaaklaee.gadgidlnfgcpvskvr
                   l a++++++pl++ql+gs pe+la +a++ae++g+d+++ln+gcp+ +v+
  ABA59402.1    67 L-AYHKSEHPLALQLGGSHPEELALCAQMAEDyGFDEVNLNVGCPSNRVQ 115  

                   rdgyGaallkdpelvleivkavreavpipvtvkirlgwdledtve....l
                   ++++Ga+l+++pelv+e+v+a+ +a+ ipvtvk+r+g+d +d++e+ +++
  ABA59402.1   116 SGRFGACLMAEPELVAECVAAMAQATQIPVTVKTRIGIDEQDSYEaldhF 165  

                   akaleeaGadaltvhgr........trsqrytgpadleaikevke...si
                   +  +++aG+  +++h+r++  +   ++++r+++p+ +++++ +k++  ++
  ABA59402.1   166 ISTVAQAGCRTFIIHARkawlqglsPKENREKPPLRYDVVRTIKQdfpQL 215  

                   pvianGgirtpedaakaleatGadgVmigraalgnpelfgeikeglggeg
                    vi+nGgi+t+e++ ++le+   dgVmigraa++np+l++++++ ++g  
  ABA59402.1   216 TVIINGGITTLEEISEHLEL--LDGVMIGRAAYHNPYLLAQVDRNFYGDF 263  

                   ivvigakevlellleylellleyggellgvlrllkhllrllkglpgagel
                   ++ ++++e++e++l+y+ ++l  g     ++++++h+l+l++g pga+++
  ABA59402.1   264 HPFLTRHEIIEAFLPYVAEQLVQGVY---LNHMTRHILGLFQGQPGARAW 310  

                   rltln.dadgllegldlleelleevdlamriiPalDlkdgrvvrlvqgdldnlrvvgd.......pvelaavy
                      +++ + P+++++d+++  + + + ++++++ +++++ + ++   a++
  ABA59402.1    20    YKISVAPMMEWTDRHCRYFLRLISHRALLYTEmvtagalIHGNRARF 66   

                   leggadelhvvdldgalgpevlaeaieaiaeltdlpidvnggirsledae
                   l++   e++++ + g++ pe+la  ++++ ++++  +++n+g++s ++  
  ABA59402.1    67 LAYHKSEHPLALQLGGSHPEELALCAQMAEDYGFDEVNLNVGCPSNRVQS 116  

                   alleagadkviigtaalknpelvaellkafgsqvvvsvdvkiglvatdgw
                     +         g+ ++ +pelvae+++a+  +  ++v+vk+++    g 
  ABA59402.1   117 GRF---------GACLMAEPELVAECVAAMAQATQIPVTVKTRI----GI 153  

                   le..sgldavelakkaeeaGadaiiltgi.......drdgtlggp..dle
                   +e++s   +  ++  +++aG+  +i++++++  +  ++   ++ p   ++
  ABA59402.1   154 DEqdSYEALDHFISTVAQAGCRTFIIHARkawlqglSPKENREKPplRYD 203  

                   llrevaeavd.ipviasGGigsledlaaalellalGadgvlvGsallggp
                    +r +++ ++++ vi++GGi++le + + lel     dgv++G+a++++p
  ABA59402.1   204 VVRTIKQDFPqLTVIINGGITTLEEISEHLEL----LDGVMIGRAAYHNP 249  

                   eslaeakeylekmskLfePlklggltLknRvvmaPmtrylatlddgvptdlalryyaq
                                        ++ +aPm++         +td+++ry+ +
  ABA59402.1    21    ------------------KISVAPMME---------WTDRHCRYFLR 40   

                   ra.gagliiteatavspegrgypgtlgiwsdeqveglkkvtdavhaaggk
                   +    +l++te+++++++++g++  ++                +h+ +++
  ABA59402.1    41 LIsHRALLYTEMVTAGALIHGNRARFLA---------------YHKSEHP 75   

                   ialQLwhagrvaspsllpggllpvaPSaipapggvfllllllelalvafv
                   +alQL ++ +                                        
  ABA59402.1    76 LALQLGGSHP---------------------------------------- 85   

                   vpraltveeikriiedfaeAArraieaGfdgveihgAhgyLldqFlsplt
                                 e++a +A++a+++Gfd v+++ ++         p+ 
  ABA59402.1    86 --------------EELALCAQMAEDYGFDEVNLNVGC---------PSN 112  

                   nkrtdeyGgslenrarfllevveavreavgdfpvgvrlspldlvggmarl
                   +++++++G++l+ +++++ e+v+a+++a   +pv+v+           r+
  ABA59402.1   113 RVQSGRFGACLMAEPELVAECVAAMAQAT-QIPVTVKT----------RI 151  

                   gl....tledavelakaleeaGadylhvsdgdgag..........gegan
                   g+++++++e   +++  +++aG+  ++++++ ++ +    +++ + ++  
  ABA59402.1   152 GIdeqdSYEALDHFISTVAQAGCRTFIIHARKAWLqglspkenreKPPLR 201  

                   lelieaireavg.ipviasGgi.tpedaeealaagladlValGrallanp
                   +++++ i++ +++++vi++Ggi+t+e + e+l++  +d+V++Gra+++np
  ABA59402.1   202 YDVVRTIKQDFPqLTVIINGGItTLEEISEHLEL--LDGVMIGRAAYHNP 249  

                   dlvaklaeglpleiyvridfygglvagytdyptllldlanlidltllkpdltledieklidealeygfaavcvnplyvkla
                       +++a+++++t  +  + l+ i      + e+ +a   ++ ++ ++ 
  ABA59402.1    21    KISVAPMMEWTDRHCRYFLRLISHRALLYTEMVTAGALIHGNRARFL 67   

                   kdllgglkvaavvgfPlGasttedkveeakaaveagadeieinishgnl.
                   +   ++ ++a  +g    +s++e+++  a++a+++g+de+ +n+ ++   
  ABA59402.1    68 AYHKSEHPLALQLG----GSHPEELALCAQMAEDYGFDEVNLNVGCPSNr 113  

