hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /home/genome/SCOP/1.73/Scop1.73.bin
Sequence file:            /home/genome/FASTA/gib_20059.fasta
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: ABA59517.1
Accession:      [none]
Description:    noce0 ABA59517.1 GIB00281CH01 "ATP synthase F1, alpha subunit"

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
0046478  P-loop containing nucleoside triphosphate hy   324.2   4.5e-102   1
0043648  P-loop containing nucleoside triphosphate hy   315.0    4.4e-94   1
0037818  P-loop containing nucleoside triphosphate hy   316.7    1.1e-91   1
0046479  P-loop containing nucleoside triphosphate hy   217.5    9.2e-62   1
0046869  P-loop containing nucleoside triphosphate hy   178.9    3.6e-54   1
0042496  P-loop containing nucleoside triphosphate hy   185.5    5.5e-54   1
0036812  C-terminal domain of alpha and beta subunits   166.6    9.8e-48   1
0043646  C-terminal domain of alpha and beta subunits   162.0      1e-46   1
0051056  P-loop containing nucleoside triphosphate hy   142.6    2.1e-46   1
0037816  C-terminal domain of alpha and beta subunits   161.7      3e-46   1
0043651  P-loop containing nucleoside triphosphate hy   158.2    8.1e-46   1
0049853  P-loop containing nucleoside triphosphate hy   132.0      7e-43   1
0046895  P-loop containing nucleoside triphosphate hy   122.5    4.7e-41   1
0040863  N-terminal domain of alpha and beta subunits   103.8    1.6e-30   1
0037817  N-terminal domain of alpha and beta subunits    87.5    5.7e-23   1
0043647  N-terminal domain of alpha and beta subunits    84.5    3.8e-22   1
0049611  P-loop containing nucleoside triphosphate hy    25.5    4.9e-07   1
0048255  P-loop containing nucleoside triphosphate hy    18.4    2.1e-05   1
0050061  P-loop containing nucleoside triphosphate hy    13.9    0.00027   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
0040863    1/1      11    96 ..     1    86 []   103.8  1.6e-30
0043647    1/1      23    97 ..     1    75 []    84.5  3.8e-22
0037817    1/1      26    97 ..     1    72 []    87.5  5.7e-23
0043651    1/1      97   378 ..     1   274 []   158.2  8.1e-46
0046478    1/1      97   384 ..     1   285 []   324.2 4.5e-102
0046479    1/1      97   379 ..     1   276 []   217.5  9.2e-62
0046869    1/1      97   382 ..     1   280 []   178.9  3.6e-54
0037818    1/1      98   384 ..     1   276 []   316.7  1.1e-91
0043648    1/1      98   384 ..     1   276 []   315.0  4.4e-94
0046895    1/1     110   395 ..     1   269 []   122.5  4.7e-41
0049853    1/1     110   379 ..     1   266 []   132.0    7e-43
0051056    1/1     110   394 ..     1   268 []   142.6  2.1e-46
0042496    1/1     113   429 ..     1   289 []   185.5  5.5e-54
0050061    1/1     129   263 ..     1   141 [.    13.9  0.00027
0048255    1/1     143   199 ..     1    64 [.    18.4  2.1e-05
0049611    1/1     146   405 ..     1   242 []    25.5  4.9e-07
0036812    1/1     385   515 ..     1   131 []   166.6  9.8e-48
0037816    1/1     385   513 ..     1   129 []   161.7    3e-46
0043646    1/1     385   517 .]     1   131 []   162.0    1e-46

