RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 95pdb09Oct16_0000; 95pdb09Oct16_0001; 95pdb09Oct16_0002;
95pdb09Oct16_0003 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done

Query= ABA56789.1 noce0 ABA56789.1 GIB00281CH01 "SSU ribosomal protein
S6P modification protein"
         (307 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

1a9xA [c.30.1 - d.142.1 - a.92.1 - c.30.1 - d.142.1 - c.24.1] CA...    84   7e-19
1bxrA [c.30.1 - d.142.1 - a.92.1 - c.30.1 - d.142.1 - c.24.1] CA...    74   4e-16
1ce8A [c.30.1 - d.142.1 - a.92.1 - c.30.1 - d.142.1 - c.24.1] PR...    74   7e-16
3bg5B [x.x.x] PYRUVATE CARBOXYLASE                                     72   2e-15
1e4eB [c.30.1 - d.142.1] VANCOMYCIN/TEICOPLANIN A-TYPE RESISTANC...    70   6e-15
3bg5A [x.x.x] PYRUVATE CARBOXYLASE                                     68   3e-14
3e5nA [x.x.x] D-ALANINE-D-ALANINE LIGASE A                             64   4e-13
1c30A [c.30.1 - d.142.1 - a.92.1 - c.30.1 - d.142.1 - c.24.1] CA...    64   6e-13
1ehiA [c.30.1 - d.142.1] D-ALANINE:D-LACTATE LIGASE                    63   1e-12
3bg5D [x.x.x] PYRUVATE CARBOXYLASE                                     61   5e-12
1b6sB [c.30.1 - d.142.1 - b.84.2] PROTEIN (N5-CARBOXYAMINOIMIDAZ...    60   9e-12
1auvA [c.30.1 - d.142.1] SYNAPSIN IA                                   59   2e-11
1ehiB [c.30.1 - d.142.1] D-ALANINE:D-LACTATE LIGASE                    59   2e-11
2c00B [x.x.x] BIOTIN CARBOXYLASE                                       58   5e-11
1auvB [c.30.1 - d.142.1] SYNAPSIN IA                                   58   5e-11
2czgA [x.x.x] PHOSPHORIBOSYLGLYCINAMIDE FORMYL TRANSFERASE             57   5e-11
1e4eA [c.30.1 - d.142.1] VANCOMYCIN/TEICOPLANIN A-TYPE RESISTANC...    57   7e-11
3df7A [x.x.x] PUTATIVE ATP-GRASP SUPERFAMILY PROTEIN                   55   3e-10
2dzdB [x.x.x] PYRUVATE CARBOXYLASE                                     54   8e-10
1dv2A [c.30.1 - d.142.1 - b.84.2] BIOTIN CARBOXYLASE                   51   6e-09
3bg5C [x.x.x] PYRUVATE CARBOXYLASE                                     50   6e-09
2c00A [x.x.x] BIOTIN CARBOXYLASE                                       50   7e-09
1bncA [c.30.1 - d.142.1 - b.84.2] BIOTIN CARBOXYLASE                   50   7e-09
1dv1A [c.30.1 - d.142.1 - b.84.2] BIOTIN CARBOXYLASE                   50   8e-09
1auxA [c.30.1 - d.142.1] SYNAPSIN IA                                   48   4e-08
2dzdA [x.x.x] PYRUVATE CARBOXYLASE                                     47   1e-07
1dv2B [c.30.1 - d.142.1 - b.84.2] BIOTIN CARBOXYLASE                   47   1e-07
3d8tA [x.x.x] UROPORPHYRINOGEN-III SYNTHASE                            45   3e-07
1bncB [c.30.1 - d.142.1 - b.84.2] BIOTIN CARBOXYLASE                   45   3e-07
1b6sC [c.30.1 - d.142.1 - b.84.2] PROTEIN (N5-CARBOXYAMINOIMIDAZ...    45   4e-07
2dwcA [x.x.x] 433AA LONG HYPOTHETICAL                                  43   1e-06
1dosA [c.1.10] ALDOLASE CLASS II                                       43   1e-06
1dv1B [c.30.1 - d.142.1 - b.84.2] BIOTIN CARBOXYLASE                   40   7e-06
1b6sA [c.30.1 - d.142.1 - b.84.2] PROTEIN (N5-CARBOXYAMINOIMIDAZ...    40   9e-06
2cqyA [x.x.x] PROPIONYL-COA CARBOXYLASE ALPHA CHAIN,                   37   7e-05
1cqjB [d.142.1 - c.23.4] SUCCINYL-COA SYNTHETASE BETA CHAIN            35   4e-04
2czgB [x.x.x] PHOSPHORIBOSYLGLYCINAMIDE FORMYL TRANSFERASE             34   5e-04

>1a9xA [c.30.1 - d.142.1 - a.92.1 - c.30.1 - d.142.1 - c.24.1]
           CARBAMOYL PHOSPHATE SYNTHETASE (LARGE CHAIN)
          Length = 1058

 Score = 83.6 bits (205), Expect = 7e-19
 Identities = 34/225 (15%), Positives = 72/225 (32%), Gaps = 17/225 (7%)

Query: 60  AIVRGIAAGSFEQITLRLDVLHTLAEFGIPVL-NTASAIERTVDKARTSLLLRHRRVPTP 118
           A++  +   +     L L+    L EFG+ ++  TA AI++  D+ R  + ++   + T 
Sbjct: 85  AVLPTMGGQTALNCALELERQGVLEEFGVTMIGATADAIDKAEDRRRFDVAMKKIGLETA 144

Query: 119 RAWACEDLAQARHLSAQAQREKRELVLKPLFGCQGQGIIRIGKPADLEAC------EPTG 172
           R+     + +A    A A       +++P F   G G        + E            
Sbjct: 145 RSGIAHTMEEAL---AVAADVGFPCIIRPSFTMGGSGGGIAYNREEFEEICARGLDLSPT 201

Query: 173 GLYYLQEFIRPAQPNIWQDWRVFVIGHRPIAAMVRRGQGWITNVARGAQYFPAPL----E 228
               + E +   +    +  R        + ++       I             L     
Sbjct: 202 KELLIDESLIGWKEYEMEVVRDKNDNCIIVCSIENFDAMGIHTGDSITVAPAQTLTDKEY 261

Query: 229 REIGALACQATQAVAVDYGGV---DIIQTPAQGFQVLEVNSIPSW 270
           + +   +    + + V+ GG      +        V+E+N   S 
Sbjct: 262 QIMRNASMAVLREIGVETGGSNVQFAVNPKNGRLIVIEMNPRVSR 306



 Score = 57.0 bits (136), Expect = 7e-11
 Identities = 29/283 (10%), Positives = 60/283 (21%), Gaps = 31/283 (10%)

Query: 1   MLRIVIFNNSHGWHSKQLEAALAPQGVAIIRSNLAQCRIDLDSPSGLH---IPGLGGDLP 57
             RI        +       AL   G   I  N     +  D  +       P    D+ 
Sbjct: 569 PNRIGQGIEF-DYCCVHASLALREDGYETIMVNCNPETVSTDYDTSDRLYFEPVTLEDVL 627

Query: 58  DAAIVRGIAAGSFEQITLRLDVLHTLAE--FGIPVLNTASAIERTVDKARTSLLLRHRRV 115
           +   +        +        L    E      +  +  AI+R  D+ R    +   ++
Sbjct: 628 EIVRIEKPKGVIVQYGGQTPLKLARALEAAGVPVIGTSPDAIDRAEDRERFQHAVERLKL 687

Query: 116 PTPRAWACEDLAQARHLSAQAQREKRELVLKPLFGCQGQGIIRIGKPADLEACEPTGGLY 175
             P       +  A      A+     LV++                             
Sbjct: 688 KQPANATVTAIEMAVEK---AKEIGYPLVVRAAMEIVYDEADLRRYFQTAV--------L 736

Query: 176 YLQEFIRPAQPNIWQDWRVFVIGHRPIAAMVRRGQGW----ITNVARGAQYFPAPL---- 227
                          +  V  I    +  +    +      + +           L    
Sbjct: 737 LDHFLDD------AVEVDVDAICDGEMVLIGGIMEHIEQAGVHSGDSACSLPAYTLSQEI 790

Query: 228 EREIGALACQATQAVAVDYGGVDIIQTPAQGFQVLEVNSIPSW 270
           +  +     +    + V                ++EVN   + 
Sbjct: 791 QDVMRQQVQKLAFELQVRGLMNVQFAVKNNEVYLIEVNPRAAR 833


>1bxrA [c.30.1 - d.142.1 - a.92.1 - c.30.1 - d.142.1 - c.24.1]
           CARBAMOYL-PHOSPHATE SYNTHASE
          Length = 1073

 Score = 74.4 bits (181), Expect = 4e-16
 Identities = 34/225 (15%), Positives = 72/225 (32%), Gaps = 17/225 (7%)

Query: 60  AIVRGIAAGSFEQITLRLDVLHTLAEFGIPVL-NTASAIERTVDKARTSLLLRHRRVPTP 118
           A++  +   +     L L+    L EFG+ ++  TA AI++  D+ R  + ++   + T 
Sbjct: 85  AVLPTMGGQTALNCALELERQGVLEEFGVTMIGATADAIDKAEDRRRFDVAMKKIGLETA 144

Query: 119 RAWACEDLAQARHLSAQAQREKRELVLKPLFGCQGQGIIRIGKPADLEA------CEPTG 172
           R+     + +A    A A       +++P F   G G        + E            
Sbjct: 145 RSGIAHTMEEAL---AVAADVGFPCIIRPSFTMGGSGGGIAYNREEFEEICARGLDLSPT 201

