BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= AAL63787.1 paer1 AAL63787.1 GIB00076CH01 "conserved protein
with 2 CBS domains"
         (142 letters)

Database: 95pdb09Oct16x 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

2rc3C [x.x.x] CBS DOMAIN                                               67   3e-14
2rc3B [x.x.x] CBS DOMAIN                                               67   3e-14
2rc3A [x.x.x] CBS DOMAIN                                               67   3e-14
2ef7B [x.x.x] HYPOTHETICAL PROTEIN ST2348                              61   2e-12
2ef7A [x.x.x] HYPOTHETICAL PROTEIN ST2348                              61   2e-12
2yziB [x.x.x] HYPOTHETICAL PROTEIN PH0107                              60   4e-12
2yziA [x.x.x] HYPOTHETICAL PROTEIN PH0107                              60   4e-12
2rifD [x.x.x] CONSERVED PROTEIN WITH 2 CBS DOMAINS                     59   9e-12
2rifC [x.x.x] CONSERVED PROTEIN WITH 2 CBS DOMAINS                     59   9e-12
2rifB [x.x.x] CONSERVED PROTEIN WITH 2 CBS DOMAINS                     59   9e-12
2rifA [x.x.x] CONSERVED PROTEIN WITH 2 CBS DOMAINS                     59   9e-12
2yvxA [x.x.x] MG2+ TRANSPORTER MGTE                                    55   1e-10
2yvyA [x.x.x] MG2+ TRANSPORTER MGTE                                    53   5e-10
1xkfB [x.x.x] HYPOTHETICAL PROTEIN RV2626C                             52   1e-09
2yzqA [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN PH1780                  50   5e-09
1xkfA [x.x.x] HYPOTHETICAL PROTEIN RV2626C                             50   5e-09
2qh1B [x.x.x] HYPOTHETICAL PROTEIN TA0289                              49   7e-09
2qh1A [x.x.x] HYPOTHETICAL PROTEIN TA0289                              49   7e-09
1pvmB [d.37.1 - d.37.1 - g.41.13] CONSERVED HYPOTHETICAL PROTEIN...    49   7e-09
1pvmA [d.37.1 - d.37.1 - g.41.13] CONSERVED HYPOTHETICAL PROTEIN...    49   7e-09
3fhmC [x.x.x] UNCHARACTERIZED PROTEIN ATU1752                          49   7e-09
3fhmB [x.x.x] UNCHARACTERIZED PROTEIN ATU1752                          49   7e-09
3fhmA [x.x.x] UNCHARACTERIZED PROTEIN ATU1752                          49   7e-09
3fhmD [x.x.x] UNCHARACTERIZED PROTEIN ATU1752                          42   1e-06
2o16A [x.x.x] ACETOIN UTILIZATION PROTEIN ACUB, PUTATIVE               40   4e-06
1zfjA [c.1.5 - d.37.1 - d.37.1] INOSINE MONOPHOSPHATE DEHYDROGENASE    40   5e-06
2yvzA [x.x.x] MG2+ TRANSPORTER MGTE                                    37   3e-05
2j9lA [x.x.x] CHLORIDE CHANNEL PROTEIN 5                               36   6e-05
1uipA [x.x.x] ADENOSINE DEAMINASE                                      35   1e-04
1uioA [x.x.x] ADENOSINE DEAMINASE                                      35   1e-04
1fkxA [x.x.x] ADENOSINE DEAMINASE                                      35   1e-04
1fkwA [x.x.x] ADENOSINE DEAMINASE                                      35   1e-04
1a4mA [c.1.9] ADENOSINE DEAMINASE                                      35   1e-04
2j9lD [x.x.x] CHLORIDE CHANNEL PROTEIN 5                               35   1e-04
2j9lC [x.x.x] CHLORIDE CHANNEL PROTEIN 5                               35   1e-04
2j9lB [x.x.x] CHLORIDE CHANNEL PROTEIN 5                               35   1e-04
2j9lF [x.x.x] CHLORIDE CHANNEL PROTEIN 5                               34   2e-04
2o16B [x.x.x] ACETOIN UTILIZATION PROTEIN ACUB, PUTATIVE               34   3e-04
3ddjA [x.x.x] CBS DOMAIN-CONTAINING PROTEIN                            32   9e-04
2bj9A [x.x.x] NICKEL RESPONSIVE REGULATOR                              32   9e-04
2bj7A [x.x.x] NICKEL RESPONSIVE REGULATOR                              32   9e-04
2bj3C [x.x.x] NICKEL RESPONSIVE REGULATOR                              32   9e-04
2bj3B [x.x.x] NICKEL RESPONSIVE REGULATOR                              32   9e-04
2bj3A [x.x.x] NICKEL RESPONSIVE REGULATOR                              32   9e-04
2bj1A [x.x.x] NICKEL RESPONSIVE REGULATOR                              32   9e-04

>2rc3C [x.x.x] CBS DOMAIN
          Length = 128

 Score = 67.0 bits (162), Expect = 3e-14
 Identities = 41/113 (36%), Positives = 67/113 (59%), Gaps = 4/113 (3%)

Query: 11  VICIKPGASILDAAKLMAQRNIGFLIVSSDCKRDLAGVISERDIIRAIASGIQPSEP--V 68
           V+ I P  S+ +A + MA  NIG L+V  D K  L G+++ERD  R      +P +   V
Sbjct: 16  VVAIGPDDSVFNAMQKMAADNIGALLVMKDEK--LVGILTERDFSRKSYLLDKPVKDTQV 73

Query: 69  DNIMTRKVVYVYKDTPVWEIARLMRKYNIRHILVMDNGQIFGVISIRDLLKES 121
             IMTR+V YV  +    +   L+ +  +RH+ V+D+G++ G++SI DL+K++
Sbjct: 74  KEIMTRQVAYVDLNNTNEDCMALITEMRVRHLPVLDDGKVIGLLSIGDLVKDA 126


>2rc3B [x.x.x] CBS DOMAIN
          Length = 127

 Score = 67.0 bits (162), Expect = 3e-14
 Identities = 40/113 (35%), Positives = 69/113 (61%), Gaps = 5/113 (4%)

Query: 11  VICIKPGASILDAAKLMAQRNIGFLIVSSDCKRDLAGVISERDIIRA--IASGIQPSEPV 68
           V+ I P  S+ +A + MA  NIG L+V  D K  L G+++ERD  R   +   ++ ++ V
Sbjct: 16  VVAIGPDDSVFNAMQKMAADNIGALLVMKDEK--LVGILTERDFSRKSYLLKPVKDTQ-V 72