Alignments of top-scoring domains:
0040863: domain 1 of 1, from 11 to 96: score 103.8, E = 1.6e-30
                   *->lelikerienldleleleevGtvlsvgdGiarvyGlenvmagellef
                       eli++rie+++ ++e+++ Gtv+s++dGi+r++Gl +vm+ge++ef
  ABA59517.1    11    SELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEF 57   

                   eggvlGlalnleednvgvvllgddlsikeGdlvkrtgrileleleevGtvlsvgdgiarveglenvmagelvefengllGlalnle
                       ++e ++ Gtv+s+ dgi+r++gl++vm+ge++ef+++++Gla+nle
  ABA59517.1    23    ADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTYGLAMNLE 69   

                   ednvgvvvlgdtsgikeGdlvkrtgkileleevGtvlsvgdGiarvyGlenvllgellefeggvlGlalnleedn
                      e ++ Gtv+s+ dGi+r++Gl +v++ge++ef+g+++Gla+nle+d+
  ABA59517.1    26    EARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTYGLAMNLERDS 72   

                   vgvvllgddesikeGdlvkrtgrilievpvglallgrvldllgepidgkgplelgepllevenlsksyggrk
                      +evpvg+allgrv+d+lg+pidg+gp+e+     ++e+++++  +r+
  ABA59517.1    97    LEVPVGEALLGRVVDALGIPIDGGGPIEAQA-TSPIEKVAPGVITRQ 142  

                   lvlepletgialddvsltikkGervglvGpsGaGKtTL.lkllagllkpd
                   +v +p++tg++ +d ++++++G+r +++G+  +GKt  +++++++  +  
  ABA59517.1   143 SVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVaIDAIIN--QKG 190  

                   sGeilvdgligerlrevlelirelelaelrrrigyvfqdpalpallrlla
                   +G  +++++ig++++ v+ ++r+le++++++++++v+  ++++a+l+++a
  ABA59517.1   191 TGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVAASASESAALQFIA 240  

                   lfpaltvaenlrfglglavlllldsatrlaqakreisalarellervglp
                   ++ ++ ++e++r+ +g++ l+++d++t++a a+r++s+l+r++++r  +p
  ABA59517.1   241 PYAGCAMGEYFRD-RGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFP 289  

                   gdlftllsrlderagnlS...............gGqrqrvaiaralasdp
                   gd+f+l+srl+er ++++++++++ ++ +++ + G++++++i+ + a+d 
  ABA59517.1   290 GDVFYLHSRLLERSARVNaehvekltegkvkgkTGSLTALPIIETQAGDV 339  

                   dllilDEptsglDpetvllralaeggtvllishdlsvvrladrlkvpvgdallgrvvdvlgepidgkgpllalerlpveltapnplerll
                      l+vpvg+allgrvvd+lg pidg+gp+ a  + p+e  ap++++r++
  ABA59517.1    97    LEVPVGEALLGRVVDALGIPIDGGGPIEAQATSPIEKVAPGVITRQS 143  

                   leeplltgirviDlllpigrGqrilifggsgvGKtvlalqlianqaklne
                   +++p++tg++ iD+++p+grGqr+li+g++++GKt++a+++i+nq+    
  ABA59517.1   144 VSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAIDAIINQK---- 189  

                   ssdedadvlvvyvliGergrevtefleelkgegalertvvvastadepal
                       +++++++yv+iG++ + v+ ++++l+++gale+t+vva+ a+e+a+
  ABA59517.1   190 ----GTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVAASASESAA 235  

                   lrllvaytaltiAeyfrdqgkdVllllDsltrlaeAlrevslllgepPgr
                   l+++++y++++++eyfrd+g d+l+++D+lt++a A+r+vslll++pPgr
  ABA59517.1   236 LQFIAPYAGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGR 285  

                   egyppdlfsllsrlleragn.........legllgg..GsiTalptvlvp
                   e++p+d+f+l+srller ++++++++++ +eg+++g++Gs+Talp+++++
  ABA59517.1   286 EAFPGDVFYLHSRLLERSARvnaehveklTEGKVKGktGSLTALPIIETQ 335  

                   gddlsdpipdntlsildgqivLsrklaekgiyPAidvllSvSrllelli<
                   ++d+s++ip+n++si+dgqi+L+++l+++gi+PAi+ +lSvSr++++++ 
  ABA59517.1   336 AGDVSAFIPTNVISITDGQIFLETDLFNAGIRPAINAGLSVSRVGGAAQ  384  