Query: 173 GLYYLQEFIRPAQPNIWQDWRVFVIGHRPIAAMVRRGQGWITNVARGAQYFPAPL----E 228
               + E +   +    +  R        + ++       I             L     
Sbjct: 202 KELLIDESLIGWKEYEMEVVRDKNDNCIIVCSIENFDAMGIHTGDSITVAPAQTLTDKEY 261

Query: 229 REIGALACQATQAVAVDYGGV---DIIQTPAQGFQVLEVNSIPSW 270
           + +   +    + + V+ GG      +        V+E+N   S 
Sbjct: 262 QIMRNASMAVLREIGVETGGSNVQFAVNPKNGRLIVIEMNPRVSR 306



 Score = 68.2 bits (165), Expect = 3e-14
 Identities = 39/290 (13%), Positives = 77/290 (26%), Gaps = 30/290 (10%)

Query: 1   MLRIVIFNNSHGWHSKQLEAALAPQGVAIIRSNLAQCRIDLDSPSGLHIPGLGGDLPD-- 58
             RI        +       AL   G   I  N     +  D  +   +      L D  
Sbjct: 569 PNRIGQGIEF-DYCCVHASLALREDGYETIMVNCNPETVSTDYDTSDRLYFEPVTLEDVL 627

Query: 59  ----AAIVRGIAAGSFEQITLRLDVLHTLAEFGIPVLNTASAIERTVDKARTSLLLRHRR 114
                   +G+      Q  L+L      A     +  +  AI+R  D+ R    +   +
Sbjct: 628 EIVRIEKPKGVIVQYGGQTPLKL-ARALEAAGVPVIGTSPDAIDRAEDRERFQHAVERLK 686

Query: 115 VPTPRAWACEDLAQARHLSAQAQREKRELVLKPLFGCQGQGIIRIGKPADLEA------C 168
           +  P       +  A     +A+     LV++P +   G+ +  +   ADL         
Sbjct: 687 LKQPANATVTAIEMAV---EKAKEIGYPLVVRPSYVLGGRAMEIVYDEADLRRYFQTAVS 743

Query: 169 EPTGGLYYLQEFIRPAQPNIWQDWRVFVIGHRPIAAMVRR----GQGWITNVARGA---- 220
                   L  F+     +   +  V  I    +  +        Q  + +         
Sbjct: 744 VSNDAPVLLDHFL-----DDAVEVDVDAICDGEMVLIGGIMEHIEQAGVHSGDSACSLPA 798

Query: 221 QYFPAPLEREIGALACQATQAVAVDYGGVDIIQTPAQGFQVLEVNSIPSW 270
                 ++  +     +    + V                ++EVN   + 
Sbjct: 799 YTLSQEIQDVMRQQVQKLAFELQVRGLMNVQFAVKNNEVYLIEVNPRAAR 848


>1ce8A [c.30.1 - d.142.1 - a.92.1 - c.30.1 - d.142.1 - c.24.1]
           PROTEIN (CARBAMOYL-PHOSPHATE SYNTHASE)
          Length = 1058

 Score = 73.6 bits (179), Expect = 7e-16
 Identities = 34/225 (15%), Positives = 72/225 (32%), Gaps = 17/225 (7%)

Query: 60  AIVRGIAAGSFEQITLRLDVLHTLAEFGIPVL-NTASAIERTVDKARTSLLLRHRRVPTP 118
           A++  +   +     L L+    L EFG+ ++  TA AI++  D+ R  + ++   + T 
Sbjct: 85  AVLPTMGGQTALNCALELERQGVLEEFGVTMIGATADAIDKAEDRRRFDVAMKKIGLETA 144

Query: 119 RAWACEDLAQARHLSAQAQREKRELVLKPLFGCQGQGIIRIGKPADLEAC------EPTG 172
           R+     + +A    A A       +++P F   G G        + E            
Sbjct: 145 RSGIAHTMEEAL---AVAADVGFPCIIRPSFTMGGSGGGIAYNREEFEEICARGLDLSPT 201

Query: 173 GLYYLQEFIRPAQPNIWQDWRVFVIGHRPIAAMVRRGQGWITNVARGAQYFPAPL----E 228
               + E +   +    +  R        + ++       I             L     
Sbjct: 202 KELLIDESLIGWKEYEMEVVRDKNDNCIIVCSIENFDAMGIHTGDSITVAPAQTLTDKEY 261

Query: 229 REIGALACQATQAVAVDYGGV---DIIQTPAQGFQVLEVNSIPSW 270
           + +   +    + + V+ GG      +        V+E+N   S 
Sbjct: 262 QIMRNASMAVLREIGVETGGSNVQFAVNPKNGRLIVIEMNPRVSR 306



 Score = 62.4 bits (150), Expect = 2e-12
 Identities = 30/283 (10%), Positives = 64/283 (22%), Gaps = 31/283 (10%)

Query: 1   MLRIVIFNNSHGWHSKQLEAALAP--QGVAIIRSNLAQCRIDLDSPSGLHIPGLGGDLPD 58
             RI               A      + + +  +          S      P    D+ +
Sbjct: 569 PNRIGQGIEFDYCCVHASLALREDGYETIMVNCNPETVSTDYDTSDRLYFEPVTLEDVLE 628

Query: 59  AAIVRG---IAAGSFEQITLRLDVLHTLAEFGIPVLNTASAIERTVDKARTSLLLRHRRV 115
              +     +      Q  L+L      A     +  +  AI+R  D+ R    +   ++
Sbjct: 629 IVRIEKPKGVIVQYGGQTPLKL-ARALEAAGVPVIGTSPDAIDRAEDRERFQHAVERLKL 687

Query: 116 PTPRAWACEDLAQARHLSAQAQREKRELVLKPLFGCQGQGIIRIGKPADLEACEPTGGLY 175
             P       +  A      A+     LV++P                            
Sbjct: 688 KQPANATVTAIEMAVEK---AKEIGYPLVVRPAMEIVYDEADLRRYFQT---------AV 735

Query: 176 YLQEFIRPAQPNIWQDWRVFVIGHRPIAAMVRRGQG----WITNVARGAQYFPAPL---- 227
            L  F      +   +  V  I    +  +    +      + +           L    
Sbjct: 736 LLDHF-----LDDAVEVDVDAICDGEMVLIGGIMEHIEQAGVHSGDSACSLPAYTLSQEI 790

Query: 228 EREIGALACQATQAVAVDYGGVDIIQTPAQGFQVLEVNSIPSW 270
           +  +     +    + V                ++EVN   + 
Sbjct: 791 QDVMRQQVQKLAFELQVRGLMNVQFAVKNNEVYLIEVNPRAAR 833


>3bg5B [x.x.x] PYRUVATE CARBOXYLASE
          Length = 1074

 Score = 72.4 bits (176), Expect = 2e-15
 Identities = 27/212 (12%), Positives = 53/212 (25%), Gaps = 21/212 (9%)

Query: 65  IAAGSFEQITLRLDVLHTLAEFGIPVL-NTASAIERTVDKARTSLLLRHRRVPTPRAWA- 122
           +A  S E        LH        ++ +     E  ++  R   + +   V        
Sbjct: 29  VAIYSNED----KSSLHRYKADESYLVGSDLGPAESYLNIERIIDVAKQANVDAIHPGYG 84

Query: 123 -CEDLAQARHLSAQAQREKRELVLKPLFGCQGQGIIRIGKPADLEACEPTGGLYYLQEFI 181
              +  Q      +   E  + +   L      G     +   ++A      L  +    
Sbjct: 85  FLSENEQFA---RRCAEEGIKFIGPHLEHLDMFGDKVKARTTAIKA-----DLPVIPIDN 136

Query: 182 RPA---QPNIWQDWRVFVIGHRPIAAMVRRGQGWITNVARGAQYFPAPLEREIGALACQA 238
                 Q    +   +  +  R  +   R  +      + G       L + I   A Q 
Sbjct: 137 PKHIEVQVIGDEHGNIVHLFERDCSVQRRHQKVVEVAPSVGL---SPTLRQRICDAAIQL 193

Query: 239 TQAVAVDYGGVDIIQTPAQGFQVLEVNSIPSW 270
            + +     G          F  +EVN     
Sbjct: 194 MENIKYVNAGTVEFLVSGDEFFFIEVNPRVQV 225


>1e4eB [c.30.1 - d.142.1] VANCOMYCIN/TEICOPLANIN A-TYPE RESISTANCE
           PROTEIN
          Length = 340

 Score = 70.5 bits (171), Expect = 6e-15
 Identities = 29/297 (9%), Positives = 71/297 (23%), Gaps = 37/297 (12%)

Query: 27  VAIIRSNLAQCRIDLDSPSGLHIPGLGGDLPDAAIVR----GIAAGSFEQITLRLDVLHT 82
                +            S            +            +    +      +   
Sbjct: 51  CEKPCAEWENENCYSAVLSPDKKMHGLLVKKNHEYEINHVDVAFSALHGKSGEDGSIQGL 110

Query: 83  LAEFGIP-VLNTASAIERTVDKARTSLLLRHRRVPTPRAWACEDLAQARHLSAQAQREKR 141
               GIP V     +    +DK+ T ++ ++  + TP  W      +       A     
Sbjct: 111 FELSGIPFVGCDIQSSAICMDKSLTYIVAKNAGIATPAFWVINKDDR-----PVAATFTY 165

