BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= AAL64389.1 paer1 AAL64389.1 GIB00076CH01 "conserved
hypothetical protein"
         (667 letters)

Database: sws57.9x 
           510,076 sequences; 179,409,320 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YYAL_BACSU RecName: Full=Uncharacterized protein yyaL;                277   2e-76
YP65_CAEEL RecName: Full=Uncharacterized protein B0495.5;             219   4e-59
SPT20_RAT RecName: Full=Spermatogenesis-associated protein 20;Al...   212   9e-57
SPT20_HUMAN RecName: Full=Spermatogenesis-associated protein 20;...   211   2e-56
SPT20_MOUSE RecName: Full=Spermatogenesis-associated protein 20;...   210   3e-56
YYAO_BACSU RecName: Full=Uncharacterized protein yyaO;                 50   6e-08
DSBD_CAMJR RecName: Full=Thiol:disulfide interchange protein dsb...    37   6e-04
DSBD_CAMJE RecName: Full=Thiol:disulfide interchange protein dsb...    37   6e-04

>YYAL_BACSU RecName: Full=Uncharacterized protein yyaL;
          Length = 689

 Score =  277 bits (708), Expect = 2e-76
 Identities = 202/686 (29%), Positives = 306/686 (44%), Gaps = 49/686 (7%)

Query: 8   LSSSSSPFVLEGLKSRVKWWGWCKEAFEAAEREDKPVLVDVGAVWCHWCHVMDERTYNDE 67
           L +  SP++L+   + V W+ W +EAFE A+RE+KPVLV +G   CHWCHVM   ++ DE
Sbjct: 10  LINEKSPYLLQHAHNPVDWFPWGEEAFEKAKRENKPVLVSIGYSTCHWCHVMAHESFEDE 69

Query: 68  EVAEFINKHFIPXXXXXXXXXXXXXXLQEAAQLISGQSGWPLTVFMTPKGQVIWAATYLP 127
           E+A  +N+ F+                    QL++GQ GWPL VF+TP  +  +A TY P
Sbjct: 70  EIARLLNERFVAIKVDREERPDVDSVYMRICQLMTGQGGWPLNVFITPDQKPFYAGTYFP 129

Query: 128 PRREMGLPGMLEVLEAVLRAYREKRGEVEKFHEDLARELKKWHSPSPGEPRREGQAE-VL 186
              +   PG ++VLE +   +   R  VE   E+ A+ L+   +   GE   E       
Sbjct: 130 KTSKFNRPGFVDVLEHLSETFANDREHVEDIAENAAKHLQTKTAAKTGEGLSESAIHRTF 189

Query: 187 AALAASFDEEYGGFGGAPKFPPITQLELLMMRHFYDGVGIYGKMAERTLDAMALGGVYDQ 246
             LA+ FD  YGGFG APKFP    L  L+      G         +TLD+MA GG+YD 
Sbjct: 190 QQLASGFDTIYGGFGQAPKFPMPHMLMYLLRYDHNTGQENALYNVTKTLDSMANGGIYDH 249

Query: 247 LLGGFFRYSTDRSWLIPHYEKLLIDNAELLAVYTKAYRQFGKALYKRTAEGIVKWLDEFM 306
           +  GF RYSTD  WL+PH+EK+L DNA LL  YT+AY+    + YK   E I+ ++   M
Sbjct: 250 IGYGFARYSTDDEWLVPHFEKMLYDNALLLTAYTEAYQVTQNSRYKEICEQIITFIQREM 309

Query: 307 RAPEGGYYASQDADVDGEEGGYYRWS--------XXXXXXXXXXXYPVASK--------- 349
              +G ++++ DAD +GEEG YY WS                   Y +  +         
Sbjct: 310 THEDGSFFSALDADTEGEEGKYYVWSKEEILKTLGDDLGTLYCQVYDITEEGNFEGKNIP 369

Query: 350 ---HFGLEEYPWPEGKATLRVARPLEGPEAERIYQILIEARRKRKPPFTDTTVYVGWSCA 406
              H   E+     G     ++  LE        Q L++ R +R  P  D  V   W+ A
Sbjct: 370 NLIHTKREQIKEDAGLTEKELSLKLEDAR-----QQLLKTREERTYPHVDDKVLTSWN-A 423

