RPS-BLAST 2.2.16 [Mar-25-2007]

Database: Pfam-A 
           11,912 sequences; 2,039,872 total letters

Searching..................................................done

Query= ABA58417.1 noce0 ABA58417.1 GIB00281CH01 "O-antigen polymerase"
         (468 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

PF04932 Wzy_C "O-Antigen ligase"                                       41   4e-06

>PF04932 Wzy_C "O-Antigen ligase"
          Length = 159

 Score = 40.8 bits (95), Expect = 4e-06
 Identities = 54/159 (33%), Positives = 75/159 (47%), Gaps = 16/159 (10%)

Query: 202 ATFALTFIAVPFTYSRGAMLGLAVVSVLLFM-----RWRNKALLVIMLIP-------ILF 249
           A   L  +A+  T SRGA L L V  +LL +     R + + LL+I+LI        ILF
Sbjct: 3   ALLLLLLLALLLTGSRGAWLALLVALLLLLLLLLKKRRKRRLLLLILLIILALLFVGILF 62

Query: 250 GGLAFVPEKLF-NRAESIQNYEMDASSMQRIAAWDLAWNIAIDRPLRG-GGFEYEGDTAR 307
            GL  V   L  NR   +     D+SS  R+  W  A  +  + PL G G   + G  A 
Sbjct: 63  AGLKLVKGILLLNRIARLVEGSGDSSSSGRLYIWRDALEMIKEHPLLGYGPGTFWG--AW 120

Query: 308 WHTYLDPKYYYVMEGAHVAHSIYFQMLGQHGFVGLSLFM 346
           +  Y D  Y      A  AH++Y Q+L + G +GL LF+
Sbjct: 121 YAAYRDYAYESYGYTATHAHNLYLQILVETGIIGLLLFL 159


  Database: Pfam-A
    Posted date:  Oct 30, 2009  9:48 AM
  Number of letters in database: 2,039,872
  Number of sequences in database:  11,912
  
Lambda     K      H
   0.330    0.144    0.463 

Gapped
Lambda     K      H
   0.267   0.0533    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 11912
Number of Hits to DB: 16,966,448
Number of extensions: 960813
Number of successful extensions: 124758
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 2811
Number of HSP's successfully gapped: 208
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)