Query: 142 ELVLKPLFGCQGQGIIRIGKPADLEA----CEPTGGLYYLQEFIRPAQPNIWQDWRVFVI 197
            + +KP       G+ ++    +L+              +++ +      +         
Sbjct: 166 PVFVKPARSGSSFGVKKVNSADELDYAIESARQYDSKILIEQAVSG--CEVGCAVLGNSA 223

Query: 198 GHRPIAAMVRRGQ----------GWITNVARGAQYFPAPLEREIGALACQATQAV----- 242
                     R Q                       PA L  E      +  + +     
Sbjct: 224 ALVVGEVDQIRLQYGIFRIHQEVEPEKGSENAVITVPADLSAEERGRIQETVKKIYKTLG 283

Query: 243 AVDYGGVDIIQTPAQGFQVLEVNSIPSWKALQ------QTTEVNIAGALAKNLLERL 293
                 VD+         + EVN++P + +            +++   + + ++  L
Sbjct: 284 CRGLARVDMFLQDRGRIVLNEVNTLPGFTSYSRYPRMMAAAGISLPELIDRLIVLAL 340


>3bg5A [x.x.x] PYRUVATE CARBOXYLASE
          Length = 1137

 Score = 68.2 bits (165), Expect = 3e-14
 Identities = 27/228 (11%), Positives = 57/228 (25%), Gaps = 17/228 (7%)

Query: 55  DLPDAAIVRGIAAG--SFEQITLRLDVLHTLAEFGIPVL-NTASAIERTVDKARTSLLLR 111
            + D A    + A    +  ++         AE GI  +      ++   DK +      
Sbjct: 66  RIIDVAKQANVDAIHPGYGFLSENEQFARRCAEEGIKFIGPHLEHLDMFGDKVKARTTAI 125

Query: 112 HRRVPTPRAW--ACEDLAQARHLSAQAQREKRELVLKPLFGCQGQGIIRIGKPADLEA-- 167
              +P         +    A+     A+     L++K       +           ++  
Sbjct: 126 KADLPVIPGTDGPIKSYELAK---EFAEEAGFPLMIKATSRIVREESELEDAFHRAKSEA 182

Query: 168 -CEPTGGLYYLQEFIRPAQPNIWQDWRVFVIGHRPIAAMVRRGQGWITNVARG----AQY 222
                    Y++ +I    P   +   +       +    R       +        +  
Sbjct: 183 EKSFGNSEVYIERYI--DNPKHIEVQVIGDEHGNIVHLFERDCSVQRRHQKVVEVAPSVG 240

Query: 223 FPAPLEREIGALACQATQAVAVDYGGVDIIQTPAQGFQVLEVNSIPSW 270
               L + I   A Q  + +     G          F  +EVN     
Sbjct: 241 LSPTLRQRICDAAIQLMENIKYVNAGTVEFLVSGDEFFFIEVNPRVQV 288


>3e5nA [x.x.x] D-ALANINE-D-ALANINE LIGASE A
          Length = 340

 Score = 64.4 bits (156), Expect = 4e-13
 Identities = 34/219 (15%), Positives = 69/219 (31%), Gaps = 21/219 (9%)

Query: 89  PVLNTASAIERTVDKARTSLLLRHRRVPTPRAWACEDLAQ-ARHLSAQAQREKRELVLKP 147
            V +        +DK     +LR  R+        +        +     +    L +KP
Sbjct: 124 FVGSGVLGSAVAMDKDMAKRVLRDARLAVAPFVCFDRHTAAHADVDTLIAQLGLPLFVKP 183

Query: 148 LFGCQGQGIIRIGK----PADLEACEPTGGLYYLQEFIRPAQPNIWQDWRVFVIGHRPIA 203
                  G+ ++       A L           ++  +        ++    V+G+    
Sbjct: 184 ANQGSSVGVSQVRTADAFAAALALALAYDHKVLVEAAVA------GREIECAVLGNAVPH 237

Query: 204 AMVRRGQGWITNVARGAQYFPAPLEREIGALACQATQAV-AVDYGGVDIIQTPAQGFQVL 262
           A V      +  +   A    A  ++ I  +A QA QA+       VD+         + 
Sbjct: 238 ASVC--GEVVVEIVIPAD-IDAQTQQRIQQIAVQAYQALGCAGMARVDVFLCADGRIVIN 294

Query: 263 EVNSIPSWK------ALQQTTEVNIAGALAKNLLERLHS 295
           EVN++P +        L Q + ++  G + + +   L  
Sbjct: 295 EVNTLPGFTRISVYPKLWQASGLDYRGLITRLIELALER 333


>1c30A [c.30.1 - d.142.1 - a.92.1 - c.30.1 - d.142.1 - c.24.1]
           CARBAMOYL PHOSPHATE SYNTHETASE: LARGE SUBUNIT
          Length = 1058

 Score = 63.9 bits (154), Expect = 6e-13
 Identities = 36/261 (13%), Positives = 77/261 (29%), Gaps = 19/261 (7%)

Query: 24  PQGVAIIRSNLAQCRIDLDSPSGLHIPGLGGDLPDAAIVRGIAAGSFEQITLRLDVLHTL 83
           P  +           I+      +            A++  +   +     L L+    L
Sbjct: 51  PATIMTDPEMADATYIEPIHWEVVRKIIEKERPD--AVLPTMGGQTALNCALELERQGVL 108

Query: 84  AEFGIPVL-NTASAIERTVDKARTSLLLRHRRVPTPRAWACEDLAQARHLSAQAQREKRE 142
            EFG+ ++  TA AI++  D+ R  + ++   + T R+     + +A    A A      
Sbjct: 109 EEFGVTMIGATADAIDKAEDRRRFDVAMKKIGLETARSGIAHTMEEAL---AVAADVGFP 165

Query: 143 LVLKPLFGCQGQGIIRIGKPADLEAC------EPTGGLYYLQEFIRPAQPNIWQDWRVFV 196
            +++P F   G G        + E                + E +   +    +  R   
Sbjct: 166 CIIRPSFTMGGSGGGIAYNREEFEEICARGLDLSPTKELLIDESLIGWKEYEMEVVRDKN 225

Query: 197 IGHRPIAAMVRRGQGWITNVARGAQYFPAPL----EREIGALACQATQAVAVDYGGV--- 249
                + ++       I             L     + +   +    + + V+ GG    
Sbjct: 226 DNCIIVCSIENFDAMGIHTGDSITVAPAQTLTDKEYQIMRNASMAVLREIGVETGGSNVQ 285

Query: 250 DIIQTPAQGFQVLEVNSIPSW 270
             +        V+E+N   S 
Sbjct: 286 FAVNPKNGRLIVIEMNPRVSR 306



 Score = 55.1 bits (131), Expect = 3e-10
 Identities = 26/225 (11%), Positives = 58/225 (25%), Gaps = 28/225 (12%)

Query: 55  DLPDAAIVRGIAAGSFEQITLRLDVLHTLAEFGIPVL-NTASAIERTVDKARTSLLLRHR 113
           ++      +G+      Q  L+L     L   G+PV+  +  AI+R  D+ R    +   
Sbjct: 628 EIVRIEKPKGVIVQYGGQTPLKL--ARALEAAGVPVIGTSPDAIDRAEDRERFQHAVERL 685

Query: 114 RVPTPRAWACEDLAQARHLSAQAQREKRELVLKPLFGCQGQGIIRIGKPADLEACEPTGG 173
           ++  P       +  A     +A+     LV++P                          
Sbjct: 686 KLKQPANATVTAIEMAV---EKAKEIGYPLVVRPAMEIVYDEADL--------RRYFQTA 734

Query: 174 LYYLQEFIRPAQPNIWQDWRVFVIGHRPIAAMVRRGQG----WITNVARGAQYFPAPL-- 227
           +                +  V  I    +  +    +      + +           L  
Sbjct: 735 VLLDHFLDDA------VEVDVDAICDGEMVLIGGIMEHIEQAGVHSGDSACSLPAYTLSQ 788

Query: 228 --EREIGALACQATQAVAVDYGGVDIIQTPAQGFQVLEVNSIPSW 270
             +  +     +    + V                ++EVN   + 
Sbjct: 789 EIQDVMRQQVQKLAFELQVRGLMNVQFAVKNNEVYLIEVNPRAAR 833


>1ehiA [c.30.1 - d.142.1] D-ALANINE:D-LACTATE LIGASE
          Length = 360

 Score = 63.1 bits (152), Expect = 1e-12
 Identities = 24/260 (9%), Positives = 58/260 (22%), Gaps = 27/260 (10%)

Query: 62  VRGIAAGSFEQITLRLDVLHTLAEFGIP-VLNTASAIERTVDKARTSLLLRHRRVPTPRA 120
                      +     +         P V         + DKA T  LL    +   + 
Sbjct: 92  FDIFFPVVHGNLGEDGTLQGLFKLLDKPYVGAPLRGHAVSFDKALTKELLTVNGIRNTKY 151

Query: 121 WACEDLAQAR-HLSAQAQREKRELVLKPLFGCQGQGIIRIGKPADLEA----CEPTGGLY 175
              +  +                + +K        GI R+    +               
Sbjct: 152 IVVDPESANNWSWDKIVAELGNIVFVKAANQGSSVGISRVTNAEEYTEALSDSFQYDYKV 211

Query: 176 YLQEFIRPAQPNIWQDWRVF--------------VIGHRPIAAMVRRGQGWITNVARGAQ 221
            ++E +  A+                                    +         +   
Sbjct: 212 LIEEAVNGARELEVGVIGNDQPLVSEIGAHTVPNQGSGDGWYDYNNKFVDNSAVHFQIPA 271