Query: 407 MAYAELLASRLASVGNKY-----HAVRTLERFGVEXXXXXXXXXXXXXXXXXXIAALEDY 461
           +  A L  +       KY      A+  +E    +                     ++DY
Sbjct: 424 LMIAGLAKAAKVYQEPKYLSLAKDAITFIEN---KLIIDGRVMVRYRDGEVKNKGFIDDY 480

Query: 462 AYCILAWIEGYSHTAKLEFLKVAESAGEILLAKFLEE--GGFKDVETVDEIIPTPNYPAL 519
           A+ + A+++ Y  +  L +L+ A+   + +++ F +E  GGF       E +        
Sbjct: 481 AFLLWAYLDLYEASFDLSYLQKAKKLTDDMISLFWDEEHGGFYFTGHDAEALIVREKEVY 540

Query: 520 DTPNFSGNAVAAIALATLSEVTGDAKYKEAAYRAVSALYGKMERVGPAASGLWIALDLLT 579
           D    SGN+VAA+ L  L +VTGD    E A    S     +E   P+    ++   L  
Sbjct: 541 DGAVPSGNSVAAVQLLRLGQVTGDLSLIEKAETMFSVFKPDIEAY-PSGHAFFMQSVLRH 599

Query: 580 LGVPRTVIVGES------PELITAALRAYRPWHVVVPITGNWPYKDPAVRA----MLNGP 629
           L   + +++  S       ++I    +A++P   ++        KD A  A    +++G 
Sbjct: 600 LMPKKEIVIFGSADDPARKQIIAELQKAFKPNDSILVAEQPEQCKDIAPFAADYRIIDG- 658

Query: 630 KPAAYICAGGACSLPVREPERLEKTI 655
           K   YIC   AC  P    E    T+
Sbjct: 659 KTTVYICENFACQQPTTNIEEAIHTL 684


>YP65_CAEEL RecName: Full=Uncharacterized protein B0495.5;
          Length = 729

 Score =  219 bits (559), Expect = 4e-59
 Identities = 173/711 (24%), Positives = 297/711 (41%), Gaps = 62/711 (8%)

Query: 8   LSSSSSPFVLEGLKSRVKWWGWCKEAFEAAEREDKPVLVDVGAVWCHWCHVMDERTYNDE 67
           L    SP++L+   + + W+ W +EAF+ A+  +KP+ + VG   CHWCHVM++ ++ +E
Sbjct: 21  LGQEKSPYLLQHANNPIDWYPWGQEAFQKAKDNNKPIFLSVGYSTCHWCHVMEKESFENE 80

Query: 68  EVAEFINKHFIPXXXXXXXXXXXXXXLQEAAQLISGQSGWPLTVFMTPKGQVIWAATYLP 127
             A+ +N +F+                       SG  GWP++VF+TP    I   TY P
Sbjct: 81  ATAKILNDNFVAIKVDREERPDVDKLYMAFVVASSGHGGWPMSVFLTPDLHPITGGTYFP 140

Query: 128 PRREMGLPGMLEVLEAVLRAYREKRGEVEKFHEDLARELKKWHSPSPGEPRREGQAEVLA 187
           P    G+ G   +L  +   ++++   +++    + + L+   +        E    + +
Sbjct: 141 PDDNRGMLGFPTILNMIHTEWKKEGESLKQRGAQIIKLLQPETASGDVNRSEEVFKSIYS 200

Query: 188 ALAASFDEEYGGFGGAPKFPPITQLELLMMRHFYDGVGIYGK----MAERTLDAMALGGV 243
              +SFD   GGFG APKFP    L+ L+     +      K    M ++TL++MA GG+
Sbjct: 201 HKQSSFDSRLGGFGRAPKFPKACDLDFLITFAASENESEKAKDSIMMLQKTLESMADGGI 260

Query: 244 YDQLLGGFFRYSTDRSWLIPHYEKLLIDNAELLAVYTKAYRQFGKA--LYKRTAEGIVKW 301
           +D +  GF RYS    W IPH+EK+L D ++LLA Y+  ++   +     K     I ++
Sbjct: 261 HDHIGNGFHRYSVGSEWHIPHFEKMLYDQSQLLATYSDFHKLTERKHDNVKHVINDIYQY 320