                   -*
                     
  ABA59517.1     -    -    

0046479: domain 1 of 1, from 97 to 379: score 217.5, E = 9.2e-62
                   *->lsvpvgdkllGrvldvlgepidglgpllalerlpierlappllelen
                      l+vpvg++llGrv+d+lg pidg gp+ a  + pie +ap+++++++
  ABA59517.1    97    LEVPVGEALLGRVVDALGIPIDGGGPIEAQATSPIEKVAPGVITRQS 143  

                   lskrfgtgivlidvslpigkGervglvGpnGaGKTtLlkllagllkpdsg
                   +s + +tg++ id ++p+g+G+r +++G+  +GKT ++   + ++k   g
  ABA59517.1   144 VSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAIDAIINQK-GTG 192  

                   eivvygligerprevrellglllelgvlfaaellervglvaatadeppge
                     ++y++ig+++++v+ +++ l+e      +++le +++vaa a+e ++ 
  ABA59517.1   193 IKCIYVAIGQKASSVAGVVRKLEE------HGALEHTIVVAASASESAAL 236  

                   lsggqrqrlaiAraladdqgkpvllllDEptsgldalreillllgellse
                   + ++++ ++a++++++ d+g++ l+++D++t  + a+r+++lll++++++
  ABA59517.1   237 QFIAPYAGCAMGEYFR-DRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGR 285  

                   egytvllvshdlslleraadr...............eggsitalgtvlve
                   e+++  +++ + +ller a+++++++++ ++ +++ + gs+tal++++++
  ABA59517.1   286 EAFPGDVFYLHSRLLERSARVnaehvekltegkvkgKTGSLTALPIIETQ 335  

                   ggdlsdpivelllsildgvivldrdlaekgiyPaidvllSvsrllsvpvglallgrvldvlgepidglgplllllllpivrlappllelen
                      l+vpvg+allgrv+d+lg pidg+gp+++  + pi+++ap+++++++
  ABA59517.1    97    LEVPVGEALLGRVVDALGIPIDGGGPIEAQATSPIEKVAPGVITRQS 143  

                   lsksygtgialidvsltigrGervglvGpnGaGKttL.lkllagllkpds
                   +s + +tg++ id ++++grG+r +++G+  +GKt +++++++++     
  ABA59517.1   144 VSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVaIDAIINQKGTGI 193  

                   geilvd.Gedlr...elrelrrrigyvfqdpalfpeltvlenlalgalla
                    +i+v++G++ + ++++++ +++ g +  ++++ ++++    l+++a++a
  ABA59517.1   194 KCIYVAiGQKASsvaGVVRKLEEHGALEHTIVVAASASESAALQFIAPYA 243  

                   glglaeyldelgkdLSgGqrqrvalArpvlLllDEptsgldalreilell
                   g++++ey++++g d               l+++D++t  + a+r+++ ll
  ABA59517.1   244 GCAMGEYFRDRGED--------------ALIIYDDLTKQAWAYRQVSLLL 279  

                   rellkelgytvllvthdlsladrilvl...............edGsital
                   r++++++ ++  +++ + +l++r ++++++++++ ++ +++ + Gs+tal
  ABA59517.1   280 RRPPGREAFPGDVFYLHSRLLERSARVnaehvekltegkvkgKTGSLTAL 329  

                   gtveellddlgdpitllllsildgqivlsrelaekgiyPaidvllsvsrl
                   +++e+ ++d++++i+++++si+dgqi+l+++l+++gi+Pai+  lsvsr+
  ABA59517.1   330 PIIETQAGDVSAFIPTNVISITDGQIFLETDLFNAGIRPAINAGLSVSRV 379  