Query: 222 YFPAPLEREIGALACQATQAV-AVDYGGVDIIQTPAQGFQVLEVNSIPSWK------ALQ 274
                + +E+  +A  A + +       +D +        + E N++P +        L 
Sbjct: 272 QLSPEVTKEVKQMALDAYKVLNLRGEARMDFLLDENNVPYLGEPNTLPGFTNMSLFKRLW 331

Query: 275 QTTEVNIAGALAKNLLERLH 294
             +++N A  +   +     
Sbjct: 332 DYSDINNAKLVDMLIDYGFE 351


>3bg5D [x.x.x] PYRUVATE CARBOXYLASE
          Length = 1067

 Score = 60.9 bits (146), Expect = 5e-12
 Identities = 23/197 (11%), Positives = 47/197 (23%), Gaps = 11/197 (5%)

Query: 77  LDVLHTLAEFGIPVL-NTASAIERTVDKARTSLLLRHRRVPTPRAW--ACEDLAQARHLS 133
              LH        ++ +     E  ++  R   + +   V           +  Q     
Sbjct: 37  KSSLHRYKADESYLVGSDLGPAESYLNIERIIDVAKQANVDAIHPGYGFLSENEQFA--- 93

Query: 134 AQAQREKRELVLKPLFGCQGQGIIRIGKPADLEACEPTGGLYYLQEFIRPAQPNIWQDWR 193
            +   E  + +   L      G     +            +          Q    +   
Sbjct: 94  RRCAEEGIKFIGPHLEHLDMFGDKVKARTT--AIKADLPVIPIDNPKHIEVQVIGDEHGN 151

Query: 194 VFVIGHRPIAAMVRRGQGWITNVARGAQYFPAPLEREIGALACQATQAVAVDYGGVDIIQ 253
           +  +  R   ++ RR Q  +      +      L + I   A Q  + +     G     
Sbjct: 152 IVHLFERDC-SVQRRHQKVVEVA--PSVGLSPTLRQRICDAAIQLMENIKYVNAGTVEFL 208

Query: 254 TPAQGFQVLEVNSIPSW 270
                F  +EVN     
Sbjct: 209 VSGDEFFFIEVNPRVQV 225


>1b6sB [c.30.1 - d.142.1 - b.84.2] PROTEIN (N5-CARBOXYAMINOIMIDAZOLE
           RIBONUCLEOTIDE
          Length = 355

 Score = 60.0 bits (144), Expect = 9e-12
 Identities = 23/214 (10%), Positives = 45/214 (21%), Gaps = 6/214 (2%)

Query: 58  DAAIVRGIAAGSFEQITLRLDVLHTLAEFGIPVLNTASAIERTVDKARTSLLLRHRRVPT 117
            A   +     +  +         T      P            D+     L     +PT
Sbjct: 37  AAVPFQQSVITAEIERWPETA--LTRELARHPAFVNRDVFPIIADRLTQKQLFDKLHLPT 94

Query: 118 PRAWACEDLAQARHLSAQAQREKRELVLKPLFGCQGQGIIRIGKPADLEA-CEPTGGLYY 176
                  + ++     A   R     ++K   G          +  + E       G   
Sbjct: 95  APWQLLAERSEWP---AVFDRLGELAIVKRRTGGYDGRGQWRLRANETEQLPAECYGECI 151

Query: 177 LQEFIRPAQPNIWQDWRVFVIGHRPIAAMVRRGQGWITNVARGAQYFPAPLEREIGALAC 236
           +++ I  +        R F              Q  I   +       A  +     +  
Sbjct: 152 VEQGINFSGEVSLVGARGFDGSTVFYPLTHNLHQDGILRTSVAFPQANAQQQARAEEMLS 211

Query: 237 QATQAVAVDYGGVDIIQTPAQGFQVLEVNSIPSW 270
              Q +              QG  + E+      
Sbjct: 212 AIMQELGYVGVMAMECFVTPQGLLINELAPRVHN 245


>1auvA [c.30.1 - d.142.1] SYNAPSIN IA
          Length = 282

 Score = 59.2 bits (142), Expect = 2e-11
 Identities = 24/199 (12%), Positives = 48/199 (24%), Gaps = 25/199 (12%)

Query: 83  LAEFGIPVLNTASAIERTVDKARTSLLLRHRRVPTPRAWACEDLAQARHLSAQAQREKRE 142
           L   GIP +N+  ++    DK      +R  +      +   +         +       
Sbjct: 92  LQYAGIPSINSLHSVYNFCDKPWVFAQVRLHKKLGTEEFPLIN-QTFYPNHKELSSTTYP 150

Query: 143 LVLKPLFGCQGQGIIRIGKPADLEACE--PTGGLYYLQEFIRPAQPNIWQDWRVFVIGHR 200
           +V+K      G+  +         A     T      + F      +   D R+  IG  
Sbjct: 151 VVVKGHAHSGGKVKVDNQHDFQDIASVVALTKTYATTEPF-----IDAKYDVRIQKIGQN 205

Query: 201 PIAAMVRRGQGWITNVARGAQYFPAPLEREIGALACQATQAV-AVDYGGVDIIQTPAQGF 259
             A                                   ++    +D   V+ +       
Sbjct: 206 YKAYRTL----------------EQIASDRYKLWVDTCSEIFGGLDICAVEALHGKDGRD 249

Query: 260 QVLEVNSIPSWKALQQTTE 278
            ++EV          Q  +
Sbjct: 250 HIIEVVGSSPLIGDHQDED 268


>1ehiB [c.30.1 - d.142.1] D-ALANINE:D-LACTATE LIGASE
          Length = 347

 Score = 58.9 bits (141), Expect = 2e-11
 Identities = 27/246 (10%), Positives = 58/246 (23%), Gaps = 19/246 (7%)

Query: 62  VRGIAAGSFEQITLRLDVLHTLAEFGIPVL-NTASAIERTVDKARTSLLLRHRRVPTPRA 120
                      +     +         P +         + DKA T  LL    +   + 
Sbjct: 93  FDIFFPVVHGNLGEDGTLQGLFKLLDKPYVGAPLRGHAVSFDKALTKELLTVNGIRNTKY 152

Query: 121 WACEDLAQAR-HLSAQAQREKRELVLKPLFGCQGQGIIRIGKPADLEA----CEPTGGLY 175
              +  +                + +K        GI R+    +               
Sbjct: 153 IVVDPESANNWSWDKIVAELGNIVFVKAANQGSSVGISRVTNAEEYTEALSDSFQYDYKV 212

Query: 176 YLQEFIRPAQPNIWQDWRVFVIGHRPIAAMVRRGQGWITNVARGAQYFPAPLEREIGALA 235
            ++E +     N  ++  V VIG+               +    AQ  P   +       
Sbjct: 213 LIEEAV-----NGARELEVGVIGNDQPLVSEI--GAHTVHFQIPAQLSPEVTKEVKQMAL 265

Query: 236 CQATQAVAVDYGGVDIIQTPAQGFQVLEVNSIPSWK------ALQQTTEVNIAGALAKNL 289
                        +D +        + E N++P +        L   +++N A  +   +
Sbjct: 266 DAYKVLNLRGEARMDFLLDENNVPYLGEPNTLPGFTNMSLFKRLWDYSDINNAKLVDMLI 325

Query: 290 LERLHS 295
                 
Sbjct: 326 DYGFED 331


>2c00B [x.x.x] BIOTIN CARBOXYLASE
          Length = 439

 Score = 57.6 bits (138), Expect = 5e-11
 Identities = 32/206 (15%), Positives = 54/206 (26%), Gaps = 21/206 (10%)

Query: 78  DVLHTLAEFGIPVLNT-ASAIERTVDKARTSLLLRHRRVPTPRAWACEDLAQARHLSAQA 136
           D    +   G   +   A  I    DK      ++   VPT                A A
Sbjct: 90  DFAEQIERSGFTFVGPTAEVIRLMGDKVSAKDAMKRAGVPTVPGSDGPLPEDEETALAIA 149

Query: 137 QREKRELVLKPLFGCQGQGIIRIGKPADLEACE----PTGGLYYLQEFIRPAQPNIWQDW 192
           +     +++K   G               +           + YL++F+        +  
Sbjct: 150 REVGYPVIIKAAGGGMRVVYDESELIKSAKLTRTEAGAGNPMVYLEKFL-----TNPRHV 204

Query: 193 RVFVIGHRPIAAMV---------RRGQGWITNVARGAQYFPAPLEREIGALACQATQAVA 243
            V V+      A+          RR Q  I      A        +E+ A   QA   + 
Sbjct: 205 EVQVLSDGQGNAIHLGDRDCSLQRRHQKVIEEA--PAPGIDEKARQEVFARCVQACIEIG 262

Query: 244 VDYGGVDIIQTPAQGFQVLEVNSIPS 269
               G          F  +E+N+   
Sbjct: 263 YRGAGTFEFLYENGRFYFIEMNTRVQ 288


>1auvB [c.30.1 - d.142.1] SYNAPSIN IA
          Length = 283

 Score = 57.6 bits (138), Expect = 5e-11
 Identities = 32/300 (10%), Positives = 69/300 (23%), Gaps = 40/300 (13%)

Query: 1   MLRIVIFNNSHGWHSKQLEAALAPQGV-AIIRSNLAQCRIDLDSPSGLHIPGLGGDLPDA 59
              +++ +  H   +K  +       +   +          +   +G             
Sbjct: 4   ARVLLVIDEPHTDWAKYFKGKKIHGEIDIKVEQAEFSDLNLVAHANGGFSVDEVLRNGVK 63

