BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= AAL64946.1 paer1 AAL64946.1 GIB00076CH01 "indolepyruvate
ferredoxin oxidoreductase alpha s.."
         (390 letters)

Database: sws57.9x 
           510,076 sequences; 179,409,320 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

IORA_PYRAB RecName: Full=Indolepyruvate oxidoreductase subunit i...   181   1e-47
IORA_ARCFU RecName: Full=Indolepyruvate oxidoreductase subunit i...   179   4e-47
IORA_PYRKO RecName: Full=Indolepyruvate oxidoreductase subunit i...   179   5e-47
IORA_PYRHO RecName: Full=Indolepyruvate oxidoreductase subunit i...   164   1e-42
IORA_METTH RecName: Full=Indolepyruvate oxidoreductase subunit i...   152   5e-39
Y514_METJA RecName: Full=Uncharacterized polyferredoxin-like pro...    57   3e-10
FWDF_METJA RecName: Full=Polyferredoxin protein fwdF;                  57   4e-10
MVHB_METFE RecName: Full=Polyferredoxin protein mvhB;                  55   1e-09
FER_METTE RecName: Full=Probable ferredoxin;                           49   6e-08
MVHB_METTH RecName: Full=Polyferredoxin protein mvhB;                  49   1e-07
Y1303_METJA RecName: Full=Uncharacterized polyferredoxin-like pr...    48   1e-07
VORD_PYRFU RecName: Full=Ketoisovalerate oxidoreductase subunit ...    47   2e-07
Y870_METJA RecName: Full=Uncharacterized protein MJ0870;               47   3e-07
VORD_PYRAB RecName: Full=Ketoisovalerate oxidoreductase subunit ...    46   5e-07
VHUB_METJA RecName: Full=Polyferredoxin protein vhuB;                  46   5e-07
VORD_PYRHO RecName: Full=Ketoisovalerate oxidoreductase subunit ...    46   6e-07
HDRA_METMA RecName: Full=CoB--CoM heterodisulfide reductase 1 ir...    46   6e-07
HDRA_METAC RecName: Full=CoB--CoM heterodisulfide reductase 1 ir...    44   2e-06
VHUB_METVO RecName: Full=Polyferredoxin protein vhuB;                  44   2e-06
HDRA2_METKA RecName: Full=CoB--CoM heterodisulfide reductase iro...    44   2e-06
PORD_PYRAB RecName: Full=Pyruvate synthase subunit porD;AltName:...    44   3e-06
Y264_METJA RecName: Full=Uncharacterized protein MJ0264;               43   4e-06
RNFB_AZOSB RecName: Full=Electron transport complex protein rnfB...    43   4e-06
FER2_DESNO RecName: Full=Ferredoxin-2;AltName: Full=Ferredoxin II;     43   4e-06
NUOI_MYCA1 RecName: Full=NADH-quinone oxidoreductase subunit I; ...    43   5e-06
NUOI2_MYCPA RecName: Full=NADH-quinone oxidoreductase subunit I ...    43   5e-06
FER_CLOST RecName: Full=Ferredoxin;                                    43   5e-06
RNFB_AZOSE RecName: Full=Electron transport complex protein rnfB;      42   7e-06
PORD_METBF RecName: Full=Pyruvate synthase subunit porD;AltName:...    42   7e-06
NUOI_MYCUA RecName: Full=NADH-quinone oxidoreductase subunit I; ...    42   7e-06
NUOI_MYCTU RecName: Full=NADH-quinone oxidoreductase subunit I; ...    42   7e-06
NUOI_MYCTA RecName: Full=NADH-quinone oxidoreductase subunit I; ...    42   7e-06
NUOI_MYCSS RecName: Full=NADH-quinone oxidoreductase subunit I; ...    42   7e-06
NUOI_MYCSK RecName: Full=NADH-quinone oxidoreductase subunit I; ...    42   7e-06
NUOI_MYCSJ RecName: Full=NADH-quinone oxidoreductase subunit I; ...    42   7e-06
NUOI_MYCS2 RecName: Full=NADH-quinone oxidoreductase subunit I; ...    42   7e-06
NUOI_MYCMM RecName: Full=NADH-quinone oxidoreductase subunit I; ...    42   7e-06
NUOI_MYCBT RecName: Full=NADH-quinone oxidoreductase subunit I; ...    42   7e-06
NUOI_MYCBP RecName: Full=NADH-quinone oxidoreductase subunit I; ...    42   7e-06
NUOI_MYCBO RecName: Full=NADH-quinone oxidoreductase subunit I; ...    42   7e-06
YEIA_ECOLI RecName: Full=Uncharacterized protein yeiA;                 42   1e-05
FER6_METJA RecName: Full=Uncharacterized ferredoxin MJ0624;            42   1e-05
FER2_METJA RecName: Full=Uncharacterized ferredoxin MJ0099;            42   1e-05
ODPA_ZYMMO RecName: Full=Pyruvate dehydrogenase E1 component sub...    41   2e-05
NUOI_SULDN RecName: Full=NADH-quinone oxidoreductase subunit I; ...    41   2e-05