                   ldlevpvgdallGrvldvlgepidgkgpllllllrpinrlapnilerrvv
                      evpvg+allGrv+d+lg pidg+gp+ +  + pi+ +ap+++ r++v
  ABA59517.1    98    EVPVGEALLGRVVDALGIPIDGGGPIEAQATSPIEKVAPGVITRQSV 144  

                   veplstgirviDlllpigrGqrilifGpsgtGKTtlalqiianaqkeggv
                    +p++tg+++iD+++p+grGqr+li+G+++tGKT +a+++i+n++  g +
  ABA59517.1   145 SQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAIDAIINQKGTGIK 194  

                   vvyvligergrevtefaeelldlgalkrtvvvaatadepallrllaaeta
                   ++yv+ig++ + v+ ++++l+++gal++t+vvaa a+e+a+l+++a++++
  ABA59517.1   195 CIYVAIGQKASSVAGVVRKLEEHGALEHTIVVAASASESAALQFIAPYAG 244  

                   ltiaeylrdsgkdvllvldsltrlalalrevslalgelpgregypgtlfs
                   ++++ey+rd+g d+l+++d+lt++a+a+r+vsl+l+++pgre++pg++f+
  ABA59517.1   245 CAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFY 294  

                   llsrlleragvvrgilgg...........gsiTalptvlvegddlsdpip
                   l+srller ++v+  + ++ ++ +++ ++gs+Talp+++++++d+s++ip
  ABA59517.1   295 LHSRLLERSARVNAEHVEkltegkvkgktGSLTALPIIETQAGDVSAFIP 344  

                   dntlsildgqivLsrklaekgiyPAidvllSvSrlldlllsvpvgdallGrvldvlgepidgkgpilaeerlpierlaplilerrlv
                      +vpvg+allGrv+d+lg pidg+gpi+a+ + pie +ap++++r++v
  ABA59517.1    98    EVPVGEALLGRVVDALGIPIDGGGPIEAQATSPIEKVAPGVITRQSV 144  

                   leplstGiralDlllpigrGqrilifGppgtGKTtlalqiianaaknggv
                    +p++tG++++D ++p+grGqr+li+G+++tGKT +a+++i+n+++ g +
  ABA59517.1   145 SQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAIDAIINQKGTGIK 194  

                   vvyvligerlrevtelleeleelgalkrtvvvaatadepalarllaaeta
                   ++yv+ig++ + v+ +++ lee+gal++t+vvaa+a+e+a+++++a++++
  ABA59517.1   195 CIYVAIGQKASSVAGVVRKLEEHGALEHTIVVAASASESAALQFIAPYAG 244  

                   ltiaeylrdsgkdvllvlDsltrlalalreislalgelpgregypptlfi
                   ++++ey+rd+g d l+++D+lt++a+a+r++sl+l+++pgre++p+++f+
  ABA59517.1   245 CAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFY 294  

                   llsrlleragvvr.....giteg......gsiTalptvlvegddlsdpip
                   l+srller ++v++++++++teg+++ ++gs+Talp+++++++d+s++ip
  ABA59517.1   295 LHSRLLERSARVNaehveKLTEGkvkgktGSLTALPIIETQAGDVSAFIP 344  

                   dnvisildgqivLsrdlaekgiyPAIdvllSvSrlldllllnvlgesidalgkilseilkllekgfltalgllerksv.erlstgik
                      +++lg++id+ g+i +++++++ek   +a+g++ r+sv ++++tg+k
  ABA59517.1   110    VDALGIPIDGGGPIEAQATSPIEK---VAPGVITRQSVsQPVQTGLK 153  

                   aLDlllgiGglprGelvlivGppGsGKTtlalqlaanlaklggkvlyidt
                    +D ++++G   rG++ li+G+  +GKT+ a++++ n+ ++g k++y+++
  ABA59517.1   154 SIDSMVPVG---RGQRELIIGDRQTGKTAVAIDAIINQKGTGIKCIYVAI 200  