Query: 60  --------AIVRGIAAGSFEQITLRLDVLHTLAEFGIPVLNTASAIERTVDKARTSLLLR 111
                    ++    A S      R  V+      GIP +N+  ++    DK      +R
Sbjct: 64  VVRSLKPDFVLIRQHAFSARNGDYRSLVIGLQYA-GIPSINSLHSVYNFCDKPWVFAQVR 122

Query: 112 HRRVPTPRAWACEDLAQARHLSAQAQREKRELVLKPLFGCQGQGIIRIGKPADLEACE-- 169
             +      +   +     +           +V+K      G+  +         A    
Sbjct: 123 LHKKLGTEEFPLINQTFYPNHKE-LSSTTYPVVVKGHAHSGGKVKVDNQHDFQDIASVVA 181

Query: 170 PTGGLYYLQEFIRPAQPNIWQDWRVFVIGHRPIAAMVRRGQGWITNVARGAQYFPAPLER 229
            T      + FI         D R+  IG    A                          
Sbjct: 182 LTKTYATTEPFIDA-----KYDVRIQKIGQNYKAYR-----------------LEQIASD 219

Query: 230 EIGALACQATQAV-AVDYGGVDIIQTPAQGFQVLEVNSIPSWKALQQTTE----VNIAGA 284
                    ++    +D   V+ +        ++EV          Q  +    V +   
Sbjct: 220 RYKLWVDTCSEIFGGLDICAVEALHGKDGRDHIIEVVGSSPLIGDHQDEDKQLIVELVVN 279


>2czgA [x.x.x] PHOSPHORIBOSYLGLYCINAMIDE FORMYL TRANSFERASE
          Length = 405

 Score = 57.4 bits (137), Expect = 5e-11
 Identities = 35/299 (11%), Positives = 77/299 (25%), Gaps = 25/299 (8%)

Query: 3   RIVIFNNSHGWHSKQLEAALAPQG--VAIIRSNLAQCRIDLDSPSGLHIPGLGGDLPDAA 60
           +I++  +  G   K++       G  V  +        + +   S +        L    
Sbjct: 20  KILLLGS--GELGKEIAIEAQRLGVEVVAVDRYANAPAMQVAHRSYVGNMMDKDFLWSVV 77

Query: 61  IVRGIAAGSFEQITLRLDVLHTLAEFGIP-VLNTASAIERTVDKARTSLLLRHRRVPTPR 119
                 A   E   + LD L    + G   V N  +       +     L++  +VPT R
Sbjct: 78  EREKPDAIIPEIEAINLDALFEFEKDGYFVVPNARATWIAMHRERLRETLVKEAKVPTSR 137

Query: 120 AWACEDLAQARHLSAQAQREKRELVLKPLFGCQGQGIIRIGKPADLEACEPTGGLYYLQE 179
                 L +        ++       K +     +G                     ++E
Sbjct: 138 YMYATTLDELYEA---CEKIGYPCHTKAIMSYFVKGPED---------IPKAWEKIIVEE 185

Query: 180 FIRPAQPNIWQDWRVFVIGHRPIAAMVRRGQGWITNVARGAQYFPAPLEREIGALACQAT 239
            I           R F      +    +    +  +    A + PA +  +      +  
Sbjct: 186 HIDFDVEVTELAVRHFDENGEIVTTFPKPVGHYQIDGDYHASWQPAEISEKAEREVYRIA 245

Query: 240 QAVA--VDYGGVDIIQTP--AQGFQVLEVNSIPS----WKALQQTTEVNIAGALAKNLL 290
           + +   +   G+  ++           EV+  P               +      + +L
Sbjct: 246 KRITDVLGGLGIFGVEMFVKGDKVWANEVSPRPHDTGMVTLASHPPGFSEFALHLRAVL 304


>1e4eA [c.30.1 - d.142.1] VANCOMYCIN/TEICOPLANIN A-TYPE RESISTANCE
           PROTEIN
          Length = 341

 Score = 57.0 bits (136), Expect = 7e-11
 Identities = 32/261 (12%), Positives = 74/261 (28%), Gaps = 34/261 (13%)

Query: 57  PDAAIVRGIAAGSFEQITLRLDVLHTLAEFGIP-VLNTASAIERTVDKARTSLLLRHRRV 115
            D A           +      +       GIP V     +    +DK+ T ++ ++  +
Sbjct: 90  VDVAFSALHG-----KSGEDGSIQGLFELSGIPFVGCDIQSSAICMDKSLTYIVAKNAGI 144

Query: 116 PTPRAWACEDLAQARHLSAQAQREKRELVLKPLFGCQGQGIIRIGKPADLEA----CEPT 171
            TP  W      +       A      + +KP       G+ ++    +L+         
Sbjct: 145 ATPAFWVINKDDRP-----VAATFTYPVFVKPARSGSSFGVKKVNSADELDYAIESARQY 199

Query: 172 GGLYYLQEFI--RPAQPNIWQDWRVFVIGHRPI----AAMVRRGQG--WITNVARGAQYF 223
                +++ +        +  +    V+G          + R  Q               
Sbjct: 200 DSKILIEQAVSGCEVGCAVLGNSAALVVGEVDQIRLQYGIFRIHQEVEPEKGSENAVITV 259

Query: 224 PAPLEREIGALACQATQAVA-----VDYGGVDIIQTPAQGFQVLEVNSIPSWK------A 272
           PA L  E      +  + +           VD+         + EVN++P +        
Sbjct: 260 PADLSAEERGRIQETVKKIYKTLGCRGLARVDMFLQDNGRIVLNEVNTLPGFTSYSRYPR 319

Query: 273 LQQTTEVNIAGALAKNLLERL 293
           +     +++   + + ++  L
Sbjct: 320 MMAAAGISLPELIDRLIVLAL 340


>3df7A [x.x.x] PUTATIVE ATP-GRASP SUPERFAMILY PROTEIN
          Length = 297

 Score = 54.8 bits (131), Expect = 3e-10
 Identities = 48/307 (15%), Positives = 96/307 (31%), Gaps = 56/307 (18%)

Query: 3   RIVIFNNSHGWHSKQLEAALAPQGVAIIRSNLAQCRI-DLDSPSGLHIPGLGGDLPDAAI 61
           ++ +F        +++E + A +G+A   +        ++          L   LP  + 
Sbjct: 3   KLFLFEF--ATCGERIEDSTAVEGLAFKSAFDGFKNYYEITGFVRPEFSCLF-TLPVDSD 59

Query: 62  VR-------GIAAGSFEQITLRLDVLHTLAEFGIPVLNTASAIERTVDKARTSLLLRHRR 114
                         + E   L   +     ++   + +++ AI  T DK      LR   
Sbjct: 60  SEKYLEKSDAFLIIAPEDDFLLYTLTKKAEKYCENLGSSSRAIAVTSDKWELYKKLRGEV 119

Query: 115 VPTPRAWACEDLAQARHLSAQAQREKRELVLKPLFGCQGQGIIRIGKPADLEACEPTGGL 174
              P+                 +    + ++KP   C G                     
Sbjct: 120 -QVPQTS--------------LRPLDCKFIIKPRTACIGFSDEVPDG------------- 151

Query: 175 YYLQEFIRPAQPNIWQDWRVFVIGHRPIAAMVRRGQGWITNVARGAQYFPAP----LERE 230
           +  QEFI         +  V +     +  +    +  I N        PA     ++RE
Sbjct: 152 HIAQEFIE------GINLSVSLAVGEDVKCLS-VNEQIINNFRYAGAVVPARISDEVKRE 204

Query: 231 IGALACQATQAVA--VDYGGVDIIQTPAQGFQVLEVNSIP--SWKALQQTTEVNIAGALA 286
           +   A +A + V     Y GVDI+ +      V+E+N+       A  +    ++A  LA
Sbjct: 205 VVEEAVRAVECVEGLNGYVGVDIVYS--DQPYVIEINARLTTPVVAFSRAYGASVADLLA 262

Query: 287 KNLLERL 293
              ++ +
Sbjct: 263 GGEVKHV 269


>2dzdB [x.x.x] PYRUVATE CARBOXYLASE
          Length = 453

 Score = 53.6 bits (127), Expect = 8e-10
 Identities = 26/195 (13%), Positives = 59/195 (30%), Gaps = 21/195 (10%)

Query: 88  IPVLNTASAIERTVDKARTSLLLRHRRVPTPRA--WACEDLAQARHLSAQAQREKRELVL 145
           I +    + ++   DK +      +  +P         + L       A A+     +++
Sbjct: 104 IFIGPNENHLDMFGDKVKARHAAVNAGIPVIPGSDGPVDGLEDVV---AFAEAHGYPIII 160

Query: 146 KPLFGCQGQGIIRIGKPADL----EACEPTGGLYYLQEFIRPAQPNIWQDWRVFVIGHRP 201
           K   G  G+G+  +   +++    E  +      Y+++          +   V ++G   
Sbjct: 161 KAALGGGGRGMRIVRSKSEVKEAFERAKSEAKEVYVEKL-----IENPKHIEVQILGDYE 215

Query: 202 ---IAAMVRRGQGWITNVARGAQYFPAPLEREIGALACQA--TQAVAVDYGGVDIIQ--T 254
              +    R       +           L  E+    C+A      +V Y     ++   
Sbjct: 216 GNIVHLYERDCSVQRRHQKVVEVAPSVSLSDELRQRICEAAVQLMRSVGYVNAGTVEFLV 275

