hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /home/genome/SCOP/1.73/Scop1.73.bin
Sequence file:            /home/genome/FASTA/gib_20059.fasta
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: ABA59518.1
Accession:      [none]
Description:    noce0 ABA59518.1 GIB00281CH01 "H+-transporting two-sector ATPase, delta (OSCP) .."

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
0034989  N-terminal domain of the delta subunit of th    87.3    8.3e-23   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
0034989    1/1       2   107 ..     1   105 []    87.3  8.3e-23

Alignments of top-scoring domains:
0034989: domain 1 of 1, from 2 to 107: score 87.3, E = 8.3e-23
                   *->velstvarrYAkALfelAleknsldevledlelllevlkdpklkell
                       e +t+ar+YA A+felA+ ++++d+++  l++++++++d +++ l+
  ABA59518.1     2    AEKITIARPYANAVFELAQAQKNYDQWSRVLNVFADLARDSEMQILI 48   

                   snplisaeekkellkallg.glselllnfLkllaengRllllpeileefl
                   ++p ++ e+ + l+ ++ g+ ++e  +nf+k+la+n+Rl++lpe+++ f+
  ABA59518.1    49 DDPRYTSEQLIGLFVEIGGdTVTESAKNFIKILADNRRLSVLPEVAALFE 98   

                   ellaelegi