Query: 69  DNIMTRKVVYVYKDTPVWEIARLMRKYNIRHILVMDNGQIFGVISIRDLLKES 121
             IMTR+V YV  +    +   L+ +  +RH+ V+D+G++ G++SI DL+K++
Sbjct: 73  KEIMTRQVAYVDLNNTNEDCMALITEMRVRHLPVLDDGKVIGLLSIGDLVKDA 125


>2rc3A [x.x.x] CBS DOMAIN
          Length = 127

 Score = 67.0 bits (162), Expect = 3e-14
 Identities = 41/113 (36%), Positives = 67/113 (59%), Gaps = 4/113 (3%)

Query: 11  VICIKPGASILDAAKLMAQRNIGFLIVSSDCKRDLAGVISERDIIRAIASGIQPSEP--V 68
           V+ I P  S+ +A + MA  NIG L+V  D K  L G+++ERD  R      +P +   V
Sbjct: 15  VVAIGPDDSVFNAMQKMAADNIGALLVMKDEK--LVGILTERDFSRKSYLLDKPVKDTQV 72

Query: 69  DNIMTRKVVYVYKDTPVWEIARLMRKYNIRHILVMDNGQIFGVISIRDLLKES 121
             IMTR+V YV  +    +   L+ +  +RH+ V+D+G++ G++SI DL+K++
Sbjct: 73  KEIMTRQVAYVDLNNTNEDCMALITEMRVRHLPVLDDGKVIGLLSIGDLVKDA 125


>2ef7B [x.x.x] HYPOTHETICAL PROTEIN ST2348
          Length = 120

 Score = 60.8 bits (146), Expect = 2e-12
 Identities = 41/113 (36%), Positives = 68/113 (60%), Gaps = 6/113 (5%)

Query: 11  VICIKPGASILDAAKLMAQRNIGFLIVSSDCKRDLAGVISERDIIRAIASGIQPSEPVDN 70
           VI +   A + D AK+  ++NIG +IV    K    G+I+ERDI++AI  G +  E    
Sbjct: 10  VISVTKDAKLNDIAKV-TEKNIGSVIVVDGNKP--VGIITERDIVKAIGKG-KSLETKAE 65

Query: 71  IMTRKVVYVYKDTPVWEIARLMRKYNIRHILVMDN-GQIFGVISIRDLLKESD 122
             T  ++ + +D+P+   A  +R++NIRH+ V+D+ G + G+ISIRD+ +  D
Sbjct: 66  EFTASLITIREDSPITG-ALALRQFNIRHLPVVDDKGNLKGIISIRDITRAID 117



 Score = 32.7 bits (73), Expect = 7e-04
 Identities = 20/59 (33%), Positives = 35/59 (59%), Gaps = 1/59 (1%)

Query: 75  KVVYVYKDTPVWEIARLMRKYNIRHILVMDNGQIFGVISIRDLLKESDVIERLVEYAEE 133
           +V+ V KD  + +IA++  K NI  ++V+D  +  G+I+ RD++K     + L   AEE
Sbjct: 9   QVISVTKDAKLNDIAKVTEK-NIGSVIVVDGNKPVGIITERDIVKAIGKGKSLETKAEE 66


>2ef7A [x.x.x] HYPOTHETICAL PROTEIN ST2348
          Length = 121

 Score = 60.8 bits (146), Expect = 2e-12
 Identities = 41/113 (36%), Positives = 68/113 (60%), Gaps = 6/113 (5%)

Query: 11  VICIKPGASILDAAKLMAQRNIGFLIVSSDCKRDLAGVISERDIIRAIASGIQPSEPVDN 70
           VI +   A + D AK+  ++NIG +IV    K    G+I+ERDI++AI  G +  E    
Sbjct: 12  VISVTKDAKLNDIAKV-TEKNIGSVIVVDGNKP--VGIITERDIVKAIGKG-KSLETKAE 67

Query: 71  IMTRKVVYVYKDTPVWEIARLMRKYNIRHILVMDN-GQIFGVISIRDLLKESD 122
             T  ++ + +D+P+   A  +R++NIRH+ V+D+ G + G+ISIRD+ +  D
Sbjct: 68  EFTASLITIREDSPITG-ALALRQFNIRHLPVVDDKGNLKGIISIRDITRAID 119



 Score = 32.7 bits (73), Expect = 7e-04
 Identities = 20/59 (33%), Positives = 35/59 (59%), Gaps = 1/59 (1%)

Query: 75  KVVYVYKDTPVWEIARLMRKYNIRHILVMDNGQIFGVISIRDLLKESDVIERLVEYAEE 133
           +V+ V KD  + +IA++  K NI  ++V+D  +  G+I+ RD++K     + L   AEE
Sbjct: 11  QVISVTKDAKLNDIAKVTEK-NIGSVIVVDGNKPVGIITERDIVKAIGKGKSLETKAEE 68


>2yziB [x.x.x] HYPOTHETICAL PROTEIN PH0107
          Length = 129

 Score = 60.1 bits (144), Expect = 4e-12
 Identities = 37/117 (31%), Positives = 72/117 (61%), Gaps = 6/117 (5%)

Query: 6   IASKNVICIKPGASILDAAKLMAQRNIGFLIVSSDCKRDLAGVISERDIIR-AIASGIQP 64
           + +K ++ +KP  S+ +A++L  + ++G L+V +D   ++ G  ++ DIIR  I  G+  
Sbjct: 7   VYTKKLLGVKPSTSVQEASRL--EFDVGSLVVIND-DGNVVGFFTKSDIIRRVIVPGLPY 63

Query: 65  SEPVDNIMTRKVVYVYKDTPVWEIARLMRKYNIRHILVMDNGQIFGVISIRDLLKES 121
             PV+ I TR ++    +TP+ E+ R   ++ I+HIL+ + G+I G+ ++ DLL+ S
Sbjct: 64  DIPVERI-TRNLITANVNTPLGEVLR-KAEHRIKHILIEEEGKIVGIFTLSDLLEAS 118


>2yziA [x.x.x] HYPOTHETICAL PROTEIN PH0107
          Length = 125

 Score = 60.1 bits (144), Expect = 4e-12
 Identities = 37/117 (31%), Positives = 72/117 (61%), Gaps = 6/117 (5%)