                   eesldqlr..arrlgld............lddllllpaltveellalaer
                   +++++ ++ + r+l+++ + ++++++++ +++ + l++++++  +a+ e+
  ABA59517.1   201 GQKASSVAgvVRKLEEHgalehtivvaasASESAALQFIAPYAGCAMGEY 250  

                   llsggkpqlvviDslt....alrp.alllldeptgellgldvrll.sell
                   ++++g++ l++ D+lt+++ a+r+++lll+++p++e++++dv++l+s+ll
  ABA59517.1   251 FRDRGEDALIIYDDLTkqawAYRQvSLLLRRPPGREAFPGDVFYLhSRLL 300  

                   rllkrlakel...........gvtvilvshvlkegedraddvpdlagggv
                   ++ +r++ e++++ ++ +++ ++  +++ ++   +e++a+dv+++++++v
  ABA59517.1   301 ERSARVNAEHvekltegkvkgKTGSLTALPI---IETQAGDVSAFIPTNV 347  

                   leqiadvviflerdeaykgilpaigglrelrvvKnrfgptgevalffiit
                   ++ i+d++ifle d+++ gi+pai+   ++    +r+g+  +++++    
  ABA59517.1   348 IS-ITDGQIFLETDLFNAGIRPAINAGLSV----SRVGGAAQTKIIK-KL 391  

                   eeGlldklgkildlalkileksflklevlalgvlerkev.erlstGikaLD
                      +d+lg ++d+ ++i +  + ++e +a+gv+ r++v ++++tG+k +D
  ABA59517.1   110    VDALGIPIDGGGPIEAQATSPIEKVAPGVITRQSVsQPVQTGLKSID 156  

                   allgiGglprGsltliaGppGsGKTtlalqlaanlaklggkvlyistees
                    ++++G   rG++ li+G+  +GKT+ a+ ++ n++++g k++y++++++
  ABA59517.1   157 SMVPVG---RGQRELIIGDRQTGKTAVAIDAIINQKGTGIKCIYVAIGQK 203  

                   leql..rarrlgld............ldellllpaltveellalaerlls
                   ++ ++ + r+l+ + + ++++++++ ++e + l+++++++ +a+ e++++
  ABA59517.1   204 ASSVagVVRKLEEHgalehtivvaasASESAALQFIAPYAGCAMGEYFRD 253  

                   ggkpdlvviDsltala.....pslllldepgrvtqgldarllreilrllk
                   +g++ l++ D+lt  a ++ ++slll+++pgr+++++d+  ++ ++rll+
  ABA59517.1   254 RGEDALIIYDDLTKQAwayrqVSLLLRRPPGREAFPGDV--FYLHSRLLE 301  

                   rlak.................elgitvlltshvtrevedraddvpvlagg
                   r a+++++++++ ++ +++ +++++t+l ++++      +a+dv++ +++
  ABA59517.1   302 RSARvnaehvekltegkvkgkTGSLTALPIIET------QAGDVSAFIPT 345  

                   gvlehladvvlflerdeaykgirpaigvlrelrvvknrfgptgevglffi
                   +v++ ++d+++fle d+++ girpai+   ++++v               
  ABA59517.1   346 NVIS-ITDGQIFLETDLFNAGIRPAINAGLSVSRV--------------- 379  

                   iteeGlldglgepldgllpilaklfrpievlalgllerksv.erlstGikaLD
                      +d+lg p+dg +pi a++++pie++a+g++ r+sv ++++tG+k +D
  ABA59517.1   110    VDALGIPIDGGGPIEAQATSPIEKVAPGVITRQSVsQPVQTGLKSID 156  

                   lllgiGglprGelvliaGppGsGKTtlalqlaanlaaqggkvlyistees
                    ++++G   rG++ li+G+  +GKT+ a+ ++ n++++g k++y++++++
  ABA59517.1   157 SMVPVG---RGQRELIIGDRQTGKTAVAIDAIINQKGTGIKCIYVAIGQK 203  