                   .........legdlelllelikaikeavg.gvvvkvilgtvll.deeeiv
                   ++     + l   +el++e ++a+ +a+ ++v+vk  +g+   ++ e + 
  ABA59402.1   114 vqsgrfgacLMAEPELVAECVAAMAQATQiPVTVKTRIGIDEQdSYEALD 163  

                   elaealieaGaDgikvsgGfggi........gatlealrliaevvke...
                   + +  +++aG     ++ +    +    +++  +++ +  +++ +k +  
  ABA59402.1   164 HFISTVAQAGCRTFIIHARKAWLqglspkenREKPPLRYDVVRTIKQdfp 213  

                   kipiiadGGIrsgedalkalaaGAdlvgvgsalaileellglleelggss
                   ++ +i+ GGI ++e++ ++l++  d+v++g+a+  ++ ll ++    + +
  ABA59402.1   214 QLTVIINGGITTLEEISEHLEL-LDGVMIGRAAYHNPYLLAQVDRNFYGD 262  

                   ilLsttllglklknPlglaaglvdkdaeailalaalgfgiielgtvtl
                                                                  +++
  ABA59402.1    21    -------------------------------------------KISV 24   

                   apmagvtdprlrrl.....gagllnreglnndgleaalkllrralkagkp
                   apm+++td+++r++   + + +ll++e++++ +l+++ +   r+l+++k+
  ABA59402.1    25 APMMEWTDRHCRYFlrlisHRALLYTEMVTAGALIHGNR--ARFLAYHKS 72   

                   glpvgvnlggnrpedlaeaarlleeagadailelnlgcp.....ntlggs
                   ++p++++lgg+ pe+la +a+++e++g+d++ +ln+gcp + +++  +g+
  ABA59402.1    73 EHPLALQLGGSHPEELALCAQMAEDYGFDEV-NLNVGCPsnrvqSGRFGA 121  

                   allkdpelllelleavkeavdvpvivKispgvgiedied....iakalve
                   +l+ +pel++e+++a+ +a+++pv+vK+++g++++d +++ ++++  +++
  ABA59402.1   122 CLMAEPELVAECVAAMAQATQIPVTVKTRIGIDEQDSYEaldhFISTVAQ 171  

                   aGadaivvsnt...thggrqldiegvdlivaqgpeagglsGnalapaale
                   aG+  ++++++++ + g ++ +                  ++  +p+ ++
  ABA59402.1   172 AGCRTFIIHARkawLQGLSPKE------------------NREKPPLRYD 203  

                   liaeiadavkgdipviadGGIrsgedaakalalGAdaVmiGraflytgpa
                   +++ i++ ++ ++ vi++GGI++ e + ++l+l  d+VmiGra++ ++p+
  ABA59402.1   204 VVRTIKQDFP-QLTVIINGGITTLEEISEHLEL-LDGVMIGRAAY-HNPY 250  

                   lveeilk..elrlamallgigsleelvgsl..kllDlstellglklknPiglApmgvskdaeaiaalaagglGiielgtvtl
                                                                  +++
  ABA59402.1    22    --------------------------------------------ISV 24   

                   apqegvtdprvrrl.....gaglinleglnnrglealllelakaagikgl
                   ap++++td+++r++   +  ++l+++e++++ +l+++ + +  a++ +++
  ABA59402.1    25 APMMEWTDRHCRYFlrlisHRALLYTEMVTAGALIHGNRARFLAYHKSEH 74   

                   plgvniggsgpeelaeaakllvrlleagadaielnigcp.....ntggga
                   pl++++ggs peela +a+++   +++g+d ++ln+gcp + ++++++ga
  ABA59402.1    75 PLALQLGGSHPEELALCAQMA---EDYGFDEVNLNVGCPsnrvqSGRFGA 121  

                   allldpelllelikalreavgipvivKirpgidtaedve....iakalee
                   +l+ +pel++e+++a+ +a+ ipv+vK+r+gid+++ +e+ ++++  +++
  ABA59402.1   122 CLMAEPELVAECVAAMAQATQIPVTVKTRIGIDEQDSYEaldhFISTVAQ 171  

                   aGladaiivsnrtggtlaadigpgsllttrlvehgglsgda...lpplal
                   aG +  +i+++r ++                  ++gls++ + + ppl +
  ABA59402.1   172 AG-CRTFIIHARKAW------------------LQGLSPKEnreKPPLRY 202  

                   ellaevaeavgdipviadGGIrsgedaakalalGAdaVmiGraflyggpa
                   ++++ +++ +++++vi++GGI++ e++ ++l+l  d+VmiGra++ ++p+
  ABA59402.1   203 DVVRTIKQDFPQLTVIINGGITTLEEISEHLEL-LDGVMIGRAAY-HNPY 250  

                   lleeikkellaamallgvkslselvgl..lklllelaklidltllnplatlediealceeaiklgfaavcvnpvfvrlale
                      ++a+++++t  +  + l  i   +    ++ +a+ +++  + r+++ 
  ABA59402.1    23    SVAPMMEWTDRHCRYFLRLISHRALLYTEMVTAGALIHGNRARFLAY 69   