Query: 302 LDEFMRAPEGGYYASQDAD-------VDGEEGGYYRWS-------XXXXXXXXXXXYPVA 347
           + +     +GG+YA++DAD        +  EG +  W                   + V 
Sbjct: 321 MQKISH-KDGGFYAAEDADSLPNHNSSNKVEGAFCAWEKEEIKQLLGDKKIGSASLFDVV 379

Query: 348 SKHFGLEEY--------PWPEGKATLRVARPLEGPEA---------------ERIYQILI 384
           + +F +E+         P  E K    + + L   E                +   +IL 
Sbjct: 380 ADYFDVEDSGNVARSSDPHGELKNKNVLRKLLTDEECATNHEISVAELKKGIDEAKEILW 439

Query: 385 EARRKRKPPFTDTTVYVGWSCAMAYAELLASRLASVGNKY--HAVRTLERFG-------- 434
            AR +R  P  D+ +   W   +A   L+ +  A+   KY   A +  E  G        
Sbjct: 440 NARTQRPSPHLDSKMVTSWQ-GLAITGLVKAYQATEETKYLDRAEKCAEFIGKFLDDNGE 498

Query: 435 VEXXXXXXXXXXXXXXXXXXIAALEDYAYCILAWIEGYSHTAKLEFLKVAESAGEILLAK 494
           +                    A  +DYA+ I A ++ Y+   K E+LK A    +I   K
Sbjct: 499 LRRSVYLGANGEVEQGNQEIRAFSDDYAFLIQALLDLYTTVGKDEYLKKAVELQKICDVK 558

Query: 495 FLEEGGFKDVETVDEIIPTPNYPALDTPNFSGNAVAAIALATLSEVTGDAKYKEAAYRAV 554
           F    G+   E  DE +        D    +  ++A+  L  L ++    +Y+E A +  
Sbjct: 559 FWNGNGYFISEKTDEDVSVRMIEDQDGAEPTATSIASNNLLRLYDILEKEEYREKANQCF 618

Query: 555 SALYGKMERVGPAASGLWIALDLLTLGVPRTVIVGESPELITAALRAYRPWH-------V 607
                ++  V  A   + +AL    +G    V+VG+    + +  R+            V
Sbjct: 619 RGASERLNTVPIALPKMAVALHRWQIGSTTFVLVGDPKSELLSETRSRLNQKFLNNLSVV 678

Query: 608 VVPITGNWPYKDPAVRAMLNGPKPAAYICAGGACSLPVREPERLEKTIEEF 658
            +    +     P+ +AM  GPKPA Y+C G  C  PV+  + LE+   +F
Sbjct: 679 HIQSEEDLSASGPSHKAMAEGPKPAVYMCKGFVCDRPVKAIQELEELFNKF 729


>SPT20_RAT RecName: Full=Spermatogenesis-associated protein
           20;AltName: Full=Sperm-specific protein 411;       
           Short=Ssp411;
          Length = 789

 Score =  212 bits (539), Expect = 9e-57
 Identities = 187/727 (25%), Positives = 299/727 (41%), Gaps = 82/727 (11%)

Query: 8   LSSSSSPFVLEGLKSRVKWWGWCKEAFEAAEREDKPVLVDVGAVWCHWCHVMDERTYNDE 67
           L +  SP++L+   + V W+ W +EAF+ A++E+KP+ + VG   CHWCH+M+E ++ +E
Sbjct: 68  LINEKSPYLLQHAHNPVDWYPWGQEAFDKAKKENKPIFLSVGYSTCHWCHMMEEESFQNE 127

Query: 68  EVAEFINKHFIPXXXXXXXXXXXXXXLQEAAQLISGQSGWPLTVFMTPKGQVIWAATYLP 127
           E+   +N++F+                    Q  S   GWP+ V++TP  Q     TY P
Sbjct: 128 EIGHLLNENFVSVMVDREERPDVDKVYMTFVQATSSGGGWPMNVWLTPSLQPFVGGTYFP 187

Query: 128 PRREMGLPGMLEVLEAVLRAYREKRGEVEKFHEDLARELKKWHSPSPGEPRREGQAEVLA 187
           P   +   G   VL  +   +++ +  + +  + +   L      S G+ +    A  + 
Sbjct: 188 PEDGLTRVGFRTVLMRICDQWKQNKNTLLENSQRVTTALLARSEISVGDRQLPPSAATMN 247