Query: 6   IASKNVICIKPGASILDAAKLMAQRNIGFLIVSSDCKRDLAGVISERDIIR-AIASGIQP 64
           + +K ++ +KP  S+ +A++L  + ++G L+V +D   ++ G  ++ DIIR  I  G+  
Sbjct: 7   VYTKKLLGVKPSTSVQEASRL--EFDVGSLVVIND-DGNVVGFFTKSDIIRRVIVPGLPY 63

Query: 65  SEPVDNIMTRKVVYVYKDTPVWEIARLMRKYNIRHILVMDNGQIFGVISIRDLLKES 121
             PV+ I TR ++    +TP+ E+ R   ++ I+HIL+ + G+I G+ ++ DLL+ S
Sbjct: 64  DIPVERI-TRNLITANVNTPLGEVLR-KAEHRIKHILIEEEGKIVGIFTLSDLLEAS 118


>2rifD [x.x.x] CONSERVED PROTEIN WITH 2 CBS DOMAINS
          Length = 130

 Score = 58.9 bits (141), Expect = 9e-12
 Identities = 40/113 (35%), Positives = 65/113 (57%), Gaps = 5/113 (4%)

Query: 18  ASILDAAKLMAQRNIGFLIVSS--DCKRDLAGVISERDIIRAIASGIQPSEPVDNIMTRK 75
           A+I + A  +A+  +G  ++++  + KR +A V+SERDI+RA+A  +    P   I    
Sbjct: 18  ATIREVATELAKNRVGLAVLTARDNPKRPVA-VVSERDILRAVAQRLDLDGPAMPIANSP 76

Query: 76  VVYVYKDTPVWEIARLMRKYNIRHILVMD-NGQIFGVISIRDLLKESDVIERL 127
           +  +  D PV   A  MR++NIRH    + NG++ GV+SIRDL  E  ++  L
Sbjct: 77  ITVLDTD-PVHVAAEKMRRHNIRHXXXXNKNGELVGVLSIRDLCFERAILLEL 128


>2rifC [x.x.x] CONSERVED PROTEIN WITH 2 CBS DOMAINS
          Length = 128

 Score = 58.9 bits (141), Expect = 9e-12
 Identities = 40/113 (35%), Positives = 65/113 (57%), Gaps = 5/113 (4%)

Query: 18  ASILDAAKLMAQRNIGFLIVSS--DCKRDLAGVISERDIIRAIASGIQPSEPVDNIMTRK 75
           A+I + A  +A+  +G  ++++  + KR +A V+SERDI+RA+A  +    P   I    
Sbjct: 18  ATIREVATELAKNRVGLAVLTARDNPKRPVA-VVSERDILRAVAQRLDLDGPAMPIANSP 76

Query: 76  VVYVYKDTPVWEIARLMRKYNIRHILVMD-NGQIFGVISIRDLLKESDVIERL 127
           +  +  D PV   A  MR++NIRH    + NG++ GV+SIRDL  E  ++  L
Sbjct: 77  ITVLDTD-PVHVAAEKMRRHNIRHXXXXNKNGELVGVLSIRDLCFERAILLEL 128


>2rifB [x.x.x] CONSERVED PROTEIN WITH 2 CBS DOMAINS
          Length = 129

 Score = 58.9 bits (141), Expect = 9e-12
 Identities = 40/113 (35%), Positives = 65/113 (57%), Gaps = 5/113 (4%)

Query: 18  ASILDAAKLMAQRNIGFLIVSS--DCKRDLAGVISERDIIRAIASGIQPSEPVDNIMTRK 75
           A+I + A  +A+  +G  ++++  + KR +A V+SERDI+RA+A  +    P   I    
Sbjct: 18  ATIREVATELAKNRVGLAVLTARDNPKRPVA-VVSERDILRAVAQRLDLDGPAMPIANSP 76

Query: 76  VVYVYKDTPVWEIARLMRKYNIRHILVMD-NGQIFGVISIRDLLKESDVIERL 127
           +  +  D PV   A  MR++NIRH    + NG++ GV+SIRDL  E  ++  L
Sbjct: 77  ITVLDTD-PVHVAAEKMRRHNIRHXXXXNKNGELVGVLSIRDLCFERAILLEL 128


>2rifA [x.x.x] CONSERVED PROTEIN WITH 2 CBS DOMAINS
          Length = 131

 Score = 58.9 bits (141), Expect = 9e-12
 Identities = 40/113 (35%), Positives = 65/113 (57%), Gaps = 5/113 (4%)

Query: 18  ASILDAAKLMAQRNIGFLIVSS--DCKRDLAGVISERDIIRAIASGIQPSEPVDNIMTRK 75
           A+I + A  +A+  +G  ++++  + KR +A V+SERDI+RA+A  +    P   I    
Sbjct: 18  ATIREVATELAKNRVGLAVLTARDNPKRPVA-VVSERDILRAVAQRLDLDGPAMPIANSP 76

Query: 76  VVYVYKDTPVWEIARLMRKYNIRHILVMD-NGQIFGVISIRDLLKESDVIERL 127
           +  +  D PV   A  MR++NIRH    + NG++ GV+SIRDL  E  ++  L
Sbjct: 77  ITVLDTD-PVHVAAEKMRRHNIRHXXXXNKNGELVGVLSIRDLCFERAILLEL 128


>2yvxA [x.x.x] MG2+ TRANSPORTER MGTE
          Length = 442

 Score = 55.1 bits (131), Expect = 1e-10
 Identities = 45/145 (31%), Positives = 73/145 (50%), Gaps = 16/145 (11%)

Query: 3   AGAIASKNVICIKPGASILDAAKLMAQR----NIGFLIVSSDCKRDLAGVISERDIIRAI 58
           AG + +   + ++ G ++ +  + + +        + I   D K  L GV+S RD+I A 
Sbjct: 128 AGGLMTPEYVAVREGMTVEEVLRFLRRAAPDAETIYYIYVVDEKGRLKGVLSLRDLIVA- 186

Query: 59  ASGIQPSEPVDNIMTRKVVYVYKDTPVWEIARLMRKYNIRHILVMD-NGQIFGVISIRDL 117
                P   V  IM  KVVYV  DT   E+ARLM  Y+   + V+D  G++ G++++ D+
Sbjct: 187 ----DPRTRVAEIMNPKVVYVRTDTDQEEVARLMADYDFTVLPVVDEEGRLVGIVTVDDV 242