                   llkglgvivitvvgfplggstlevkaeeaeaaveaGadeidlvincgalk
                   +  ++++ + +  +      ++e++a  a++a+++G+de++l+++c+   
  ABA59402.1    70 HKSEHPLALQLGGS------HPEELALCAQMAEDYGFDEVNLNVGCPSNR 113  

                   ag..........dpelvlelikavreavg.gvpvkviletgll.tveeiv
                   ++     +  +++pelv+e ++a+ +a+ ++v+vk  +  ++ ++ e + 
  ABA59402.1   114 VQsgrfgaclmaEPELVAECVAAMAQATQiPVTVKTRIGIDEQdSYEALD 163  

                   eaaraaveaGadfiktst.....gggsggatlevlaliveavgg......
                   +++  +++aG+   +++  ++   g+s+  + e  +l +++v+ ++++  
  ABA59402.1   164 HFISTVAQAGCRTFIIHArkawlQGLSPKENREKPPLRYDVVRTikqdfp 213  

                   kipviaaGGirtaedalkalaaGAdavgvgsalaileleeklriaklllallidhtllgppatseeireliaeaaklvkgfaav
                      ++++lr +  +++l+++++++g+ +++++ r l+    ++       
  ABA59402.1    35    CRYFLRLISHRALLYTEMVTAGALIHGNRARFLAYHKSEH------- 74   

                   cvypgdvglaaellkgagllevkiatvigfplGgslldvkvaeaeaavea
                                             + +++lGgs++++++  a++a ++
  ABA59402.1    75 --------------------------PLALQLGGSHPEELALCAQMAEDY 98   

                   Gadeidlvinl..........gallsgdpeevleeiravveaakdlgvpv
                   G+de++l++++  + ++    ga+l+ +pe+v+e+++a+ +a+ + +v+v
  ABA59402.1    99 GFDEVNLNVGCpsnrvqsgrfGACLMAEPELVAECVAAMAQAT-QIPVTV 147  

                   kviletglltdveflveaaraaaeaGAdfikvsd......Ggtvg..gat
                   k  +  +  +++e l +    +a+aG+    ++  ++  +G+++ ++   
  ABA59402.1   148 KTRIGIDEQDSYEALDHFISTVAQAGCRTFIIHArkawlqGLSPKenREK 197  

                   peavallvealrevavgvkipvhasGGirtdedaakalalaaveaGadqv
                   p+ ++++v+++++  + +++ v+++GGi t+e++ + l+l          
  ABA59402.1   198 PPLRYDVVRTIKQ--DFPQLTVIINGGITTLEEISEHLEL---------- 235  

                   gadavgiGtsagnapleelvaalllldlltkalllllllllgrlllknillalsllelaklidltlLkpd
                      +l  + ++all++ ++  g+l+++n +++l +++  + + l      
  ABA59402.1    38    FLRLISHRALLYTEMVTAGALIHGNRARFLAYHKSEHPLALQ----- 79   

                   ateedieklcdeAleygfaavcvnpvfvklakellkgsdvkvatvigFPl
                                                                    l
  ABA59402.1    80 -------------------------------------------------L 80   

                   GgstlevklaeaklaieaGadeidlvin..........igallggdpelv
                   Ggs++e ++ +a++a+++G de++l+++   + ++   +ga+l+ +pelv
  ABA59402.1    81 GGSHPEELALCAQMAEDYGFDEVNLNVGcpsnrvqsgrFGACLMAEPELV 130  

                   yeeikavreacg.pvvvKviletgdl.dleeiveaakaaaeaGadfikts
                   +e+++a+ +a+++pv+vK+++++++ +++e + ++   +a+aG+   +++
  ABA59402.1   131 AECVAAMAQATQiPVTVKTRIGIDEQdSYEALDHFISTVAQAGCRTFIIH 180  

                   ......tGfggg..gatlealrlilevvkd...kipviaaGGIrtgeDal
                   + ++   G++++++  +++ ++ +++++k++  ++ vi++GGI t+e++ 
  ABA59402.1   181 arkawlQGLSPKenREKPPLRYDVVRTIKQdfpQLTVIINGGITTLEEIS 230  

                   kal.aaGadriGtssllallaglelgvvlmlkriiPaldlkdgkvvlvkgvllvplvtagdpleiaklleeagad
                               l l++ ++ l+  ++ ++    g+              
  ABA59402.1    39    ---------LRLISHRALLYTEMVTAGALIHGN-------------- 62   

                   alhvvdldaplaggptileaikralkavdipvlvgggirdledae.....
                                     +a   a ++ ++p+++++g++++e+++  +++
  ABA59402.1    63 ------------------RARFLAYHKSEHPLALQLGGSHPEELAlcaqm 94   

                   ........illnaGadvvii.....gsalltdpeliaelakavgagvivv
                   ++++  +++ ln G++   ++    g+ l+ +pel+ae ++a+   + + 
  ABA59402.1    95 aedygfdeVNLNVGCPSNRVqsgrfGACLMAEPELVAECVAAM---AQAT 141  

                   dldvrlgeglaevatkggle..vtpidavelakraeelgadailltsrt.
                    ++v       +v+t+ g++++++ ++   ++ +++++g+  ++++ r +
  ABA59402.1   142 QIPV-------TVKTRIGIDeqDSYEALDHFISTVAQAGCRTFIIHARKa 184  

                   vtgtlsgpd........lellkevaeavs.ipviasGGigtpedaaklle
                     ++ls+  + ++    ++ ++ +++ ++++ vi++GGi t+e + + le
  ABA59402.1   185 WLQGLSPKEnrekpplrYDVVRTIKQDFPqLTVIINGGITTLEEISEHLE 234  

                   aGadgvivGsalfggplileeakalleelgkevrlllllstiLdkIvadkleevaalkkriipaidlkdglvvrlvqgdlal
                      ++ + t    I+ ++++ +a++k + + a+ l ++            
  ABA59402.1    49    YTEMVTAGALIHGNRARFLAYHKSEHPLALQLGGSH----------- 84   

                   iaevkkaspskgvidfdpveiak.yeeaGadalsvlt.ddgafgg.....
                                 +++++  a+++e++G+d++ + +  + +++      
  ABA59402.1    85 --------------PEELALCAQmAEDYGFDEVNLNVgCPSNRVQsgrfg 120  