Query: 188 A-----LAASFDEEYGGFGGAPKFPPITQLELLMMRHFYDGVGIYG----KMAERTLDAM 238
           +     L   +DEEYGGF  APKFP    L  L        V   G    +MA  TL  M
Sbjct: 248 SRCFQQLDEGYDEEYGGFAEAPKFPTPVILNFLFSYWLSHRVTQDGSRAQQMALHTLKMM 307

Query: 239 ALGGVYDQLLGGFFRYSTDRSWLIPHYEKLLIDNAELLAVYTKAYRQFGKALYKRTAEGI 298
           A GG+ D +  GF RYSTDR W IPH+EK+L D A+L  VY +A++  G   +   A+GI
Sbjct: 308 ANGGIRDHVGQGFHRYSTDRQWHIPHFEKMLYDQAQLSVVYCQAFQISGDEFFSDVAKGI 367

Query: 299 VKWLDEFMRAPEGGYYASQDAD------VDGEEGGYYRWSXXXXXXXXXXXYPVAS---- 348
           ++++   +    GG+Y+++DAD      V  +EG  Y W+              AS    
Sbjct: 368 LQYVTRNLSHRSGGFYSAEDADSPPERGVKPQEGALYLWTVKEVQQLLPEPVGGASEPLT 427

Query: 349 ------KHFGLEE----YPWPE------GKATLRVARPLE------GPEAERIYQI---- 382
                 KH+GL E     P  +      G+  L V   LE      G E E +  +    
Sbjct: 428 SGQLLMKHYGLSEAGNINPTQDVNGEMHGQNVLTVRDSLELTGARYGLEVEAVRALLNTG 487

Query: 383 ---LIEARRKRKPPFTDTTVYVGWSCAMAYAELLASRLAS----VGNKYHAVRTLERF-- 433
              L +AR+ R     D  +   W+  M     +A  +      V    +  + L+R   
Sbjct: 488 LEKLFQARKHRPKAHLDNKMLAAWNGLMVSGFAVAGSVLGMEKLVTQATNGAKFLKRHMF 547

Query: 434 -----GVEXXXXXXXXXXXXXXXXXXIAALEDYAYCILAWIEGYSHTAKLEFLKVAESAG 488
                 ++                     LEDYA+ +   ++ Y  + +  +L+ A    
Sbjct: 548 DVSSGRLKRTCYAGAGGTVEQSNPPCWGFLEDYAFVVRGLLDLYEASQESSWLEWALRLQ 607

Query: 489 EILLAKFLEEGG---FKDVETVDEIIPTPNYPALDTPNFSGNAVAAIALATLSEVTGDAK 545
           +I    F +  G   F     +   +P       D    S N+V+A  L  L  +TG   
Sbjct: 608 DIQDKLFWDSHGGGYFCSEAELGTDLPLRLKDDQDGAEPSANSVSAHNLLRLHGLTGHKD 667

Query: 546 YKEAAYRAVSALYGKMERVGPAASGLWIALDLLTLGVPRTVIVGESPELITAAL-----R 600
           + +     ++A   +M RV  A   +  AL      + + VI G+     T AL      
Sbjct: 668 WMDKCVCLLTAFSERMRRVPVALPEMVRALSAQQQTLKQIVICGDPQAKDTKALLQCVHS 727

Query: 601 AYRPWHVVVPITGNWPYKDPAVRAMLNGP----------KPAAYICAGGACSLPVREPER 650
            Y P  V++   G     DP+       P          +   YI    ACS+P+ +P  
Sbjct: 728 IYIPNKVLILADG-----DPSSFLSRQLPFLSNLRRVEDRATVYIFENQACSMPITDPCE 782

Query: 651 LEKTIEE 657
           L K + +
Sbjct: 783 LRKLLHQ 789


>SPT20_HUMAN RecName: Full=Spermatogenesis-associated protein
           20;AltName: Full=Sperm-specific protein 411;       
           Short=Ssp411;Flags: Precursor;
          Length = 786

 Score =  211 bits (536), Expect = 2e-56
 Identities = 191/726 (26%), Positives = 294/726 (40%), Gaps = 84/726 (11%)