Query: 118 LKESDVIERLVEYAEERIDEISAHD 142
           L   DV+E     A E I ++ A D
Sbjct: 243 L---DVLE---AEATEDIHKLGAVD 261


>2yvyA [x.x.x] MG2+ TRANSPORTER MGTE
          Length = 248

 Score = 53.1 bits (126), Expect = 5e-10
 Identities = 37/121 (30%), Positives = 62/121 (51%), Gaps = 10/121 (8%)

Query: 3   AGAIASKNVICIKPGASILDAAKLMAQR----NIGFLIVSSDCKRDLAGVISERDIIRAI 58
           AG + +   + ++ G ++ +  + + +        + I   D K  L GV+S RD+I A 
Sbjct: 130 AGGLMTPEYVAVREGMTVEEVLRFLRRAAPDAETIYYIYVVDEKGRLKGVLSLRDLIVA- 188

Query: 59  ASGIQPSEPVDNIMTRKVVYVYKDTPVWEIARLMRKYNIRHILVMD-NGQIFGVISIRDL 117
                P   V  IM  KVVYV  DT   E+ARLM  Y+   + V+D  G++ G++++ D+
Sbjct: 189 ----DPRTRVAEIMNPKVVYVRTDTDQEEVARLMADYDFTVLPVVDEEGRLVGIVTVDDV 244

Query: 118 L 118
           L
Sbjct: 245 L 245


>1xkfB [x.x.x] HYPOTHETICAL PROTEIN RV2626C
          Length = 123

 Score = 52.0 bits (123), Expect = 1e-09
 Identities = 32/121 (26%), Positives = 66/121 (54%), Gaps = 9/121 (7%)

Query: 1   MNAGAIASKNVICIKPGASILDAAKLMAQRNIGFLIVSSDCKRDLAGVISERDI-IRAIA 59
           MNAG      V C+    ++  AA+ M + +IG L +  D  R L G++++RDI I+ +A
Sbjct: 8   MNAG------VTCVGEHETLTAAAQYMREHDIGALPICGDDDR-LHGMLTDRDIVIKGLA 60

Query: 60  SGIQPSEPVDNIMTR-KVVYVYKDTPVWEIARLMRKYNIRHILVMDNGQIFGVISIRDLL 118
           +G+ P+      + R  + YV  +  + E+  +M ++ +R + V+   ++ G+++  D+ 
Sbjct: 61  AGLDPNTATAGELARDSIYYVDANASIQEMLNVMEEHQVRRVPVISEHRLVGIVTEADIA 120

Query: 119 K 119
           +
Sbjct: 121 R 121


>2yzqA [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN PH1780
          Length = 224

 Score = 49.7 bits (117), Expect = 5e-09
 Identities = 28/81 (34%), Positives = 47/81 (58%), Gaps = 2/81 (2%)

Query: 40  DCKRDLAGVISERDIIRAIASGIQPSEPVDNIMTRKVVYVYKDTPVWEIARLMRKYNIRH 99
           D + +L G++ E D++R  +  ++P++PV  IMTR V+       V E+A  M KY+I  
Sbjct: 142 DSEGNLVGIVDETDLLRD-SEIVRPNKPVAEIMTRDVIVATPHMTVHEVALKMAKYSIEQ 200

Query: 100 I-LVMDNGQIFGVISIRDLLK 119
           + ++   G + G+I   DLLK
Sbjct: 201 LPVIRGEGDLIGLIRDFDLLK 221



 Score = 37.4 bits (85), Expect = 3e-05
 Identities = 30/122 (24%), Positives = 60/122 (49%), Gaps = 4/122 (3%)

Query: 6   IASKNVICIKPGASILDAAKLMAQRNIGFLIVSSDCKRDLAGVISERDIIRAIASGIQPS 65
           +  ++V  +K   ++  AAKLM + +   ++V  D K    G+++  DIIR   +  +  
Sbjct: 43  LVKRDVPVVKENDTLKKAAKLMLEYDYRRVVVV-DSKGKPVGILTVGDIIRRYFAKSEKY 101

Query: 66  EPVD--NIMTRKVVYVYKDTPVWEIARLMRKYNIRHILVMDN-GQIFGVISIRDLLKESD 122
           + V+      R V  V++ TP           N   + V+D+ G + G++   DLL++S+
Sbjct: 102 KGVEIEPYYQRYVSIVWEGTPXXXXXXXXXXSNSMALPVVDSEGNLVGIVDETDLLRDSE 161

Query: 123 VI 124
           ++
Sbjct: 162 IV 163


>1xkfA [x.x.x] HYPOTHETICAL PROTEIN RV2626C
          Length = 120

 Score = 49.7 bits (117), Expect = 5e-09
 Identities = 31/120 (25%), Positives = 65/120 (54%), Gaps = 10/120 (8%)

Query: 1   MNAGAIASKNVICIKPGASILDAAKLMAQRNIGFLIVSSDCKRDLAGVISERDI-IRAIA 59
           MNAG      V C+    ++  AA+ M + +IG L +  D  R L G++++RDI I+ +A
Sbjct: 7   MNAG------VTCVGEHETLTAAAQYMREHDIGALPICGDDDR-LHGMLTDRDIVIKGLA 59

Query: 60  SGIQPSEPVDNIMTRKVVYVYKDTPVWEIARLMRKYNIRHILVMDNGQIFGVISIRDLLK 119
           +G+ P+      +   + YV  +  + E+  +M ++ +R + V+   ++ G+++  D+ +
Sbjct: 60  AGLDPNTATAGELA--IYYVDANASIQEMLNVMEEHQVRRVPVISEHRLVGIVTEADIAR 117


>2qh1B [x.x.x] HYPOTHETICAL PROTEIN TA0289
          Length = 185

 Score = 49.3 bits (116), Expect = 7e-09
 Identities = 33/120 (27%), Positives = 63/120 (52%), Gaps = 4/120 (3%)

Query: 1   MNAGAIASKNVICIKPGASILDAAKLMAQRNIGFLIVSSDCKRDLAGVISERDII-RAIA 59
           M    I + N   +    ++ DA K+M + ++  L+V  D   D+ G++SER II R I 
Sbjct: 10  MRVEKIMNSNFKTVNWNTTVFDAVKIMNENHLYGLVVKDDNGNDV-GLLSERSIIKRFIP 68