                   .........slellkaireavslpvlvkggir.dpyqveealaaGadavl
                   +  +++ +  +e ++a+++a+ +pv+vk+ i +d+ + +eal++ ++ v 
  ABA59402.1   121 aclmaepelVAECVAAMAQATQIPVTVKTRIGiDEQDSYEALDHFISTVA 170  

                   lgaaalsdpelvellelakelglevlvevhtleeakralelgadligvnn
                                                          ++g++ ++++ 
  ABA59402.1   171 ---------------------------------------QAGCRTFIIHA 181  

                   rdgttggvd...........lellkelaeavpkdipviasGGisspedia
                   r   ++g + +++ ++    +++++++++ +p ++ vi++GGi+++e i 
  ABA59402.1   182 RKAWLQGLSpkenrekpplrYDVVRTIKQDFP-QLTVIINGGITTLEEIS 230  

                   elleaGadgvlvGsalmkapdplkearerkelvrelapdiplivnlggnkltedavedyvelarrlee.gadale
                      r+++++++  + pl ++lgg       +e+ + +a+++e++g+d + 
  ABA59402.1    63    RARFLAYHKSEHPLALQLGG-----SHPEELALCAQMAEDyGFDEVN 104  

                   lnvssPntpglrelqlglalgllpelllevveavkkavglpvivKlapdl
                   lnv++P      +  +g+ l + pel++e v+a+++a+ +pv vK    +
  ABA59402.1   105 LNVGCPS-NRVQSGRFGACLMAEPELVAECVAAMAQATQIPVTVKTRIGI 153  

                   teediaeiaraae....eagadgiivtNttggrlldlepllgveagglsg
                   +e+d+ e  +  + ++++ag+   i+     +r   l      +     +
  ABA59402.1   154 DEQDSYEALDHFIstvaQAGCRTFII----HARKAWL-----QGLSPKEN 194  

                   aalkplalrlvaevreavggdipiigvGGIrtgedalealaaGAsaVqvg
                   +   pl  ++v+++++ ++ ++ +i  GGI t e + e+l++  ++V++g
  ABA59402.1   195 REKPPLRYDVVRTIKQDFP-QLTVIINGGITTLEEISEHLEL-LDGVMIG 242  

                   tallyegpalvkeilkeleallalkgfsslselvglllrllelikeiaeavpiplqvgggi.............rslediellleag
                      ++++++ ++++p+ lq+gg   ++ +  ++++++++++ ++l+++++
  ABA59402.1    64    ARFLAYHKSEHPLALQLGGSHpeelalcaqmaedYGFDEVNLNVGCP 110  

                   adkvi...igsaaledpelvaelakafgkqaivvsvdvkrvdgdglvatr
                    ++v    +g++++ +pelvae+++a+  qa  ++v+vk        ++ 
  ABA59402.1   111 SNRVQsgrFGACLMAEPELVAECVAAM-AQATQIPVTVK-------TRIG 152  

                   ggleltgvdlvelakaaeeaGadailvtsi.......drdgtlsgp..dl
                   ++ ++++  l  ++  +++aG+  ++++++++  +  ++   ++ p   +
  ABA59402.1   153 IDEQDSYEALDHFISTVAQAGCRTFIIHARkawlqglSPKENREKPplRY 202  

                   ellkevaeavs.ipviasGGigsledaaellaaGadavlvGsallggpll
                   ++++ +++ ++++ vi +GGi++le + e l++  d+v++G+a++++p+l
  ABA59402.1   203 DVVRTIKQDFPqLTVIINGGITTLEEISEHLEL-LDGVMIGRAAYHNPYL 251  

                   lkeikelleelgievrllgprakaagikpigvnl.gkpgeggalaaikvseagadaidlnlgaplvd
                      +a++  ++p++++l g+++e+ al a +++++g d + ln+g+p   
  ABA59402.1    67    LAYHKSEHPLALQLgGSHPEELALCAQMAEDYGFDEVNLNVGCPS-N 112  

                   pvvdvgsistlggdpelvledlkalreavgvpvivKlvptved.......
                    v     ++ l+  pelv+e ++a+ +a+ +pv+vK+++++++++ +++ 
  ABA59402.1   113 RVQSGRFGACLMAEPELVAECVAAMAQATQIPVTVKTRIGIDEqdsyeal 162  