Query: 8   LSSSSSPFVLEGLKSRVKWWGWCKEAFEAAEREDKPVLVDVGAVWCHWCHVMDERTYNDE 67
           L    SP++L+   + V W+ W +EAF+ A +E+KP+ + VG   CHWCH+M+E ++ +E
Sbjct: 65  LIHEKSPYLLQHAYNPVDWYPWGQEAFDKARKENKPIFLSVGYSTCHWCHMMEEESFQNE 124

Query: 68  EVAEFINKHFIPXXXXXXXXXXXXXXLQEAAQLISGQSGWPLTVFMTPKGQVIWAATYLP 127
           E+   +++ F+                    Q  S   GWP+ V++TP  Q     TY P
Sbjct: 125 EIGRLLSEDFVSVKVDREERPDVDKVYMTFVQATSSGGGWPMNVWLTPNLQPFVGGTYFP 184

Query: 128 PRREMGLPGMLEVLEAVLRAYREKRGEVEKFHEDLARELKKWHSPSPGEPRREGQAEVL- 186
           P   +   G   VL  +   +++ +  + +  + +   L      S G+ +    A  + 
Sbjct: 185 PEDGLTRVGFRTVLLRIREQWKQNKNTLLENSQRVTTALLARSEISVGDRQLPPSAATVN 244

Query: 187 ----AALAASFDEEYGGFGGAPKFPPITQLELLMM-----RHFYDGVGIYGKMAERTLDA 237
                 L   +DEEYGGF  APKFP    L  L       R   DG     +MA  TL  
Sbjct: 245 NRCFQQLDEGYDEEYGGFAEAPKFPTPVILSFLFSYWLSHRLTQDGSRAQ-QMALHTLKM 303

Query: 238 MALGGVYDQLLGGFFRYSTDRSWLIPHYEKLLIDNAELLAVYTKAYRQFGKALYKRTAEG 297
           MA GG+ D +  GF RYSTDR W +PH+EK+L D A+L   Y++A++  G   Y   A+G
Sbjct: 304 MANGGIRDHVGQGFHRYSTDRQWHVPHFEKMLYDQAQLAVAYSQAFQLSGDEFYSDVAKG 363

Query: 298 IVKWLDEFMRAPEGGYYASQDADVDGE------EGGYYRWSXXXXXXXXXXXY-----PV 346
           I++++   +    GG+Y+++DAD   E      EG YY W+                 P+
Sbjct: 364 ILQYVARSLSHRSGGFYSAEDADSPPERGQRPKEGAYYVWTVKEVQQLLPEPVLGATEPL 423

Query: 347 AS-----KHFGLEEY--------PWPE--GKATLRVARPLE------GPEAERIYQI--- 382
            S     KH+GL E         P  E  G+  L V   LE      G + E +  +   
Sbjct: 424 TSGQLLMKHYGLTEAGNISPSQDPKGELQGQNVLTVRYSLELTAARFGLDVEAVRTLLNS 483

Query: 383 ----LIEARRKRKPPFTDTTVYVGWS------CAMAYAELLASRLASVGNKYHAVRTLER 432
               L +AR+ R  P  D+ +   W+       A+  A L   RL +             
Sbjct: 484 GLEKLFQARKHRPKPHLDSKMLAAWNGLMVSGYAVTGAVLGQDRLINYATNGAKFLKRHM 543

Query: 433 FGVEXXXXXXXXXXXXXXXXXXI-----AALEDYAYCILAWIEGY---SHTAKLEFLKVA 484
           F V                           LEDYA+ +   ++ Y     +A LE+    
Sbjct: 544 FDVASGRLMRTCYTGPGGTVEHSNPPCWGFLEDYAFVVRGLLDLYEASQESAWLEWALRL 603

Query: 485 ESAGEILLAKFLEEGGFKDVETVDEIIPTPNYPALDTPNFSGNAVAAIALATLSEVTGDA 544
           +   + L       G F     +   +P       D    S N+V+A  L  L   TG  
Sbjct: 604 QDTQDRLFWDSQGGGYFCSEAELGAGLPLRLKDDQDGAEPSANSVSAHNLLRLHGFTGHK 663