Query: 60  SGIQPSE-PVDNIMTRKVVYVYKDTPVWEIARLMRKYNIRHILVMDN-GQIFGVISIRDL 117
              +P E P+  +M + +  V  D  V ++A  + +  +    V+D+ G++ G++++ DL
Sbjct: 69  RNKKPDEVPIRLVMRKPIPKVKSDYDVKDVAAYLSENGLERCAVVDDPGRVVGIVTLTDL 128


>2qh1A [x.x.x] HYPOTHETICAL PROTEIN TA0289
          Length = 179

 Score = 49.3 bits (116), Expect = 7e-09
 Identities = 33/120 (27%), Positives = 63/120 (52%), Gaps = 4/120 (3%)

Query: 1   MNAGAIASKNVICIKPGASILDAAKLMAQRNIGFLIVSSDCKRDLAGVISERDII-RAIA 59
           M    I + N   +    ++ DA K+M + ++  L+V  D   D+ G++SER II R I 
Sbjct: 4   MRVEKIMNSNFKTVNWNTTVFDAVKIMNENHLYGLVVKDDNGNDV-GLLSERSIIKRFIP 62

Query: 60  SGIQPSE-PVDNIMTRKVVYVYKDTPVWEIARLMRKYNIRHILVMDN-GQIFGVISIRDL 117
              +P E P+  +M + +  V  D  V ++A  + +  +    V+D+ G++ G++++ DL
Sbjct: 63  RNKKPDEVPIRLVMRKPIPKVKSDYDVKDVAAYLSENGLERCAVVDDPGRVVGIVTLTDL 122


>1pvmB [d.37.1 - d.37.1 - g.41.13] CONSERVED HYPOTHETICAL PROTEIN
           TA0289
          Length = 184

 Score = 49.3 bits (116), Expect = 7e-09
 Identities = 33/120 (27%), Positives = 63/120 (52%), Gaps = 4/120 (3%)

Query: 1   MNAGAIASKNVICIKPGASILDAAKLMAQRNIGFLIVSSDCKRDLAGVISERDII-RAIA 59
           M    I + N   +    ++ DA K+M + ++  L+V  D   D+ G++SER II R I 
Sbjct: 9   MRVEKIMNSNFKTVNWNTTVFDAVKIMNENHLYGLVVKDDNGNDV-GLLSERSIIKRFIP 67

Query: 60  SGIQPSE-PVDNIMTRKVVYVYKDTPVWEIARLMRKYNIRHILVMDN-GQIFGVISIRDL 117
              +P E P+  +M + +  V  D  V ++A  + +  +    V+D+ G++ G++++ DL
Sbjct: 68  RNKKPDEVPIRLVMRKPIPKVKSDYDVKDVAAYLSENGLERCAVVDDPGRVVGIVTLTDL 127


>1pvmA [d.37.1 - d.37.1 - g.41.13] CONSERVED HYPOTHETICAL PROTEIN
           TA0289
          Length = 178

 Score = 49.3 bits (116), Expect = 7e-09
 Identities = 33/120 (27%), Positives = 63/120 (52%), Gaps = 4/120 (3%)

Query: 1   MNAGAIASKNVICIKPGASILDAAKLMAQRNIGFLIVSSDCKRDLAGVISERDII-RAIA 59
           M    I + N   +    ++ DA K+M + ++  L+V  D   D+ G++SER II R I 
Sbjct: 3   MRVEKIMNSNFKTVNWNTTVFDAVKIMNENHLYGLVVKDDNGNDV-GLLSERSIIKRFIP 61

Query: 60  SGIQPSE-PVDNIMTRKVVYVYKDTPVWEIARLMRKYNIRHILVMDN-GQIFGVISIRDL 117
              +P E P+  +M + +  V  D  V ++A  + +  +    V+D+ G++ G++++ DL
Sbjct: 62  RNKKPDEVPIRLVMRKPIPKVKSDYDVKDVAAYLSENGLERCAVVDDPGRVVGIVTLTDL 121


>3fhmC [x.x.x] UNCHARACTERIZED PROTEIN ATU1752
          Length = 134

 Score = 49.3 bits (116), Expect = 7e-09
 Identities = 32/113 (28%), Positives = 58/113 (51%), Gaps = 3/113 (2%)

Query: 9   KNVICIKPGASILDAAKLMAQRNIGFLIVSSDCKRDLAGVISERDIIRAIASGIQPS--E 66
           ++V+ + P  SI +AA  +    I            L G+ +ERD+++A+A     S  +
Sbjct: 20  RDVVTVGPDVSIGEAAGTLHAHKIXXXXXXXXXXXXL-GIFTERDLVKAVAGQGAASLQQ 78

Query: 67  PVDNIMTRKVVYVYKDTPVWEIARLMRKYNIRHILVMDNGQIFGVISIRDLLK 119
            V   MT+ VV    ++   ++  +M     RH+ V +NG++ G+ISI D++K
Sbjct: 79  SVSVAMTKNVVRCQHNSTTDQLMEIMTGGRFRHVPVEENGRLAGIISIGDVVK 131


>3fhmB [x.x.x] UNCHARACTERIZED PROTEIN ATU1752
          Length = 126

 Score = 49.3 bits (116), Expect = 7e-09
 Identities = 32/113 (28%), Positives = 58/113 (51%), Gaps = 3/113 (2%)

Query: 9   KNVICIKPGASILDAAKLMAQRNIGFLIVSSDCKRDLAGVISERDIIRAIASGIQPS--E 66
           ++V+ + P  SI +AA  +    I            L G+ +ERD+++A+A     S  +
Sbjct: 12  RDVVTVGPDVSIGEAAGTLHAHKIXXXXXXXXXXXXL-GIFTERDLVKAVAGQGAASLQQ 70

Query: 67  PVDNIMTRKVVYVYKDTPVWEIARLMRKYNIRHILVMDNGQIFGVISIRDLLK 119
            V   MT+ VV    ++   ++  +M     RH+ V +NG++ G+ISI D++K
Sbjct: 71  SVSVAMTKNVVRCQHNSTTDQLMEIMTGGRFRHVPVEENGRLAGIISIGDVVK 123


>3fhmA [x.x.x] UNCHARACTERIZED PROTEIN ATU1752
          Length = 136

 Score = 49.3 bits (116), Expect = 7e-09
 Identities = 32/113 (28%), Positives = 58/113 (51%), Gaps = 3/113 (2%)

Query: 9   KNVICIKPGASILDAAKLMAQRNIGFLIVSSDCKRDLAGVISERDIIRAIASGIQPS--E 66
           ++V+ + P  SI +AA  +    I            L G+ +ERD+++A+A     S  +
Sbjct: 20  RDVVTVGPDVSIGEAAGTLHAHKIXXXXXXXXXXXXL-GIFTERDLVKAVAGQGAASLQQ 78