                   ...AkaaeeaGaDaivvsgaGGtg...........ldvgpptlealaeva
                   ++ +  +++aG+   +++    + +  +    ++++   p  +++++ ++
  ABA59402.1   163 dhfISTVAQAGCRTFIIHA---RKawlqglspkenREKPPLRYDVVRTIK 209  

                   ealgelglrgripviadGGirtgedaakalalGAdaVmvGraflgapeag
                   + ++      ++ vi +GGi t e + + l+l  d+Vm+Gra++ +p + 
  ABA59402.1   210 QDFP------QLTVIINGGITTLEEISEHLEL-LDGVMIGRAAYHNPYLL 252  

                   gpegvknllealleelrlimallGvrslaelrgsdlllrllllklldlsg
                   ++                                                
  ABA59402.1   253 AQ------------------------------------------------ 254  

                   llllllllldllllllleldllkgklivsvqlaldsplrdtvdlaeaAkaaaeaGadgiringgep
                       ++k ++++ +ql +++p    + la  A++a+++G+d + +n+g+p
  ABA59402.1    68    AYHKSEHPLALQLGGSHP----EELALCAQMAEDYGFDEVNLNVGCP 110  

                   ikkvkkavdlpvvgiilrdlpdspviidptleevdalleagadvvaldat
                     +v +         ++ +                             a 
  ABA59402.1   111 SNRVQS---------GRFG-----------------------------AC 122  

                   alprpelveelvelvkkaltlgllvladva.....tvee....Akraeea
                   ++  pelv+e+v+++  a    ++v   +++++++++e+ ++ +  +++a
  ABA59402.1   123 LMAEPELVAECVAAMAQATQIPVTVKTRIGideqdSYEAldhfISTVAQA 172  

                   Gadaigv....gvhggtdvtkdgglggpdlellkevveav.dipviaeGg
                   G+   ++++ + +  g + + +       ++ ++ +++ +  + vi +Gg
  ABA59402.1   173 GCRTFIIharkAWLQGLSPKENREKPPLRYDVVRTIKQDFpQLTVIINGG 222  

                   IntpedakkalalGadavmvGsailgnpeileaakellekvrdrvpvyatlgggdpeelaelaeealeaagfraiKlkvgap....
                       ++ + p++ +lgg  peela  a+ a  ++gf+ + l+vg+p + +
  ABA59402.1    69    YHKSEHPLALQLGGSHPEELALCAQMAE-DYGFDEVNLNVGCPsnrv 114  

                   ...........dleldlerveavreavgpdvrlrvDanggwdleeairla
                   +     +  ++++el++e v+a+ +a   +++++v  + g d ++  + +
  ABA59402.1   115 qsgrfgaclmaEPELVAECVAAMAQAT--QIPVTVKTRIGIDEQDSYEAL 162  

                   kal....eeygllwi..................EePlpaddleglaelre
                   ++++ +++++g   +++++ ++  +    +++ E P     ++  + +++
  ABA59402.1   163 DHFistvAQAGCRTFiiharkawlqglspkenrEKPPL--RYDVVRTIKQ 210  

                   alg.ipiaadEsltsledlrrlleagavdiiqiklaklGgltealkiaal
                    ++++ ++ +  +t+le++ +   ++ +d+++i++a   ++   + +a++
  ABA59402.1   211 DFPqLTVIINGGITTLEEISEH--LELLDGVMIGRAAYHNP---YLLAQV 255  

                   Aeaaglpvvphsalesgiglaaalhlaaalpnlliledldtpllladdlf
                    + +  ++ p      +i  a++  +a    +l+ +++l ++  ++  lf
  ABA59402.1   256 DRNFYGDFHPFLTR-HEIIEAFLPYVA---EQLVQGVYLNHMTRHILGLF 301  

                   kgpleiedglllvp...dgPGlGveldedllekyrvekmkisplivalDfpdleealeladalge.gvdvikvgtplvla....
                       ++ +pl ++l+    ee+   a++++++g d + ++++++   ++ 
  ABA59402.1    70    HKSEHPLALQLGGSHPEELALCAQMAEDyGFDEVNLNVGCPSNrvqs 116  

                   ..fgp..........evvkalrkapglpvildlKladign....tveaaa
                     fg   +++ + ++e v+a+++a+ +pv + +++++  ++ ++  ++++
  ABA59402.1   117 grFGAclmaepelvaECVAAMAQATQIPVTVKTRIGIDEQdsyeALDHFI 166  

                   eaaaeaGadaitvhgyagsdtlkelleaakelglgvlvllspstegllel
                     +a+aG+  +++h++                  ++l+ lsp ++     
  ABA59402.1   167 STVAQAGCRTFIIHARK-----------------AWLQGLSPKEN----- 194  

                   llelvllvaylavelgvdgvvvgat.nlellkeirellgdvplivdgGir
                                       +  ++ ++++++ i++ ++++ +i++gGi 
  ABA59402.1   195 --------------------REKPPlRYDVVRTIKQDFPQLTVIINGGIT 224  

                   tpgdaaealeagadgvvvGraitkaedpaeaaeaireaikayrdaelaal
                   t +     +    dgv++Gra ++++ +++ ++                 
  ABA59402.1   225 TLEE-ISEHLELLDGVMIGRAAYHNPYLLAQVD----------------- 256  

                   lskgllaaasglliiimllkriylildvdiedllelaeaaleaGadaiqlrvkdpspe...
                       +  ++   ++ ++ +e+l+  a++a+++G+d + l+v +ps +++ 
  ABA59402.1    70    HKSEHPLALQLGGSHPEELALCAQMAEDYGFDEVNLNVGCPSNRvqs 116  

                   .........gllelaeaikelakkvdvplivndg...............v
                       +  +++ + +ae ++++a++  +p++v+ ++ +++++ +++ ++ +
  ABA59402.1   117 grfgaclmaEPELVAECVAAMAQATQIPVTVKTRigideqdsyealdhfI 166  

                   elaleagadgvhlggpdllleaarelglgvivgvsvhtleealeaeelga
                     +++ag+  +++++    l+ +                           
  ABA59402.1   167 STVAQAGCRTFIIHARKAWLQGLSPKE----------------------- 193  

                   dyillgpvfptgtkpgfgplglellrelveav.kipviasGGi.tpenaa
                           +++      +pl ++++r +++ +  + vi+ GGi+t+e + 
  ABA59402.1   194 --------NREK-----PPLRYDVVRTIKQDFpQLTVIINGGItTLEEIS 230  

                   ealeaGadgvavgsailgapdpaeaakalleavkeyrgvrdgvpvyatlgggdpeelaeaaeelldeGftavkikvgap......
                       + + p++ +lgg  peela  a+ + d Gf+ v+++vg+p + ++ 
  ABA59402.1    70    HKSEHPLALQLGGSHPEELALCAQMAEDYGFDEVNLNVGCPsnrvqs 116  

