RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 40scop73nmM 
           9549 sequences; 1,678,726 total letters

Searching..................................................done

Query= ABA58511.1 noce0 ABA58511.1 GIB00281CH01 "Transposase"
         (111 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

1pdnC [a.4.1.5] PROTEIN (PRD PAIRED)                                   32   7e-04

>1pdnC [a.4.1.5] PROTEIN (PRD PAIRED)
          Length = 123

 Score = 32.3 bits (73), Expect = 7e-04
 Identities = 9/54 (16%), Positives = 22/54 (40%)

Query: 5  SIDLRKRVIDFVRGGGSKAEAARRFQVGRASIYRWLSQDDALCYERPGPRRSHK 58
            ++R ++++    G      +R+ +V    + + L++       RPG     K
Sbjct: 18 PNNIRLKIVEMAADGIRPCVISRQLRVSHGCVSKILNRYQETGSIRPGVIGGSK 71


  Database: 40scop73nmM
    Posted date:  Nov 2, 2009 11:39 AM
  Number of letters in database: 1,678,726
  Number of sequences in database:  9549
  
Lambda     K      H
   0.317    0.134    0.384 

Gapped
Lambda     K      H
   0.267   0.0398    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 9549
Number of Hits to DB: 13,148,599
Number of extensions: 957473
Number of successful extensions: 4477
Number of sequences better than 1.0e-03: 8
Number of HSP's gapped: 4415
Number of HSP's successfully gapped: 114
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.2 bits)