Query: 67  PVDNIMTRKVVYVYKDTPVWEIARLMRKYNIRHILVMDNGQIFGVISIRDLLK 119
            V   MT+ VV    ++   ++  +M     RH+ V +NG++ G+ISI D++K
Sbjct: 79  SVSVAMTKNVVRCQHNSTTDQLMEIMTGGRFRHVPVEENGRLAGIISIGDVVK 131


>3fhmD [x.x.x] UNCHARACTERIZED PROTEIN ATU1752
          Length = 125

 Score = 42.0 bits (97), Expect = 1e-06
 Identities = 30/113 (26%), Positives = 55/113 (48%), Gaps = 5/113 (4%)

Query: 9   KNVICIKPGASILDAAKLMAQRNIGFLIVSSDCKRDLAGVISERDIIRAIA--SGIQPSE 66
           ++V+ + P  SI +AA  +    I            L G+ +ERD+++A+A        +
Sbjct: 13  RDVVTVGPDVSIGEAAGTLHAHKIXXXXXXXXXXXXL-GIFTERDLVKAVAGQGAASLQQ 71

Query: 67  PVDNIMTRKVVYVYKDTPVWEIARLMRKYNIRHILVMDNGQIFGVISIRDLLK 119
            V   MT+ VV    ++   ++  +M     RH+ V   G++ G+ISI D++K
Sbjct: 72  SVSVAMTKNVVRCQHNSTTDQLMEIMTGGRFRHVPV--EGRLAGIISIGDVVK 122


>2o16A [x.x.x] ACETOIN UTILIZATION PROTEIN ACUB, PUTATIVE
          Length = 132

 Score = 40.0 bits (92), Expect = 4e-06
 Identities = 31/112 (27%), Positives = 54/112 (48%), Gaps = 4/112 (3%)

Query: 22  DAAKLMAQRNIGFLIVSSDCKRDLAGVISERDIIRAIASGIQPSEPVDNIMTRKVVYVYK 81
           DA  LM   +I  + +  D  + L G++S+RD++ A  S +Q   P+  +M   V  V  
Sbjct: 25  DAKHLMEALDIRHVPIV-DANKKLLGIVSQRDLLAAQESSLQFETPLFEVMHTDVTSVAP 83

Query: 82  DTPVWEIARLMRKYNIRHILVMDNGQIFGVISIRDLLKESDVIERLVEYAEE 133
              + E A  M+K+ I  + V+    + G+I+  D +    +   L+E  EE
Sbjct: 84  QAGLKESAIYMQKHKIGCLPVVAKDVLVGIITDSDFV---TIAINLLELQEE 132


>1zfjA [c.1.5 - d.37.1 - d.37.1] INOSINE MONOPHOSPHATE DEHYDROGENASE
          Length = 463

 Score = 39.7 bits (91), Expect = 5e-06
 Identities = 32/125 (25%), Positives = 61/125 (48%), Gaps = 13/125 (10%)

Query: 14  IKPGASILDAAKLMAQRNIGFLIVSSDCKRDLAGVISERDIIRAIASGIQPSEPVDNIMT 73
           + P   + +A +L   R  G  IV +   R L G+I+ RD  R I+     + P+    +
Sbjct: 100 LTPEHKVSEAEELQRYRISGVPIVETLANRKLVGIITNRD--RFIS---DYNAPISEHTS 154

Query: 74  RKVVYVYKDTPVWEIARLMRKYNIRHILVMDN-GQIFGVISIRDLLKESDVIERLVEYAE 132
             +V     T +    R++ ++ I  + ++DN G++ G+I+I+D       IE+++E+  
Sbjct: 155 EHLVTAAVGTDLETAERILHEHRIEKLPLVDNSGRLSGLITIKD-------IEKVIEFPH 207

Query: 133 ERIDE 137
              DE
Sbjct: 208 AAKDE 212


>2yvzA [x.x.x] MG2+ TRANSPORTER MGTE
          Length = 244

 Score = 37.4 bits (85), Expect = 3e-05
 Identities = 32/86 (37%), Positives = 46/86 (53%), Gaps = 8/86 (9%)

Query: 34  FLIVSSDCKRDLAGVISERDIIRAIASGIQPSEPVDNIMTRKVVYVYKDTPVWEIARLMR 93
           + I   D K  L GV+S RD+I A      P   V  I   KVVYV  DT   E+ARL  
Sbjct: 163 YYIYVVDEKGRLKGVLSLRDLIVA-----DPRTRVAEI-NPKVVYVRTDTDQEEVARL-A 215

Query: 94  KYNIRHILVMD-NGQIFGVISIRDLL 118
            Y+   + V+D  G++ G++++ D+L
Sbjct: 216 DYDFTVLPVVDEEGRLVGIVTVDDVL 241


>2j9lA [x.x.x] CHLORIDE CHANNEL PROTEIN 5
          Length = 167

 Score = 36.2 bits (82), Expect = 6e-05
 Identities = 30/125 (24%), Positives = 51/125 (40%), Gaps = 25/125 (20%)

Query: 33  GFLIVSSDCKRDLAGVISERDIIRAIASGIQPSEPV------------------------ 68
           GF +V S   + L G +  RD+I +I +  +  + V                        
Sbjct: 42  GFPVVVSRESQRLVGFVLRRDLIISIENARKKQDGVVSTSIIYFTEHSXXXXXXXXXXXK 101

Query: 69  -DNIMTRKVVYVYKDTPVWEIARLMRKYNIRHILVMDNGQIFGVISIRDLLKESDVIERL 127
             NI+      V   TP+  +  + RK  +R  LV  NG++ G+I+ +D+LK    +   
Sbjct: 102 LRNILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLVTHNGRLLGIITKKDVLKHIAQMANF 161

Query: 128 VEYAE 132
            E+ E
Sbjct: 162 NEFLE 166


>1uipA [x.x.x] ADENOSINE DEAMINASE
          Length = 349

 Score = 35.4 bits (80), Expect = 1e-04
 Identities = 16/60 (26%), Positives = 30/60 (50%), Gaps = 2/60 (3%)