                   .........dleldlelveavreavgpdiplrvDanggwtleeairlaka
                       +  ++++el+ e v+a+ +a   +ip++v+ + g + ++  + ++ 
  ABA59402.1   117 grfgaclmaEPELVAECVAAMAQAT--QIPVTVKTRIGIDEQDSYEALDH 164  

                   lee....agygllwi................EePlpaddleglaelreav
                   +  ++++ag++ + i++ ++  +    +++ E P     ++  + +++  
  ABA59402.1   165 FIStvaqAGCRTFIIharkawlqglspkenrEKPPL--RYDVVRTIKQDF 212  

                   g.ipiaadEsvtsledlkelleagaadavqiklakiGgltealkiaalAe
                   +++ ++ ++++t+le++ e   +  +d+v+i++a   +++ + ++     
  ABA59402.1   213 PqLTVIINGGITTLEEISEH--LELLDGVMIGRAAYHNPYLLAQV----- 255  

                   aaglpvvvhsslesgiglaaalhlaaalpnilileldtpllladdlftgp
                    +++   +h  l +   ++ a     a + +  + l ++  ++ +lf g 
  ABA59402.1   256 DRNFYGDFHPFL-TRHEIIEAFLPYVAEQLVQGVYLNHMTRHILGLFQGQ 304  

                   lviedgyllvp...dgPGlGveldeelapggplgvnlggaqdaepgveeaaraaeeagadalelnvdlpqlgs
                      +  + pl+++lgg++++e++  ++a++ae+ g+d + lnv++p    
  ABA59402.1    70    HKSEHPLALQLGGSHPEELA--LCAQMAEDYGFDEVNLNVGCPSNRV 114  

                   reld.......rprlllellealreavgvpvivKlvggvltved......
                   +++   +  +++p+l+ e ++a+++a+ +pv+vK + g++  + +++ ++
  ABA59402.1   115 QSGRfgaclmaEPELVAECVAAMAQATQIPVTVKTRIGIDEQDSyealdh 164  

                   .aralleaGadaivvsgggggghidvetlravgaattggllgvgvptlal
                    +  +++aG+   +++ + +                ++ + +   p+l+ 
  ABA59402.1   165 fISTVAQAGCRTFIIHARKA------------WLQGLSPKENREKPPLRY 202  

                   ..laevrealgdipviadGGirtgedaakalalGAdaVlvgrallyalea
                   ++++ +++ +++++vi+ GGi t e + + l+l  d+V++gra++     
  ABA59402.1   203 dvVRTIKQDFPQLTVIINGGITTLEEISEHLEL-LDGVMIGRAAYH---- 247  

                   ggegvpkllealleelrlamallGarsleelrgrlllllkkglivaltlgdpdkedlvelakaleeaGadaieldgsf.......
                       k ++++al+lg++ +e+l+ +a+++e++G+d++ l++++  + ++ 
  ABA59402.1    70    HKSEHPLALQLGGSHPEELALCAQMAEDYGFDEVNLNVGCpsnrvqs 116  

                   .......gvtvenvlelvkavke.vdvpvvlkgginpilrigvdgvlipd
                       +  + ++e+v+e+v+a+++++++pv++k       rig+d      
  ABA59402.1   117 grfgaclMAEPELVAECVAAMAQaTQIPVTVK------TRIGIDEQDS-- 158  

                   lpveepeefaeaaaeagadiivlhapttgdlrlikeaggfayvvlnpgts
                     +e  ++f+  +a+ag++ +++ha                        +
  ABA59402.1   159 --YEALDHFISTVAQAGCRTFIIHA------------------------R 182  

                   vagvtgarpvlglvdlvlaaavaeglsglliiyleadgtpvdlelvkevk
                   +a++ g+ p+ +++ +                       p ++++v+ +k
  ABA59402.1   183 KAWLQGLSPKENREKP-----------------------PLRYDVVRTIK 209  

                   kavpdipvivgGGIsspedakellegAdgvvvGsaiykgpdilkeikel<
                   + +p++ vi++GGI+++e++ e+le  dgv++G+a+y++p++l+++++  
  ABA59402.1   210 QDFPQLTVIINGGITTLEEISEHLELLDGVMIGRAAYHNPYLLAQVDR-  257  

                   -*
                     
  ABA59402.1     -    -    

0039992: domain 1 of 1, from 73 to 255: score 77.6, E = 9.4e-22
                   *->mlakriipaldlkdgrvvrlivglnggdpedpveaakaaeeaGadai
                                       ++l ++l+g+ pe+++  a++ae++G+d++
  ABA59402.1    73    ----------------EHPLALQLGGSHPEELALCAQMAEDYGFDEV 103  

                   elndldpallgpealleviraireavgipvivgggirspedaralleaGa
                   +ln+++p+                                         +
  ABA59402.1   104 NLNVGCPSNR---------------------------------------V 114  

                   davivgsalledpellaellealgpevivvaidvkavgvpvtvkirggld
                   +   +g++l+ +pel+ae ++a+          + a ++pvtvk+r+g d
  ABA59402.1   115 QSGRFGACLMAEPELVAECVAAM----------AQATQIPVTVKTRIGID 154  