Query: 255 PAQGFQVLEVNSIPS 269
               F  +EVN    
Sbjct: 276 SGDEFYFIEVNPRIQ 290


>1dv2A [c.30.1 - d.142.1 - b.84.2] BIOTIN CARBOXYLASE
          Length = 450

 Score = 50.7 bits (120), Expect = 6e-09
 Identities = 30/232 (12%), Positives = 67/232 (28%), Gaps = 25/232 (10%)

Query: 58  DAAIVRGIAAGSFEQITLRLDVLHT--LAEFGIPVLNT-ASAIERTVDKARTSLLLRHRR 114
            AA + G  A       L  +      +   G   +   A  I    DK      ++   
Sbjct: 71  SAAEITGAVAIHPGYGFLSENANFAEQVERSGFIFIGPKAETIRLMGDKVSAIAAMKKAG 130

Query: 115 VPTPRAWACEDLAQARHLSAQAQREKRELVLKPLFGCQGQGIIRIGKPADL-EACEP--- 170
           VP                 A A+R    +++K   G  G+G+  +   A+L ++      
Sbjct: 131 VPCVPGSDGPLGDDMDKNRAIAKRIGYPVIIKASGGGGGRGMRVVRGDAELAQSISMTRA 190

Query: 171 ------TGGLYYLQEFIRPAQPNIWQDWRVFVIGHR---PIAAMVRRGQGWITNVARGAQ 221
                 +  + Y+++++        +   + V+       I    R       +     +
Sbjct: 191 EAKAAFSNDMVYMEKYL-----ENPRHVEIQVLADGQGNAIYLAERDCSMQRRHQKVVEE 245

Query: 222 YFPAPLEREIGALACQATQAV--AVDYGGVDIIQ--TPAQGFQVLEVNSIPS 269
                +  E+     +        + Y G    +       F  +++N+   
Sbjct: 246 APAPGITPELRRYIGERCAKACVDIGYRGAGTFEFLFENGEFYFIKMNTRIQ 297


>3bg5C [x.x.x] PYRUVATE CARBOXYLASE
          Length = 1067

 Score = 50.5 bits (119), Expect = 6e-09
 Identities = 32/218 (14%), Positives = 62/218 (28%), Gaps = 24/218 (11%)

Query: 70  FEQITLRLDVLHTLAEFGIPVL-NTASAIERTVDKARTSLLLRHRRVPTPRAWACEDLAQ 128
           +  ++         AE GI  +      ++   DK +         +P            
Sbjct: 83  YGFLSENEQFARRCAEEGIKFIGPHLEHLDMFGDKVKARTTAIKADLPVIPGTDGPI-KS 141

Query: 129 ARHLSAQAQREKRELVLKPLFGCQGQGIIRIGKPADLEAC----------EPTGGLYYLQ 178
                  A+     L++K   G  G+G+  + + ++LE                   Y++
Sbjct: 142 YELAKEFAEEAGFPLMIKATSGGGGKGMRIVREESELEDAFHRAKSEAEKSFGNSEVYIE 201

Query: 179 EFIRPAQPNIWQDWRVFVIGHRPIAAMVR--RGQGWITNVARGAQYFPAP-----LEREI 231
            +I     +  +   V VIG      +    R         +  +  P+      L + I
Sbjct: 202 RYI-----DNPKHIEVQVIGDEHGNIVHLFERDCSVQRRHQKVVEVAPSVGLSPTLRQRI 256

Query: 232 GALACQATQAVAVDYGGVDIIQTPAQGFQVLEVNSIPS 269
              A Q  + +     G          F  +EVN    
Sbjct: 257 CDAAIQLMENIKYVNAGTVEFLVSGDEFFFIEVNPRVQ 294


>2c00A [x.x.x] BIOTIN CARBOXYLASE
          Length = 440

 Score = 50.5 bits (119), Expect = 7e-09
 Identities = 29/189 (15%), Positives = 54/189 (28%), Gaps = 13/189 (6%)

Query: 92  NTASAIERTVDKARTSLLLRHRRVPTPRAWACEDLAQARHLSAQAQREKRELVLKPLFGC 151
            TA  I    DK      ++   VPT                A A+     +++K   G 
Sbjct: 105 PTAEVIRLMGDKVSAKDAMKRAGVPTVPGSDGPLPEDEETALAIAREVGYPVIIKAAGGR 164

Query: 152 QGQGIIRIGKPADLEAC-----EPTGGLYYLQEFIRPAQPNIWQDWRVFVIGHRPIAAMV 206
             + +    +                 + YL++F+   +     + +V   G      + 
Sbjct: 165 GMRVVYDESELIKSAKLTRTEAGFGNPMVYLEKFLTNPR---HVEVQVLSDGQGNAIHLG 221

Query: 207 RRGQGWITNVARGAQYFPAP-----LEREIGALACQATQAVAVDYGGVDIIQTPAQGFQV 261
            R         +  +  PAP       +E+ A   QA   +     G          F  
Sbjct: 222 DRDCSLQRRHQKVIEEAPAPGIDEKARQEVFARCVQACIEIGYRGAGTFEFLYENGRFYF 281

Query: 262 LEVNSIPSW 270
           +E+N+    
Sbjct: 282 IEMNTRVQV 290


>1bncA [c.30.1 - d.142.1 - b.84.2] BIOTIN CARBOXYLASE
          Length = 433

 Score = 50.4 bits (119), Expect = 7e-09
 Identities = 26/183 (14%), Positives = 50/183 (27%), Gaps = 11/183 (6%)

Query: 93  TASAIERTVDKARTSLLLRHRRVPTPRAWACEDLAQARHLSAQAQREKRELVLKPLFGCQ 152
            A  I    DK      ++   VP                 A A+R    +++K      
Sbjct: 106 KAETIRLMGDKVSAIAAMKKAGVPCVPGSDGPLGDDMDKNRAIAKRIGYPVIIKRGMRVV 165

Query: 153 GQGIIRIGKPADLEACEPTGGLYYLQEFIRPAQPNIWQDWRVFVIGHRPIAAMVRRGQGW 212
                       +        + Y+++++   +     + +V   G      +  R    
Sbjct: 166 RGDAELA---QSISMTRAEAKMVYMEKYLENPR---HVEIQVLADGQGNAIYLAERDCSM 219

Query: 213 ITNVARGAQYFPAP-----LEREIGALACQATQAVAVDYGGVDIIQTPAQGFQVLEVNSI 267
                +  +  PAP     L R IG    +A   +     G          F  +E+N+ 
Sbjct: 220 QRRHQKVVEEAPAPGITPELRRYIGERCAKACVDIGYRGAGTFEFLFENGEFYFIEMNTR 279

Query: 268 PSW 270
              
Sbjct: 280 IQV 282


>1dv1A [c.30.1 - d.142.1 - b.84.2] BIOTIN CARBOXYLASE
          Length = 433

 Score = 50.2 bits (119), Expect = 8e-09
 Identities = 24/191 (12%), Positives = 48/191 (25%), Gaps = 15/191 (7%)

Query: 87  GIPVLNT-ASAIERTVDKARTSLLLRHRRVPTPRAWACEDLAQARHLSAQAQREKRELVL 145
           G   +   A  I    DK      ++   VP                 A A+R    +++
Sbjct: 98  GFIFIGPKAETIRLMGDKVSAIAAMKKAGVPCVPGSDGPLGDDMDKNRAIAKRIGYPVII 157

Query: 146 KPLFGCQGQGIIRIGKPADLEACEPTGGLYYLQEFIRPAQPNIWQDWRVFVIGHRPIAAM 205
           K                +          + Y+++++        +   + V+      A+
Sbjct: 158 KASMRVVRGDAELA--QSISMTRAEANDMVYMEKYL-----ENPRHVEIQVLADGQGNAI 210

Query: 206 VRRGQ-------GWITNVARGAQYFPAPLEREIGALACQATQAVAVDYGGVDIIQTPAQG 258
               +                A      L R IG    +A   +     G          
Sbjct: 211 YLAERDCSMQRRHQKVVEEAPAPGITPELRRYIGERCAKACVDIGYRGAGTFEFLFENGE 270

Query: 259 FQVLEVNSIPS 269
           F  +E+N+   
Sbjct: 271 FYFIEMNTRIQ 281


>1auxA [c.30.1 - d.142.1] SYNAPSIN IA
          Length = 292

 Score = 48.0 bits (113), Expect = 4e-08
 Identities = 28/217 (12%), Positives = 56/217 (25%), Gaps = 25/217 (11%)

Query: 58  DAAIVRGIAAGSFEQITLRLDVLHTLAEFGIPVLNTASAIERTVDKARTSLLLRHRRVPT 117
              ++    A S  +      ++  L   GIP +N+  ++    DK      +       
Sbjct: 69  PDFVLIRQHAFSMARNGDYRSLVIGLQYAGIPSINSLHSVYNFCDKPWVFAQMVRLHKKL 128

Query: 118 PRAWA-CEDLAQARHLSAQAQREKRELVLKPLFGCQGQGIIRIGKPADLEACEPTGGLY- 175
                   +     +           +V+K      G G +++    D +       L  
Sbjct: 129 GTEEFPLINQTFYPNHKEMLSSTTYPVVVKMGHAHSGMGKVKVDNQHDFQDIASVVALTK 188