Query: 47  GVISERDIIRAIASGIQPSEPVDNIMTRKVVYVYKDTPVW--EIARLMRKYNIRHILVMD 104
           G ++  D++  +  G+Q  E    I  R ++   +  P W  E+  L +KYN + ++ MD
Sbjct: 119 GDVTPDDVVDLVNQGLQEGEQAFGIKVRSILCCMRHQPSWSLEVLELCKKYNQKTVVAMD 178


>1uioA [x.x.x] ADENOSINE DEAMINASE
          Length = 349

 Score = 35.4 bits (80), Expect = 1e-04
 Identities = 16/60 (26%), Positives = 30/60 (50%), Gaps = 2/60 (3%)

Query: 47  GVISERDIIRAIASGIQPSEPVDNIMTRKVVYVYKDTPVW--EIARLMRKYNIRHILVMD 104
           G ++  D++  +  G+Q  E    I  R ++   +  P W  E+  L +KYN + ++ MD
Sbjct: 119 GDVTPDDVVDLVNQGLQEGEQAFGIKVRSILCCMRHQPSWSLEVLELCKKYNQKTVVAMD 178


>1fkxA [x.x.x] ADENOSINE DEAMINASE
          Length = 349

 Score = 35.4 bits (80), Expect = 1e-04
 Identities = 16/60 (26%), Positives = 30/60 (50%), Gaps = 2/60 (3%)

Query: 47  GVISERDIIRAIASGIQPSEPVDNIMTRKVVYVYKDTPVW--EIARLMRKYNIRHILVMD 104
           G ++  D++  +  G+Q  E    I  R ++   +  P W  E+  L +KYN + ++ MD
Sbjct: 119 GDVTPDDVVDLVNQGLQEGEQAFGIKVRSILCCMRHQPSWSLEVLELCKKYNQKTVVAMD 178


>1fkwA [x.x.x] ADENOSINE DEAMINASE
          Length = 349

 Score = 35.4 bits (80), Expect = 1e-04
 Identities = 16/60 (26%), Positives = 30/60 (50%), Gaps = 2/60 (3%)

Query: 47  GVISERDIIRAIASGIQPSEPVDNIMTRKVVYVYKDTPVW--EIARLMRKYNIRHILVMD 104
           G ++  D++  +  G+Q  E    I  R ++   +  P W  E+  L +KYN + ++ MD
Sbjct: 119 GDVTPDDVVDLVNQGLQEGEQAFGIKVRSILCCMRHQPSWSLEVLELCKKYNQKTVVAMD 178


>1a4mA [c.1.9] ADENOSINE DEAMINASE
          Length = 349

 Score = 35.4 bits (80), Expect = 1e-04
 Identities = 16/60 (26%), Positives = 30/60 (50%), Gaps = 2/60 (3%)

Query: 47  GVISERDIIRAIASGIQPSEPVDNIMTRKVVYVYKDTPVW--EIARLMRKYNIRHILVMD 104
           G ++  D++  +  G+Q  E    I  R ++   +  P W  E+  L +KYN + ++ MD
Sbjct: 119 GDVTPDDVVDLVNQGLQEGEQAFGIKVRSILCCMRHQPSWSLEVLELCKKYNQKTVVAMD 178


>2j9lD [x.x.x] CHLORIDE CHANNEL PROTEIN 5
          Length = 171

 Score = 35.0 bits (79), Expect = 1e-04
 Identities = 28/112 (25%), Positives = 47/112 (41%), Gaps = 25/112 (22%)

Query: 33  GFLIVSSDCKRDLAGVISERDIIRAIASGIQPSEPV------------------------ 68
           GF +V S   + L G +  RD+I +I +  +  + V                        
Sbjct: 42  GFPVVVSRESQRLVGFVLRRDLIISIENARKKQDGVVSTSIIYFTEHSXXXXXXXXXXXK 101

Query: 69  -DNIMTRKVVYVYKDTPVWEIARLMRKYNIRHILVMDNGQIFGVISIRDLLK 119
             NI+      V   TP+  +  + RK  +R  LV  NG++ G+I+ +D+LK
Sbjct: 102 LRNILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLVTHNGRLLGIITKKDVLK 153


>2j9lC [x.x.x] CHLORIDE CHANNEL PROTEIN 5
          Length = 172

 Score = 35.0 bits (79), Expect = 1e-04
 Identities = 28/112 (25%), Positives = 47/112 (41%), Gaps = 25/112 (22%)

Query: 33  GFLIVSSDCKRDLAGVISERDIIRAIASGIQPSEPV------------------------ 68
           GF +V S   + L G +  RD+I +I +  +  + V                        
Sbjct: 42  GFPVVVSRESQRLVGFVLRRDLIISIENARKKQDGVVSTSIIYFTEHSXXXXXXXXXXXK 101

Query: 69  -DNIMTRKVVYVYKDTPVWEIARLMRKYNIRHILVMDNGQIFGVISIRDLLK 119
             NI+      V   TP+  +  + RK  +R  LV  NG++ G+I+ +D+LK
Sbjct: 102 LRNILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLVTHNGRLLGIITKKDVLK 153


>2j9lB [x.x.x] CHLORIDE CHANNEL PROTEIN 5
          Length = 171

 Score = 35.0 bits (79), Expect = 1e-04
 Identities = 28/112 (25%), Positives = 47/112 (41%), Gaps = 25/112 (22%)

Query: 33  GFLIVSSDCKRDLAGVISERDIIRAIASGIQPSEPV------------------------ 68
           GF +V S   + L G +  RD+I +I +  +  + V                        
Sbjct: 42  GFPVVVSRESQRLVGFVLRRDLIISIENARKKQDGVVSTSIIYFTEHSXXXXXXXXXXXK 101

Query: 69  -DNIMTRKVVYVYKDTPVWEIARLMRKYNIRHILVMDNGQIFGVISIRDLLK 119
             NI+      V   TP+  +  + RK  +R  LV  NG++ G+I+ +D+LK
Sbjct: 102 LRNILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLVTHNGRLLGIITKKDVLK 153


>2j9lF [x.x.x] CHLORIDE CHANNEL PROTEIN 5
          Length = 162

 Score = 34.3 bits (77), Expect = 2e-04
 Identities = 28/109 (25%), Positives = 48/109 (44%), Gaps = 22/109 (20%)

Query: 33  GFLIVSSDCKRDLAGVISERDIIRAIAS---GIQPSEPV-------------------DN 70
           GF +V S   + L G +  RD+I +I +   G+  +  +                    N
Sbjct: 42  GFPVVVSRESQRLVGFVLRRDLIISIENARKGVVSTSIIYFTEHSXXXXXXXXXXXKLRN 101