Query: 545 KYKEAAYRAVSALYGKMERVGPAASGLWIALDLLTLGVPRTVIVGESPELITAAL----- 599
            + +     ++A   +M RV  A   +  AL      + + VI G+     T AL     
Sbjct: 664 DWMDKCVCLLTAFSERMRRVPVALPEMVRALSAQQQTLKQIVICGDRQAKDTKALVQCVH 723

Query: 600 RAYRPWHVVVPITGNWPYKDPAVRAMLNGP----------KPAAYICAGGACSLPVREPE 649
             Y P  V++   G     DP+       P          +  AY+C   ACS+P+ +P 
Sbjct: 724 SVYIPNKVLILADG-----DPSSFLSRQLPFLSTLRRLEDQATAYVCENQACSVPITDPC 778

Query: 650 RLEKTI 655
            L K +
Sbjct: 779 ELRKLL 784


>SPT20_MOUSE RecName: Full=Spermatogenesis-associated protein
           20;AltName: Full=Transcript increased in spermiogenesis
           78 protein;AltName: Full=Sperm-specific protein 411;
          Length = 790

 Score =  210 bits (535), Expect = 3e-56
 Identities = 187/726 (25%), Positives = 297/726 (40%), Gaps = 80/726 (11%)

Query: 8   LSSSSSPFVLEGLKSRVKWWGWCKEAFEAAEREDKPVLVDVGAVWCHWCHVMDERTYNDE 67
           L +  SP++L+   + V W+ W +EAF+ A++E+KP+ + VG   CHWCH+M+E ++ +E
Sbjct: 69  LINEKSPYLLQHAYNPVDWYPWGQEAFDKAKKENKPIFLSVGYSTCHWCHMMEEESFQNE 128

Query: 68  EVAEFINKHFIPXXXXXXXXXXXXXXLQEAAQLISGQSGWPLTVFMTPKGQVIWAATYLP 127
           E+   +N++FI                    Q  S   GWP+ V++TP  Q     TY P
Sbjct: 129 EIGRLLNENFICVMVDREERPDVDKVYMTFVQATSSGGGWPMNVWLTPGLQPFVGGTYFP 188

Query: 128 PRREMGLPGMLEVLEAVLRAYREKRGEVEKFHEDLARELKKWHSPSPGEPRREGQAEVLA 187
           P   +   G   VL  +   ++  +  + +  + +   L      S G+ +    A  + 
Sbjct: 189 PEDGLTRVGFRTVLMRICDQWKLNKNTLLENSQRVTTALLARSEISVGDRQIPASAATMN 248

Query: 188 A-----LAASFDEEYGGFGGAPKFPPITQLELLMM-----RHFYDGVGIYGKMAERTLDA 237
           +     L   +DEEYGGF  APKFP    L  L       R   DG     +MA  TL  
Sbjct: 249 SRCFQQLDEGYDEEYGGFAEAPKFPTPVILNFLFSYWLSHRLTQDGSRAQ-QMALHTLKM 307

Query: 238 MALGGVYDQLLGGFFRYSTDRSWLIPHYEKLLIDNAELLAVYTKAYRQFGKALYKRTAEG 297
           MA GG+ D +  GF RYSTDR W IPH+EK+L D A+L  VYT+A++  G   Y   A+G
Sbjct: 308 MANGGIQDHVGQGFHRYSTDRQWHIPHFEKMLYDQAQLSVVYTQAFQISGDEFYADVAKG 367

Query: 298 IVKWLDEFMRAPEGGYYASQDAD------VDGEEGGYYRWSXXXXXXXXXXXYPVAS--- 348
           I++++   +    GG+Y+++DAD      +  +EG YY W+              AS   
Sbjct: 368 ILQYVTRTLSHRSGGFYSAEDADSPPERGMKPQEGAYYVWTVKEVQQLLPEPVVGASEPL 427

Query: 349 -------KHFGLEEY--------PWPE--GKATLRVARPLE------GPEAERIYQI--- 382
                  KH+GL E         P  E  G+  L V   LE      G E E +  +   
Sbjct: 428 TSGQLLMKHYGLSEVGNINSSQDPNGELHGQNVLMVRYSLELTAARYGLEVEAVRALLNT 487

Query: 383 ----LIEARRKRKPPFTDTTVYVGWS-----------CAMAYAELLASRLASVGNKYHAV 427
               L +AR+ R     D  +   W+            A+   +L+A   +        +
Sbjct: 488 GLEKLFQARKHRPKAHLDNKMLAAWNGLMVSGFAVTGAALGMEKLVAQATSGAKFLKRHM 547