Query: 176 ---YLQEFIRPAQPNIWQDWRVFVIGHRPIAAMVRRGQGWITNVARGAQYFPAPLEREIG 232
                + FI         D R+  IG    A M    Q  +                   
Sbjct: 189 TYATTEPFIDA-----KYDVRIQKIGQNYKAYMRTLEQIAM--------------SDRYK 229

Query: 233 ALACQATQAV-AVDYGGVDIIQTPAQGFQVLEVNSIP 268
                 ++    +D   V+ +        ++EV    
Sbjct: 230 LWVDTCSEIFGGLDICAVEALHGKDGRDHIIEVVGSS 266


>2dzdA [x.x.x] PYRUVATE CARBOXYLASE
          Length = 459

 Score = 46.6 bits (109), Expect = 1e-07
 Identities = 24/219 (10%), Positives = 59/219 (26%), Gaps = 33/219 (15%)

Query: 92  NTASAIERTVDKARTSLLLRHRRVPTPRAWAC--EDLAQARHLSAQAQREKRELVLKPLF 149
              + ++   DK +      +  +P         + L       A A+     +++K   
Sbjct: 108 PNENHLDMFGDKVKARHAAVNAGIPVIPGSDGPVDGLEDVV---AFAEAHGYPIIIKAAL 164

Query: 150 GCQGQGIIRIGKPADLEA----------CEPTGGLYYLQEFIRPAQPNIWQDWRVFVIGH 199
           G  G+G+  +   ++++                   Y+++ I        +   V ++G 
Sbjct: 165 GGGGRGMRIVRSKSEVKEAFERAKSEAKAAFGSDEVYVEKLI-----ENPKHIEVQILGD 219

Query: 200 RPIAAMVRR---GQGWITNVARG----AQYFPAPLEREIGALACQATQAVAVDYGGVDII 252
                +            +        +      L + I   A Q  ++V     G    
Sbjct: 220 YEGNIVHLYERDCSVQRRHQKVVEVAPSVSLSDELRQRICEAAVQLMRSVGYVNAGTVEF 279

Query: 253 QTPAQGFQVLEVNSIPSWKALQQTTEVNIAGALAKNLLE 291
                 F  +EVN                      ++++
Sbjct: 280 LVSGDEFYFIEVNPRIQV------EHTITEMITGIDIVQ 312


>1dv2B [c.30.1 - d.142.1 - b.84.2] BIOTIN CARBOXYLASE
          Length = 448

 Score = 46.5 bits (109), Expect = 1e-07
 Identities = 28/217 (12%), Positives = 61/217 (28%), Gaps = 23/217 (10%)

Query: 71  EQITLRLDVLHTLAEFGIPVLNT-ASAIERTVDKARTSLLLRHRRVPTPRAWACEDLAQA 129
             ++   +    +   G   +   A  I    DK      ++   VP             
Sbjct: 84  GFLSENANFAEQVERSGFIFIGPKAETIRLMGDKVSAIAAMKKAGVPCVPGSDGPLGDDM 143

Query: 130 RHLSAQAQREKRELVLKPLFGCQGQGIIRIGKPADLEAC----------EPTGGLYYLQE 179
               A A+R    +++K   G  G+G+  +   A+L               +  + Y+++
Sbjct: 144 DKNRAIAKRIGYPVIIKASGGGGGRGMRVVRGDAELAQSISMTRAEAKAAFSNDMVYMEK 203

Query: 180 FIRPAQPNIWQDWRVFVIGHRPIAAMVRRGQGWITNVARG-------AQYFPAPLEREIG 232
           ++        +   + V+      A+    +                A      L R IG
Sbjct: 204 YL-----ENPRHVEIQVLADGQGNAIYLAERDCSMQRRHQKVVEEAPAPGITPELRRYIG 258

Query: 233 ALACQATQAVAVDYGGVDIIQTPAQGFQVLEVNSIPS 269
               +A   +     G          F  +++N+   
Sbjct: 259 ERCAKACVDIGYRGAGTFEFLFENGEFYFIKMNTRIQ 295


>3d8tA [x.x.x] UROPORPHYRINOGEN-III SYNTHASE
          Length = 252

 Score = 45.1 bits (106), Expect = 3e-07
 Identities = 22/194 (11%), Positives = 45/194 (23%), Gaps = 13/194 (6%)

Query: 83  LAEFGIPVLNT-ASAIERTVDKARTSLLLRHRRVPT-PRAWACEDLAQARHLSAQAQREK 140
             + G   L     A E+         +    +      A     +            + 
Sbjct: 19  AEKLGFTPLLFPVQATEKVPVPEYRDQVRELAQGVDLFLATTGVGVRDLLEAGKALGLDL 78

Query: 141 RELVLKPLFGCQGQGIIRIGKPADLEACEPTGGL--YYLQEFIRPAQPNIWQDWRVFVI- 197
              + K     +G    R  K A L       G     L    +           + +  
Sbjct: 79  EGPLAKAFRLARGAKAARALKEAGLPPHAVGDGTSKSLLPLLPQG-----RGVAALQLYG 133

Query: 198 GHRPIAAMVRRGQGWITNVARGAQYFPAPLEREIGALACQATQAVAVDY---GGVDIIQT 254
              P+       +G+        ++ P P        A    +  A+ +     V+ +  
Sbjct: 134 KPLPLLENALAERGYRVLPLMPYRHLPDPEGILRLEEAVLRGEVDALAFVAAIQVEFLFE 193

Query: 255 PAQGFQVLEVNSIP 268
            A+  + L      
Sbjct: 194 GAKDPKALREALNT 207


>1bncB [c.30.1 - d.142.1 - b.84.2] BIOTIN CARBOXYLASE
          Length = 424

 Score = 45.1 bits (105), Expect = 3e-07
 Identities = 27/193 (13%), Positives = 54/193 (27%), Gaps = 18/193 (9%)

Query: 81  HTLAEFGIPVLNTASAIERTVDKARTSLLLRHRRVPTPRAWACEDLAQARHLSAQAQREK 140
                  I +   A  I    DK      ++   VP       +D+ + R +   A+R  
Sbjct: 94  QVERSGFIFIGPKAETIRLMGDKVSAIAAMKKAGVPCVPGSDGDDMDKNRAI---AKRIG 150

Query: 141 RELVLKPLFGCQGQGIIRIGKPADLEACEPTGGLYYLQEFIRPAQPNIWQDWR---VFVI 197
             +++K +     +    I                Y+++++   +    Q         I
Sbjct: 151 YPVIIKRVVRGDAELAQSISMTR-----------AYMEKYLENPRHVEIQVLADGQGNAI 199

Query: 198 GHRPIAAMVRRGQGWITNVARGAQYFPAPLEREIGALACQATQAVAVDYGGVDIIQTPAQ 257
                   ++R    +   A         L R IG    +A   +     G         
Sbjct: 200 YLAERDCSMQRRHQKVVEEAPAPG-ITPELRRYIGERCAKACVDIGYRGAGTFEFLFENG 258

Query: 258 GFQVLEVNSIPSW 270
            F  +E+N+    
Sbjct: 259 EFYFIEMNTRIQV 271


>1b6sC [c.30.1 - d.142.1 - b.84.2] PROTEIN (N5-CARBOXYAMINOIMIDAZOLE
           RIBONUCLEOTIDE
          Length = 350

 Score = 44.6 bits (104), Expect = 4e-07
 Identities = 16/179 (8%), Positives = 39/179 (21%), Gaps = 17/179 (9%)

Query: 97  IERTVDKARTSLLLRHRRVPTPRAWACEDLAQARHLSAQAQREKRELVLKPLFGCQGQGI 156
                D+     L     +PT       + ++     A   R     ++K   G Q +  
Sbjct: 74  FPIIADRLTQKQLFDKLHLPTAPWQLLAERSEWP---AVFDRLGELAIVKRRTGGQWRLR 130

Query: 157 IRIGKPADLEACEPTGGLYYLQEFIRPAQPNIWQDWRVFVIGHRPIAAMVRRGQGWI--- 213
               +    E          +++ I         +  +        + +       +   
Sbjct: 131 ANETEQLPAECYGE----CIVEQGINF-----SGEVSLVGARGFDGSTVFYPLTHNLHQD 181

Query: 214 --TNVARGAQYFPAPLEREIGALACQATQAVAVDYGGVDIIQTPAQGFQVLEVNSIPSW 270
                +       A  +     +     Q +              QG  + E+      
Sbjct: 182 GILRTSVAFPQANAQQQARAEEMLSAIMQELGYVGVMAMECFVTPQGLLINELAPRVHN 240


>2dwcA [x.x.x] 433AA LONG HYPOTHETICAL
          Length = 406

 Score = 43.2 bits (100), Expect = 1e-06
 Identities = 25/200 (12%), Positives = 53/200 (26%), Gaps = 20/200 (10%)

Query: 97  IERTVDKARTSLLLRHRRVPTPRAWACEDLAQARHLSAQAQREKRELVLKPLFGCQGQGI 156
                 +     L++  +VPT R      L +        ++       K +     +G 
Sbjct: 115 WIAMHRERLRETLVKEAKVPTSRYMYATTLDELYEA---CEKIGYPCHTKAIMSYFVKGP 171

Query: 157 IRIGKPADLEACEPTGGLYYLQEFIRPAQPNIWQDWRVFVIGHRPIAAMVRRGQGWITNV 216
             I K  + E         ++   +           R F      +    +    +  + 
Sbjct: 172 EDIPKAWEEEKIIVE---EHIDFDVEVT----ELAVRHFDENGEIVTTFPKPVGHYQIDG 224