Query: 71  IMTRKVVYVYKDTPVWEIARLMRKYNIRHILVMDNGQIFGVISIRDLLK 119
           I+      V   TP+  +  + RK  +R  LV  NG++ G+I+ +D+LK
Sbjct: 102 ILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLVTHNGRLLGIITKKDVLK 150


>2o16B [x.x.x] ACETOIN UTILIZATION PROTEIN ACUB, PUTATIVE
          Length = 135

 Score = 33.9 bits (76), Expect = 3e-04
 Identities = 31/113 (27%), Positives = 53/113 (46%), Gaps = 5/113 (4%)

Query: 22  DAAKLMAQRNIGFLIVSSDCKRDLAGVISERDIIRAIASGIQPSE-PVDNIMTRKVVYVY 80
           DA  LM   +I  + +  D  + L G++S+RD++ A  S     E P+  +M   V  V 
Sbjct: 24  DAKHLMEALDIRHVPIV-DANKKLLGIVSQRDLLAAQESSSLAFETPLFEVMHTDVTSVA 82

Query: 81  KDTPVWEIARLMRKYNIRHILVMDNGQIFGVISIRDLLKESDVIERLVEYAEE 133
               + E A  M+K+ I  + V+    + G+I+  D +    +   L+E  EE
Sbjct: 83  PQAGLKESAIYMQKHKIGCLPVVAKDVLVGIITDSDFV---TIAINLLELQEE 132


>3ddjA [x.x.x] CBS DOMAIN-CONTAINING PROTEIN
          Length = 270

 Score = 32.3 bits (72), Expect = 9e-04
 Identities = 21/91 (23%), Positives = 49/91 (53%), Gaps = 3/91 (3%)

Query: 30  RNIGFLIVSSDCKRDLAGVISERDIIRAIASGIQPSEPVDNIMTRKVVYVYKDTPVWEIA 89
           RN G L V  D      G+++ER+ +  +   +    PV  + + KV  +YK+  + +  
Sbjct: 102 RNFGSLPVV-DINDKPVGIVTEREFL-LLYKDLDEIFPV-KVFSTKVQTIYKEVRLDQAV 158

Query: 90  RLMRKYNIRHILVMDNGQIFGVISIRDLLKE 120
           +L+R+   R  ++ D+ ++ G++++ + +K+
Sbjct: 159 KLLRRGFRRLPVIDDDNKVVGIVTVVNAIKQ 189


>2bj9A [x.x.x] NICKEL RESPONSIVE REGULATOR
          Length = 133

 Score = 32.3 bits (72), Expect = 9e-04
 Identities = 18/51 (35%), Positives = 29/51 (56%)

Query: 88  IARLMRKYNIRHILVMDNGQIFGVISIRDLLKESDVIERLVEYAEERIDEI 138
           I  L+R + IRH   + N ++ G I+I     E DV++ L++   E +DEI
Sbjct: 34  IRDLIRDFIIRHEWEVGNEEVAGTITIVYNHDEGDVVKALLDLQHEYLDEI 84


>2bj7A [x.x.x] NICKEL RESPONSIVE REGULATOR
          Length = 136

 Score = 32.3 bits (72), Expect = 9e-04
 Identities = 18/51 (35%), Positives = 29/51 (56%)

Query: 88  IARLMRKYNIRHILVMDNGQIFGVISIRDLLKESDVIERLVEYAEERIDEI 138
           I  L+R + IRH   + N ++ G I+I     E DV++ L++   E +DEI
Sbjct: 34  IRDLIRDFIIRHEWEVGNEEVAGTITIVYNHDEGDVVKALLDLQHEYLDEI 84


>2bj3C [x.x.x] NICKEL RESPONSIVE REGULATOR
          Length = 138

 Score = 32.3 bits (72), Expect = 9e-04
 Identities = 18/51 (35%), Positives = 29/51 (56%)

Query: 88  IARLMRKYNIRHILVMDNGQIFGVISIRDLLKESDVIERLVEYAEERIDEI 138
           I  L+R + IRH   + N ++ G I+I     E DV++ L++   E +DEI
Sbjct: 34  IRDLIRDFIIRHEWEVGNEEVAGTITIVYNHDEGDVVKALLDLQHEYLDEI 84


>2bj3B [x.x.x] NICKEL RESPONSIVE REGULATOR
          Length = 137

 Score = 32.3 bits (72), Expect = 9e-04
 Identities = 18/51 (35%), Positives = 29/51 (56%)

Query: 88  IARLMRKYNIRHILVMDNGQIFGVISIRDLLKESDVIERLVEYAEERIDEI 138
           I  L+R + IRH   + N ++ G I+I     E DV++ L++   E +DEI
Sbjct: 33  IRDLIRDFIIRHEWEVGNEEVAGTITIVYNHDEGDVVKALLDLQHEYLDEI 83


>2bj3A [x.x.x] NICKEL RESPONSIVE REGULATOR
          Length = 135

 Score = 32.3 bits (72), Expect = 9e-04
 Identities = 18/51 (35%), Positives = 29/51 (56%)

Query: 88  IARLMRKYNIRHILVMDNGQIFGVISIRDLLKESDVIERLVEYAEERIDEI 138
           I  L+R + IRH   + N ++ G I+I     E DV++ L++   E +DEI
Sbjct: 34  IRDLIRDFIIRHEWEVGNEEVAGTITIVYNHDEGDVVKALLDLQHEYLDEI 84


>2bj1A [x.x.x] NICKEL RESPONSIVE REGULATOR
          Length = 132

 Score = 32.3 bits (72), Expect = 9e-04
 Identities = 18/51 (35%), Positives = 29/51 (56%)

Query: 88  IARLMRKYNIRHILVMDNGQIFGVISIRDLLKESDVIERLVEYAEERIDEI 138
           I  L+R + IRH   + N ++ G I+I     E DV++ L++   E +DEI
Sbjct: 34  IRDLIRDFIIRHEWEVGNEEVAGTITIVYNHDEGDVVKALLDLQHEYLDEI 84


  Database: 95pdb09Oct16x
    Posted date:  Nov 2, 2009  3:15 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.322    0.136    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 732,149,051
Number of extensions: 30106660
Number of successful extensions: 73101
Number of sequences better than 1.0e-03: 1287
Number of HSP's gapped: 71278
Number of HSP's successfully gapped: 1765
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.4 bits)