                   leql..rarrlgld............ldrlllldaltveellalaerlls
                   +++++ + r+l+++ + ++++++++ +++ + l+++++++ +a+ e++++
  ABA59517.1   204 ASSVagVVRKLEEHgalehtivvaasASESAALQFIAPYAGCAMGEYFRD 253  

                   ggkvdlvviDsltalapal.elsllldepts..gldasllreilrllkrl
                   +g++ l+++D+lt  a+a+ ++slll++p++ ++++ ++++ ++rll+r 
  ABA59517.1   254 RGEDALIIYDDLTKQAWAYrQVSLLLRRPPGreAFPGDVFYLHSRLLERS 303  

                   akelgvtvllvshvlkeve...........dladpvpdlrgggvlehiad
                   a+        v+ +++e  ++ +++ ++   +a p+++++ g+v ++i++
  ABA59517.1   304 AR--------VNAEHVEKLtegkvkgktgsLTALPIIETQAGDVSAFIPT 345  

                   vvlllerdeiylkdgldlvggrrelrvvKnrvgpvgsvalvfeiteeGle
                   +v+++++++i+l+++l+++g+r++++ +  +v++vg++a++ +i++ G  
  ABA59517.1   346 NVISITDGQIFLETDLFNAGIRPAINAG-LSVSRVGGAAQTKIIKKLGGG 394  

                   lgepldglgplr.........papgllelenvsksygtgialidlsl
                      lg+p+dg gp+ ++++  +++ apg++++++vs + +tg + id ++
  ABA59517.1   113    LGIPIDGGGPIEaqatspiekVAPGVITRQSVSQPVQTGLKSIDSMV 159  

                   pigkGervalvGpsGaGKttL.lrliaglldpdsgeilldgvdigersre
                   p+g+G+r +++G++++GKt +++++i+++       i +++v+ig++  +
  ABA59517.1   160 PVGRGQRELIIGDRQTGKTAVaIDAIINQKGTG---IKCIYVAIGQKASS 206  

                   vtelleel.......rrviglvfqdpplfprltvaenialgaeyfrdega
                   v+ +++ l+++ + ++++++++ +++++ +++ +++ ++++ eyfrd+g+
  ABA59517.1   207 VAGVVRKLeehgaleHTIVVAASASESAALQFIAPYAGCAMGEYFRDRGE 256  

                   dvllladsllrlagalrevlgrlgrelS.gGqkqrvaiarallleragnl
                   d+l+++d+l+++a a+r+v+++l r+++ ++++++v++ +++ller++++
  ABA59517.1   257 DALIIYDDLTKQAWAYRQVSLLLRRPPGrEAFPGDVFYLHSRLLERSARV 306  

                   e..............ggGsiTalatvlveggsdpdllllDeptsalDgei
                   +++++++ ++ +++ ++Gs+Tal+++++++g d++ +++++++s++Dg+i
  ABA59517.1   307 NaehvekltegkvkgKTGSLTALPIIETQAG-DVSAFIPTNVISITDGQI 355  

                   vlslllalkrlyPaidvllSvsrvldllllkeilqaakgltvilvthdls
                   +l+  l+ ++++Pai+ +lSvsrv++++++k i++  +g+++ l+++++ 
  ABA59517.1   356 FLETDLFNAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYREL 405  

                   ealadrilvlddgkiveegtpeelpgllsllelllelenl.tklptgipaLddvlgggipkGeivllvGps
                      ++++++++ ++ ++++ + + tg++ +d + +  + +G+  l++G+ 
  ABA59517.1   129    SPIEKVAPGVITRQSVsQPVQTGLKSIDSMVP--VGRGQRELIIGDR 173  