Query: 217 ARGAQYFPAPL----EREIGALACQATQAVAVDYGG-VDIIQTPAQGFQVLEVNSIPS-- 269
              A + PA +    ERE+  +A + T  +       V++           EV+  P   
Sbjct: 225 DYHASWQPAEISEKAEREVYRIAKRITDVLGGLGIFGVEMFVKG-DKVWANEVSPRPHDT 283

Query: 270 --WKALQQTTEVNIAGALAK 287
                       +      +
Sbjct: 284 GMVTLASHPPGFSEFALHLR 303


>1dosA [c.1.10] ALDOLASE CLASS II
          Length = 358

 Score = 42.8 bits (99), Expect = 1e-06
 Identities = 13/209 (6%), Positives = 36/209 (17%), Gaps = 30/209 (14%)

Query: 93  TASAIERTVDKARTSLLLRHRRVPTPRAWACEDLAQARHLSAQAQREKRELVLKPLFG-- 150
                  T D  +    +         A  C        +   A + K  ++++   G  
Sbjct: 6   FVKPGVITGDDVQKVFQVAKENNFALPAVNCVGTDSINAVLETAAKVKAPVIVQFSNGGA 65

Query: 151 ---CQGQGIIRIGKPADLEAC------------EPTGGLYYLQEFIRPAQPNIWQDWRVF 195
                      + + A +                    +    +              + 
Sbjct: 66  SFIAGKGVKSDVPQGAAILGAISGAHHVHQMAEHYGVPVILHTDHC-----AKKLLPWID 120

Query: 196 VIGHRPIAAMVRRGQGWITNVARGAQYFPAP--------LEREIGALACQATQAVAVDYG 247
            +           G+   ++                       +  +       +    G
Sbjct: 121 GLLDAGEKHFAATGKPLFSSHMIDLSEESLQENIEICSKYLERMSKIGMTLEIELGCTGG 180

Query: 248 GVDIIQTPAQGFQVLEVNSIPSWKALQQT 276
             D +         L         A  + 
Sbjct: 181 EEDGVDNSHMDASALYTQPEDVDYAYTEL 209


>1dv1B [c.30.1 - d.142.1 - b.84.2] BIOTIN CARBOXYLASE
          Length = 428

 Score = 40.4 bits (93), Expect = 7e-06
 Identities = 25/201 (12%), Positives = 52/201 (25%), Gaps = 9/201 (4%)

Query: 71  EQITLRLDVLHTLAEFGIPVL-NTASAIERTVDKARTSLLLRHRRVPTPRAWACEDLAQA 129
             ++   +    +   G   +   A  I    DK      ++   VP             
Sbjct: 83  GFLSENANFAEQVERSGFIFIGPKAETIRLMGDKVSAIAAMKKAGVPCVPGSDGPLGDDM 142

Query: 130 RHLSAQAQREKRELVLKPLFGCQGQGIIRIGKPADLEACEPTGGLYYLQEFIRPAQPNIW 189
               A A+R    +++K         + +          +      +++  +      + 
Sbjct: 143 DKNRAIAKRIGYPVIIKMRVVRGDAELAQSISMTRAYMEKYLENPRHVEIQV------LA 196

Query: 190 QDWRVFVIGHRPIAAMVRRGQGWITNVARGAQYFPAPLEREIGALACQATQAVAVDYGGV 249
                 +       +M RR Q  +      A      L R IG    +A   +     G 
Sbjct: 197 DGQGNAIYLAERDCSMQRRHQKVVEEAP--APGITPELRRYIGERCAKACVDIGYRGAGT 254

Query: 250 DIIQTPAQGFQVLEVNSIPSW 270
                    F  +E+N+    
Sbjct: 255 FEFLFENGEFYFIEMNTRIQV 275


>1b6sA [c.30.1 - d.142.1 - b.84.2] PROTEIN (N5-CARBOXYAMINOIMIDAZOLE
           RIBONUCLEOTIDE
          Length = 351

 Score = 40.0 bits (92), Expect = 9e-06
 Identities = 17/178 (9%), Positives = 36/178 (20%), Gaps = 12/178 (6%)

Query: 96  AIERTVDKARTSLLLRHRRVPTPRAWACEDLAQARHLSAQAQREKRELVLKPLFGCQGQG 155
                 D+     L     +PT       + ++     A   R     ++K   G     
Sbjct: 73  VFPIIADRLTQKQLFDKLHLPTAPWQLLAERSEWP---AVFDRLGELAIVKRRTGGGQWR 129

Query: 156 IIRIGKPADLEACEPTGGLYYLQEFIRPAQPNIWQDWRVFVIGHRPIAAMVRRG---QGW 212
           +         +      G   +++ I     +                         Q  
Sbjct: 130 LRANE---TEQLPAECYGECIVEQGI---NFSGEVSLVGARGFDGSTVFYPLTHNLHQDG 183

Query: 213 ITNVARGAQYFPAPLEREIGALACQATQAVAVDYGGVDIIQTPAQGFQVLEVNSIPSW 270
           I   +       A  +     +     Q +              QG  + E+      
Sbjct: 184 ILRTSVAFPQANAQQQARAEEMLSAIMQELGYVGVMAMECFVTPQGLLINELAPRVHN 241


>2cqyA [x.x.x] PROPIONYL-COA CARBOXYLASE ALPHA CHAIN,
          Length = 108

 Score = 37.1 bits (86), Expect = 7e-05
 Identities = 15/101 (14%), Positives = 32/101 (31%), Gaps = 15/101 (14%)

Query: 96  AIERTVDKARTSLLLRHRRVPTPRAW--ACEDLAQARHLSAQAQREKRELVLKPLFGCQG 153
           +   + DK  + LL +   V T   +    +D  +A      A+     +++K   G  G
Sbjct: 2   SSGSSGDKIESKLLAKKAEVNTIPGFDGVVKDAEEAV---RIAREIGYPVMIKASAGGGG 58

Query: 154 QGIIRIGKPADLEACEPT----------GGLYYLQEFIRPA 184
           +G+       +                      +++FI   
Sbjct: 59  KGMRIAWDDEETRDGFRLSSQEAASSFGDDRLLIEKFIDNP 99


>1cqjB [d.142.1 - c.23.4] SUCCINYL-COA SYNTHETASE BETA CHAIN
          Length = 385

 Score = 34.5 bits (78), Expect = 4e-04
 Identities = 23/204 (11%), Positives = 46/204 (22%), Gaps = 40/204 (19%)

Query: 102 DKARTSLLLRHRRVPTPRAWACEDLAQARHLSAQAQREKRELVLKPLFGCQGQ------- 154
            + +   L     +P P  +AC    +A    A ++      V+K      G+       
Sbjct: 4   HEYQAKQLFARYGLPAPVGYACTTPREA--EEAASKIGAGPWVVKCQVHAGGRGKAGGVK 61

Query: 155 ----GIIRIGKPADLEAC------EPTGGLY----YLQEFIRPAQPNIWQDWR------- 193
                        +              G       ++     A+               
Sbjct: 62  VVNSKEDIRAFAENWLGKRLVTYQTDANGQPVNQILVEAATDIAKELYLGAVVDRSSRRV 121

Query: 194 ---VFVIGHRPIAAMVRRGQGWITNVARGAQYFPAPLEREIGALACQATQAVAVDYGGVD 250
                  G   I  +       I  VA        P+  +   LA +      +      
Sbjct: 122 VFMASTEGGVEIEKVAEETPHLIHKVA--LDPLTGPMPYQGRELAFKLGLEGKLVQQFTK 179

Query: 251 IIQ-----TPAQGFQVLEVNSIPS 269
           I          +   ++E+N +  
Sbjct: 180 IFMGLATIFLERDLALIEINPLVI 203


>2czgB [x.x.x] PHOSPHORIBOSYLGLYCINAMIDE FORMYL TRANSFERASE
          Length = 403

 Score = 34.4 bits (77), Expect = 5e-04
 Identities = 22/186 (11%), Positives = 44/186 (23%), Gaps = 18/186 (9%)

Query: 97  IERTVDKARTSLLLRHRRVPTPRAWACEDLAQARHLSAQAQREKRELVLKPLFGCQGQGI 156
                 +     L++  +VPT R      L +        ++       K +        
Sbjct: 115 WIAMHRERLRETLVKEAKVPTSRYMYATTLDELYEA---CEKIGYPCHTKAISYFVKGPE 171

Query: 157 IRIGKPADLEACEPTGGLYYLQEFIRPAQPNIWQDWRVFVIGHRPIAAMVRRGQGWITNV 216
                   +             E I           R F      +    +    +  + 
Sbjct: 172 DIPKAWKIIVE-----------EHIDFDVEVTELAVRHFDENGEIVTTFPKPVGHYQIDG 220

Query: 217 ARGAQYFPAPL----EREIGALACQATQAVAVDYGGVDIIQTPAQGFQVLEVNSIPSWKA 272
              A + PA +    ERE+  +A + T  +         +          EV+  P    
Sbjct: 221 DYHASWQPAEISEKAEREVYRIAKRITDVLGGLGIFGVEMFVKGDKVWANEVSPRPHDTG 280

Query: 273 LQQTTE 278
           +     
Sbjct: 281 MVTLAS 286


  Database: 95pdb09Oct16_0000
    Posted date:  Oct 27, 2009  4:27 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.322    0.136    0.415 

Gapped
Lambda     K      H
   0.267   0.0502    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 27,691,822
Number of extensions: 1729743
Number of successful extensions: 20187
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 9005
Number of HSP's successfully gapped: 573
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)