BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= AAL62792.1 paer1 AAL62792.1 GIB00076CH01 "glycosyltransferase
(type 2)"
         (394 letters)

Database: 95pdb09Oct16x 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

3e26A [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN                         41   5e-06
3e25A [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN                         41   5e-06

>3e26A [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
          Length = 274

 Score = 41.2 bits (95), Expect = 5e-06
 Identities = 32/96 (33%), Positives = 45/96 (46%), Gaps = 11/96 (11%)

Query: 3   ITVVLPTLNEAQALPKVVEELR--ATGYRD-ILVVDGGSTDGTVEEAKRLGLRVIGQ--- 56
           I+VVLP LNE   +  V++ +     G  D ++V+D GSTD T   A   G RV+ +   
Sbjct: 23  ISVVLPALNEEATIESVIDSISPLVDGLVDELIVLDSGSTDDTEIRAIASGARVVSREQA 82

Query: 57  -----YGRGKGMALRTALMYVETPYVAVLDADYTYP 87
                   GKG AL  +L       V  +D+D   P
Sbjct: 83  LPEVPVRPGKGEALWRSLAATSGDIVVFIDSDLINP 118


>3e25A [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
          Length = 270

 Score = 41.2 bits (95), Expect = 5e-06
 Identities = 32/96 (33%), Positives = 45/96 (46%), Gaps = 11/96 (11%)

Query: 3   ITVVLPTLNEAQALPKVVEELR--ATGYRD-ILVVDGGSTDGTVEEAKRLGLRVIGQ--- 56
           I+VVLP LNE   +  V++ +     G  D ++V+D GSTD T   A   G RV+ +   
Sbjct: 22  ISVVLPALNEEATIESVIDSISPLVDGLVDELIVLDSGSTDDTEIRAIASGARVVSREQA 81

Query: 57  -----YGRGKGMALRTALMYVETPYVAVLDADYTYP 87
                   GKG AL  +L       V  +D+D   P
Sbjct: 82  LPEVPVRPGKGEALWRSLAATSGDIVVFIDSDLINP 117


  Database: 95pdb09Oct16x
    Posted date:  Nov 2, 2009  3:15 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.324    0.140    0.425 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 559,184,369
Number of extensions: 22742988
Number of successful extensions: 56372
Number of sequences better than 1.0e-03: 311
Number of HSP's gapped: 56485
Number of HSP's successfully gapped: 362
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)