Query: 428 RTLERFGVEXXXXXXXXXXXXXXXXXXIAALEDYAYCILAWIEGYSHTAKLEFLKVAESA 487
             +    ++                     LEDYA+ +   ++ Y  + +  +L+ A   
Sbjct: 548 FDVSSGRLKRTCYAGTGGTVEQSNPPCWGFLEDYAFVVRGLLDLYEASQESSWLEWALRL 607

Query: 488 GEILLAKFLEEGG---FKDVETVDEIIPTPNYPALDTPNFSGNAVAAIALATLSEVTGDA 544
            +     F +  G   F     +   +P       D    S N+V+A  L  L   TG  
Sbjct: 608 QDTQDKLFWDPRGGGYFCSEAELGADLPLRLKDDQDGAEPSANSVSAHNLLRLHSFTGHK 667

Query: 545 KYKEAAYRAVSALYGKMERVGPAASGLWIALDLLTLGVPRTVIVGESPELITAAL----- 599
            + +     ++A   +M RV  A   +   L      + + VI G+     T AL     
Sbjct: 668 DWMDKCVCLLTAFSERMRRVPVALPEMVRTLSAQQQTLKQIVICGDPQAKDTKALLQCVH 727

Query: 600 RAYRPWHVVVPITGN--------WPYKDPAVRAMLNGPKPAAYICAGGACSLPVREPERL 651
             Y P  V++   G+         P+     R      +   YI    ACS+P+ +P  L
Sbjct: 728 SIYVPNKVLILADGDPSSFLSRQLPFLSSLRRV---EDRATVYIFENQACSMPITDPCEL 784

Query: 652 EKTIEE 657
            K + +
Sbjct: 785 RKLLHQ 790


>YYAO_BACSU RecName: Full=Uncharacterized protein yyaO;
          Length = 79

 Score = 50.1 bits (118), Expect = 6e-08
 Identities = 22/49 (44%), Positives = 33/49 (67%), Gaps = 1/49 (2%)

Query: 8  LSSSSSPFVLEGLKSRVKWWGWCKEAFEAAEREDKPVLVDVG-AVWCHW 55
          L +  SP++L+   + V W+ W +EAF  A+RE+KPVLV +G +  CHW
Sbjct: 10 LIAEKSPYLLQHAHNPVDWFPWGEEAFAKAKRENKPVLVSIGYSTTCHW 58


>DSBD_CAMJR RecName: Full=Thiol:disulfide interchange protein dsbD; 
                  EC=1.8.1.8;AltName: Full=Protein-disulfide
           reductase;         Short=Disulfide reductase;
          Length = 567

 Score = 36.6 bits (83), Expect = 6e-04
 Identities = 12/30 (40%), Positives = 21/30 (70%)

Query: 42  KPVLVDVGAVWCHWCHVMDERTYNDEEVAE 71
           KP+++D  A WC  C ++DE T++DE + +
Sbjct: 477 KPIMLDFTASWCENCKLLDELTFSDERIIQ 506


>DSBD_CAMJE RecName: Full=Thiol:disulfide interchange protein dsbD; 
                  EC=1.8.1.8;AltName: Full=Protein-disulfide
           reductase;         Short=Disulfide reductase;
          Length = 567

 Score = 36.6 bits (83), Expect = 6e-04
 Identities = 12/30 (40%), Positives = 21/30 (70%)

Query: 42  KPVLVDVGAVWCHWCHVMDERTYNDEEVAE 71
           KP+++D  A WC  C ++DE T++DE + +
Sbjct: 477 KPIMLDFTASWCENCKLLDELTFSDERIIQ 506


  Database: sws57.9x
    Posted date:  Nov 5, 2009 10:46 AM
  Number of letters in database: 179,409,320
  Number of sequences in database:  510,076
  
Lambda     K      H
   0.328    0.144    0.418 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 510076
Number of Hits to DB: 7,079,330,201
Number of extensions: 287975709
Number of successful extensions: 755370
Number of sequences better than 1.0e-03: 14495
Number of HSP's gapped: 740550
Number of HSP's successfully gapped: 17410
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)