                   ltd..vdavelakaleeagadailvt.........gglgggtlggadlel
                    +d +  +  ++  +++ag+  +++++ ++  +  +    + +++  +++
  ABA59402.1   155 EQDsyEALDHFISTVAQAGCRTFIIHarkawlqglSPKENREKPPLRYDV 204  

                   vaeiaeavg.iPviasGGirspedaakalaaGAdaVlvgsallggpelvr
                   v+ i++ ++++ vi +GGi ++e++ + l++  d+V++g+a++++p+l++
  ABA59402.1   205 VRTIKQDFPqLTVIINGGITTLEEISEHLEL-LDGVMIGRAAYHNPYLLA 253  

                   eikegleeggllvrlnlmeiipaidlldgklvaevkgplpvllvgpdpedlaelaeaaeeaGa
                                         ++pl ++l+g+ pe+la  a++ae++G+
  ABA59402.1    73    -------------------EHPLALQLGGSHPEELALCAQMAEDYGF 100  

                   daievndldpikairkavdvpvivkdfiglplavggglrdpeeaeaalea
                   d + +n+++p  ++ +               + ++++++ pe+++++++a
  ABA59402.1   101 DEVNLNVGCPSNRVQSG--------------RFGACLMAEPELVAECVAA 136  

                   Gadgvvlgaaagyllgle..llaelvkaakelgpglivlvgvltleeaka
                    a++  +++++++++g+++++++e++++  +                   
  ABA59402.1   137 MAQATQIPVTVKTRIGIDeqDSYEALDHFIST------------------ 168  

                   aeeaGadaigvsnigltgtvagvgpp........dlellrevve..vgip
                   +++aG+   ++  + +   ++g +p ++ ++    ++ +r ++++ +++ 
  ABA59402.1   169 VAQAGCRTFII--HARKAWLQGLSPKenrekpplRYDVVRTIKQdfPQLT 216  

                   viadGGIrtpedaakalaaGAdgvlvGsallgapeppgeakelleqgggidpedpaelaraaeeaGadaielndgcpfdsrlld..gsgllp
                      q+gg+ pe++a +a++ae++G+d + ln+gcp + ++ +  g++l++
  ABA59402.1    79    QLGGSHPEELALCAQMAEDYGFDEVNLNVGCPSNRVQSGrfGACLMA 125  

                   dp....eiikavrkavsvpvivkgrigsdedvelalaagadgvtvgtlag
                    p+ ++e ++a+++a+ +pv+vk+rig de+                   
  ABA59402.1   126 EPelvaECVAAMAQATQIPVTVKTRIGIDEQ------------------- 156  

                   edpeelleaakelglpvivgardakealraarlgrealrtkgikllpdvv
                                                                  d++
  ABA59402.1   157 -----------------------------------------------DSY 159  

                   ttvea.araaeeaGadvigvtggdltgtkrlagagl...........elv
                   +++++ +  +++aG++ ++++++ +       g +++++ ++    +++v
  ABA59402.1   160 EALDHfISTVAQAGCRTFIIHARKAWLQ----GLSPkenrekpplryDVV 205  

                   revkeavp.ipvinfaaGGIgtpedaaaalelGAdgVlvGsaifkapdpv
                   r +k+ +p++ vi  ++GGI+t e + + lel  dgV++G+a++ +p+ +
  ABA59402.1   206 RTIKQDFPqLTVI--INGGITTLEEISEHLEL-LDGVMIGRAAYHNPYLL 252  

                   eaaralveaveagrlaylagriskrledfaeaArraieaGfdgveihaAhgyLldqFlspltNkRtDeYGGsl
                      e+ a +A++a++ Gfd v ++ +         +p   + + ++G  l
  ABA59402.1    86    EELALCAQMAEDYGFDEVNLNVG---------CPSNRVQSGRFGACL 123  

                   enrarfllevvdavreavgadpvgvRlspldlveggltledsnplellve
                      ++++ e+v+a+ +a+ + pv+v+ +         ++++ + +e l +
  ABA59402.1   124 MAEPELVAECVAAMAQAT-QIPVTVKTRI--------GIDEQDSYEALDH 164  

                   lakaleeagadgkg..vdylhvsegtyedlv..stpvpegyfldlaaair
                   ++  +++a     g    ++h    ++ +l  +    +++  +d+++ i+
  ABA59402.1   165 FISTVAQA-----GcrTFIIHARKAWLQGLSpkENREKPPLRYDVVRTIK 209  

                   kavg.ipviavggitltpedaeealeega.dlvalgRalladPdlvlkla
                   + + +++vi +ggit t+e++ e le  + d v++gRa++ +P+l +++ 
  ABA59402.1   210 QDFPqLTVIINGGIT-TLEEISEHLE--LlDGVMIGRAAYHNPYLLAQVD 256  

                   eglelneidrcifynqcllgytdyplllclvn..rellllakrledaGadailvtggpggtg.........................
                      a+++ed+G+d++ +  g  + +++     +  +++ + +++ +++++
  ABA59402.1    92    AQMAEDYGFDEVNLNVGCPSNRvqsgrfgaclmaepelvaecvaama 138  

                   ..................................................
                   +++++ +++++ + +++++ +++ ++ + +++++   + ++++ ++  + 
  ABA59402.1   139 qatqipvtvktrigideqdsyealdhfistvaqagcrtfiiharkawlqg 188  

