BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= AAL62507.1 paer1 AAL62507.1 GIB00076CH01 "binding protein,
putative"
         (313 letters)

Database: 95pdb09Oct16x 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

3cvgD [x.x.x] PUTATIVE METAL BINDING PROTEIN                           51   4e-09
3cvgA [x.x.x] PUTATIVE METAL BINDING PROTEIN                           51   4e-09
3cvgC [x.x.x] PUTATIVE METAL BINDING PROTEIN                           44   5e-07

>3cvgD [x.x.x] PUTATIVE METAL BINDING PROTEIN
          Length = 263

 Score = 51.2 bits (121), Expect = 4e-09
 Identities = 48/175 (27%), Positives = 77/175 (44%), Gaps = 11/175 (6%)

Query: 61  TGLLDVLIPDFEKWAASRGYNIEVRYTAVGTGQALAMAARGDVDVVIVHAPSLEKQYLEN 120
           +GL+  L   F K     G+  +V +    T   +     G VDV I ++P  E+  +++
Sbjct: 18  SGLVKELADAFIKSKVDSGF--KVAWYKSDTTVTINYLKDGIVDVGITYSPVAERISIKH 75

Query: 121 GTLKCRDVIAYNFFIIVGPRDDPAGAKSLTATEAFRRIAEAKA-------PFVSRGDRSG 173
           G  +     A+    ++GP  +PA     +    F +   A+A        F+SR D+S 
Sbjct: 76  GISESPSYYAFRDHFLIGPPSNPAKLSGDSDIADFSKHDAAEAGNTKPPVRFLSRYDKSA 135

Query: 174 THLMELSLWRRAIGREP-DPKNDTWYISAGAGMGQTLLLANEKSAYTLSDTGTWL 227
           T++ E  LW  +IG+ P      TWY        Q L  A     YT++D GT+L
Sbjct: 136 TNIKEAELW-LSIGQVPWATAYSTWYHQYITFPIQALTAAILLREYTITDYGTYL 189


>3cvgA [x.x.x] PUTATIVE METAL BINDING PROTEIN
          Length = 265

 Score = 51.2 bits (121), Expect = 4e-09
 Identities = 48/175 (27%), Positives = 77/175 (44%), Gaps = 11/175 (6%)

Query: 61  TGLLDVLIPDFEKWAASRGYNIEVRYTAVGTGQALAMAARGDVDVVIVHAPSLEKQYLEN 120
           +GL+  L   F K     G+  +V +    T   +     G VDV I ++P  E+  +++
Sbjct: 20  SGLVKELADAFIKSKVDSGF--KVAWYKSDTTVTINYLKDGIVDVGITYSPVAERISIKH 77

Query: 121 GTLKCRDVIAYNFFIIVGPRDDPAGAKSLTATEAFRRIAEAKA-------PFVSRGDRSG 173
           G  +     A+    ++GP  +PA     +    F +   A+A        F+SR D+S 
Sbjct: 78  GISESPSYYAFRDHFLIGPPSNPAKLSGDSDIADFSKHDAAEAGNTKPPVRFLSRYDKSA 137

Query: 174 THLMELSLWRRAIGREP-DPKNDTWYISAGAGMGQTLLLANEKSAYTLSDTGTWL 227
           T++ E  LW  +IG+ P      TWY        Q L  A     YT++D GT+L
Sbjct: 138 TNIKEAELW-LSIGQVPWATAYSTWYHQYITFPIQALTAAILLREYTITDYGTYL 191


>3cvgC [x.x.x] PUTATIVE METAL BINDING PROTEIN
          Length = 202

 Score = 44.3 bits (103), Expect = 5e-07
 Identities = 36/129 (27%), Positives = 59/129 (45%), Gaps = 9/129 (6%)

Query: 107 IVHAPSLEKQYLENGTLKCRDVIAYNFFIIVGPRDDPAGAKSLTATEAFRRIAEAKAP-- 164
           I ++P  E+  +++G  +     A+    ++GP  +PA     +    F +   A+A   
Sbjct: 1   ITYSPVAERISIKHGISESPSYYAFRDHFLIGPPSNPAKLSGDSDIADFSKHDAAEAGNT 60

Query: 165 -----FVSRGDRSGTHLMELSLWRRAIGREP-DPKNDTWYISAGAGMGQTLLLANEKSAY 218
                F+SR D+S T++ E  LW  +IG+ P      TWY        Q L  A     Y
Sbjct: 61  KPPVRFLSRYDKSATNIKEAELW-LSIGQVPWATAYSTWYHQYITFPIQALTAAILLREY 119

Query: 219 TLSDTGTWL 227
           T++D GT+L
Sbjct: 120 TITDYGTYL 128


  Database: 95pdb09Oct16x
    Posted date:  Nov 2, 2009  3:15 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.321    0.134    0.375 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 773,631,919
Number of extensions: 31133780
Number of successful extensions: 78902
Number of sequences better than 1.0e-03: 1987
Number of HSP's gapped: 75930
Number of HSP's successfully gapped: 2741
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.4 bits)