                   GsGKTtlllqlagllapdsgeillggkvlyislee.slrrrrigmvfqel
                    +GKT  +   + + +        g k++y+   +++ +   +    +e+
  ABA59517.1   174 QTGKTAVAIDAIINQK------GTGIKCIYVAIGQkASSVAGVVRKLEEH 217  

                   gldpdltvarerviellelvgllelldrlprelkrsggqrqrvviDev.erlstgipalDellgGglppgslvliaGppGsGKTtlalqlaan
                      +v +++ tg++ +D + +  + +g++ li+G+  +GKT+ a   + n
  ABA59517.1   143    SVsQPVQTGLKSIDSMVP--VGRGQRELIIGDRQTGKTAVAIDAIIN 187  

                   aalplelgklggkvlyiselenltklytgikaLddllslgippGeivllvGpsGsGKTtlalrll
                           + + tg+k +d +++  + +G++ l++G+  +GKT  a++++
  ABA59517.1   146    -----QPVQTGLKSIDSMVP--VGRGQRELIIGDRQTGKTAVAIDAI 185  

                   agllkptggkvliiglelsaeelrerrrrigyvfqepalfpeltvlenla
                    + +k tg k++++ ++ +a +++ + r++    ++ al  ++ v+    
  ABA59517.1   186 IN-QKGTGIKCIYVAIGQKASSVAGVVRKLE---EHGALEHTIVVAASAS 231  

                   lglldrlpgeldlSgglqrqrvaiaagdpdllllDeptsalrslgndpel
                   + ++ ++++   + g   + +++++ g+  l++ D++t        ++ +
  ABA59517.1   232 ESAALQFIAP--YAGC-AMGEYFRDRGEDALIIYDDLTK-------QAWA 271  

                   raellrllkrl..kelgvtvilvthdleeae...................
                   ++++  ll+r   +e     ++  h + + + + ++++++++ ++ +++ 
  ABA59517.1   272 YRQVSLLLRRPpgREAFPGDVFYLHSRLLERsarvnaehvekltegkvkg 321  

                   ....................dladsgriavladgrivlegdlaelglrra
                   ++   ++  ++++++ ++ + + +   ++ + dg+i+le dl++ g+r+a
  ABA59517.1   322 ktgsltalpiietqagdvsaFIPT--NVISITDGQIFLETDLFNAGIRPA 369  

                   livlksrlgplgtvilvfeitdggivvldlllllllikamkkvaGslklelAqyreleafaqfgsdldeatkaqLerGerlte
                      +k++kk++G+++l+lAqyrel+afaqf+sdldeat++qLerG+r+te
  ABA59517.1   385    TKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQLERGQRVTE 431  

                   llkQkqysPlsveeqvvilyaltngllddipvekilkfekelleylksnh
                   l+kQ qysP+sv +++v+l+a+++g+ldd++v+ki++fe++l  y++s+h
  ABA59517.1   432 LMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSH 481  

                   adlleaieetkklddeleallkeaieeflksfqlikamkkvaGslklelAqyreleafaqfgsdldeatkaqLerGerlte
                      +k++kk++G+++l+lAqyrel+afaqf+sdldeat++qLerG+r+te
  ABA59517.1   385    TKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQLERGQRVTE 431  

                   llkQkqysPlsveeqvvilyaltngllddipvekilkfekelleylksnh
                   l+kQ qysP+sv +++v+l+a+++g+ldd++v+ki++fe++l  y++s+h
  ABA59517.1   432 LMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSH 481  

                   aellelieetkklddeleellkeaieeflktfikamkkvaGslklelAqyreleafaqFgsdldeatkaqLerGerlte
                      +k++kk++G+++l+lAqyrel+afaqF+sdldeat++qLerG+r+te
  ABA59517.1   385    TKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQLERGQRVTE 431  

                   lLkQkqysPlsveeqvvilyaltngllddipvekilkfekelleylksnl
                   l+kQ qysP+sv +++v+l+a+++g+ldd++v+ki++fe++l  y++s++
  ABA59517.1   432 LMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSH 481  

                   adllelieetkdldde..ellkeaieefkktfllsl