                   ........lgvadlellrevaeav.diPviadGGIgtpedaakalelGAd
                      +++ ++++  ++++r +++    + vi++GGI t+e + + lel  d
  ABA59402.1   189 lspkenreKPPLRYDVVRTIKQDFpQLTVIINGGITTLEEISEHLEL-LD 237  

                   gVlvGsaiagaedPgemaralklaveagrlaalaglgskdrykllsGviaalvTpfddgeidldalaklidfligagvdglvvlGttGe
                                       +  +d   + +++++g++ +  v  G +G 
  ABA59402.1    93    -----------------QMAEDYGFDEVNLNVGCPSNR-VQSGRFGA 121  

                   alllsleErlelveavveavggrvpviagvga...nstreaielaklaee
                   +l+  +e ++e+v+a+++a++ +v+v++++g +++ s +    ++  +++
  ABA59402.1   122 CLMAEPELVAECVAAMAQATQIPVTVKTRIGIdeqDSYEALDHFISTVAQ 171  

                   lGadailvlppyydk.........psqegllahfkavaeavd.lPvilYn
                   +G+  ++++ +  + +    +++  + +  ++ ++++++  ++l vi   
  ABA59402.1   172 AGCRTFIIHARKAWLqglspkenrEKPPLRYDVVRTIKQDFPqLTVI--- 218  

                   iPgrtgvdlspetlarlaeeipnivgiKdasgdlgrlerllrlleltgdd
                                                 +g++ +le++ ++lel    
  ABA59402.1   219 -----------------------------INGGITTLEEISEHLELL--- 236  

                   favlsGldllllpalalGadGvisglanvlPellvelyeallagdleear
                                      dGv++g+a+++  +l++ ++  + gd+ + +
  ABA59402.1   237 -------------------DGVMIGRAAYHNPYLLAQVDRNFYGDFHPFL 267  

                   elqdlllplldllfryg..npaavKaalallgliagpvRlPllplseeel
                   + ++ ++ +l ++  + ++++ + ++ +++lgl+ g +            
  ABA59402.1   268 TRHEIIEAFLPYVAEQLvqGVYLNHMTRHILGLFQGQP------------ 305  

                   aelrellkelgllledvellleagadkvii...gsaalkdpellkelakafg.kivvsld
                      +++v+l+++++ ++v     g+ ++ +pel++e + a+ ++  +++ 
  ABA59402.1   100    FDEVNLNVGCPSNRVQSgrfGACLMAEPELVAECVAAMAqATQIPV- 145  

                   akggkvatrgwlel..tgvdavelakrleelgadeilvtsidrdgtlsgp
                       +v+tr + + +++   +  ++  ++++g+  ++++++ +  ++  p
  ABA59402.1   146 ----TVKTRIGIDEqdSYEALDHFISTVAQAGCRTFIIHARKAWLQGLSP 191  

                   .........dlellkklaeavs.ipviasGGigsledlkellelsnllet
                   +++ ++    +++++ +++ ++++ vi++GGi++le + e lel      
  ABA59402.1   192 kenrekpplRYDVVRTIKQDFPqLTVIINGGITTLEEISEHLEL------ 235  

                   gadgvlvgsallggpltleeakellkprkgliagnwkmygdpaelaeliealgaallsvltgvvlfvgpppid
                       r    + ++ +   p+ +ae ++a+ + ++ +++ v+  +g +  d
  ABA59402.1   112    NRVQSGRFGACLMAEPELVAECVAAMAQ-ATQIPVTVKTRIGIDEQD 157  

                   laavrealdipvlaknvlpnesGaftgevsvellleaGadgvilghserr
                    +++++                       ++ +++ aG++  i+++    
  ABA59402.1   158 SYEALD----------------------HFISTVAQAGCRTFIIHAR--- 182  

                   lalgepdelieaakklglkvivcvgevlearralalgadaiayepveaig
                                                                 +  g
  ABA59402.1   183 --------------------------------------------KAWLQG 188  

                   tgkganpellpevveavrallelapdvpviagGGigtgndaaaalalGad
                        n e  p   + vr++ + +p++ vi+ GGi+t + + + l+l  d
  ABA59402.1   189 LSPKENREKPPLRYDVVRTIKQDFPQLTVIINGGITTLEEISEHLEL-LD 237  

                   gVlvGsallkaedpaaaaralkqavkaarddlkavreavdlPvlvkdfi.idpyqigearaagAdavlLivadlpd
                      + ++a+++a+++Pv vk++i id+ +                   ++
  ABA59402.1   132    ECVAAMAQATQIPVTVKTRIgIDEQD-------------------SY 159  

                   eeleelleaarelgldvlvevhdleeleralalgadiigvnnrgltglev
                   e l+++++ ++++g+  ++  +  ++l+ +              ++  + 
  ABA59402.1   160 EALDHFISTVAQAGCRTFIIHARKAWLQGLS-------------PKENRE 196  

                   dldtllellklvpe...dipvvaegGIstpedvaklaagadgvlvGsalm
                    +++ +++++ ++++  +++v++ gGI t+e++ ++    dgv++G+a +
  ABA59402.1   197 KPPLRYDVVRTIKQdfpQLTVIINGGITTLEEISEHLELLDGVMIGRAAY 246  

                   raddpgeavrellglelvkevkkat.dipvivggGIstpedakealeaGAdgvvvGsaivk
                      ++ v+ +k+ +  + vi++gGI t e + e le+  dgv +G a ++
  ABA59402.1   202    YDVVRTIKQDFpQLTVIINGGITTLEEISEHLEL-LDGVMIGRAAYH 247  

                   aidgalaieelleavkelvealkeligiellkalreavg.ipvviagGGistpedaaellegAdgvvvGsaifk
                      ++ ++ +++ ++++  vi++GGi t+e + e le  dgv++G+a ++
  ABA59402.1   202    YDVVRTIKQDFPqLT-VIINGGITTLEEISEHLELLDGVMIGRAAYH 247  

                   gedplkeaieflkae