NUOI_RHOE4 RecName: Full=NADH-quinone oxidoreductase subunit I; ...    41   2e-05
NUOI_MAGSM RecName: Full=NADH-quinone oxidoreductase subunit I; ...    41   2e-05
NUOI_HELPY RecName: Full=NADH-quinone oxidoreductase subunit I; ...    41   2e-05
NUOI_HELPS RecName: Full=NADH-quinone oxidoreductase subunit I; ...    41   2e-05
NUOI_HELPJ RecName: Full=NADH-quinone oxidoreductase subunit I; ...    41   2e-05
NUOI_HELPH RecName: Full=NADH-quinone oxidoreductase subunit I; ...    41   2e-05
NUOI_HELPG RecName: Full=NADH-quinone oxidoreductase subunit I; ...    41   2e-05
NUOI_HELP2 RecName: Full=NADH-quinone oxidoreductase subunit I; ...    41   2e-05
NUOI_HELAH RecName: Full=NADH-quinone oxidoreductase subunit I; ...    41   2e-05
FER_ALIAC RecName: Full=Ferredoxin;                                    41   2e-05
Y1043_HAEIN RecName: Full=Uncharacterized protein HI1043;              41   2e-05
PORD_PYRHO RecName: Full=Pyruvate synthase subunit porD;AltName:...    41   2e-05
PORD_PYRFU RecName: Full=Pyruvate synthase subunit porD;AltName:...    41   2e-05
ODBA_THET8 RecName: Full=2-oxoisovalerate dehydrogenase subunit ...    41   2e-05
ODBA_THET2 RecName: Full=2-oxoisovalerate dehydrogenase subunit ...    41   2e-05
NUOI_RHOSR RecName: Full=NADH-quinone oxidoreductase subunit I; ...    41   2e-05
NUOI_RHOOB RecName: Full=NADH-quinone oxidoreductase subunit I; ...    41   2e-05
NUOI_MYCVP RecName: Full=NADH-quinone oxidoreductase subunit I; ...    41   2e-05
NUOI_MYCGI RecName: Full=NADH-quinone oxidoreductase subunit I; ...    41   2e-05
HYFA_ECOLI RecName: Full=Hydrogenase-4 component A;         EC=1...    41   2e-05
FDHL_STAS1 RecName: Full=Putative formate dehydrogenase SSP0601;...    41   2e-05
NUOI1_GEOSL RecName: Full=NADH-quinone oxidoreductase subunit I ...    40   3e-05
NUOHI_NOCFA RecName: Full=NADH-quinone oxidoreductase subunits H...    40   3e-05
FER_BUTME RecName: Full=Ferredoxin;                                    40   3e-05
Y578_METJA RecName: Full=Uncharacterized protein MJ0578;               40   3e-05
HMC2_DESVH RecName: Full=Protein DVU_0535;AltName: Full=HMC oper...    40   3e-05
HDRA_METTM RecName: Full=CoB--CoM heterodisulfide reductase iron...    40   3e-05
HDRA_METTH RecName: Full=CoB--CoM heterodisulfide reductase iron...    40   3e-05
RNFB_HAEIN RecName: Full=Electron transport complex protein rnfB;      40   4e-05
RNFB_HAEIE RecName: Full=Electron transport complex protein rnfB;      40   4e-05
RNFB_HAEI8 RecName: Full=Electron transport complex protein rnfB;      40   4e-05
RNFB_BUCAP RecName: Full=Electron transport complex protein rnfB;      40   4e-05
NUOI_PARUW RecName: Full=NADH-quinone oxidoreductase subunit I; ...    40   4e-05
FDHL_BACSU RecName: Full=Putative formate dehydrogenase yrhE;   ...    40   4e-05
YJGC_BACSU RecName: Full=Probable oxidoreductase yjgC;         E...    39   6e-05
Y934_METJA RecName: Full=Uncharacterized polyferredoxin-like pro...    39   6e-05
NUOI_WOLSU RecName: Full=NADH-quinone oxidoreductase subunit I; ...    39   6e-05
NUOI_RICCK RecName: Full=NADH-quinone oxidoreductase subunit I; ...    39   6e-05
NUOI2_RHIME RecName: Full=NADH-quinone oxidoreductase subunit I ...    39   6e-05
NUOI2_RHIEC RecName: Full=NADH-quinone oxidoreductase subunit I ...    39   6e-05
FER3_DESAF RecName: Full=Ferredoxin-3;AltName: Full=Ferredoxin III;    39   6e-05
DPYD_DICDI RecName: Full=Dihydropyrimidine dehydrogenase [NADP+]...    39   6e-05
NUOI1_STRCO RecName: Full=NADH-quinone oxidoreductase subunit I ...    39   8e-05
NUOI1_STRAW RecName: Full=NADH-quinone oxidoreductase subunit I ...    39   8e-05
FRHG_METVO RecName: Full=Coenzyme F420 hydrogenase subunit gamma...    39   8e-05
FER_CLOTS RecName: Full=Ferredoxin;                                    39   8e-05
FER1_DESVM RecName: Full=Ferredoxin-1;AltName: Full=Ferredoxin I...    39   8e-05
YOX6_SCHPO RecName: Full=Uncharacterized ABC transporter ATP-bin...    39   1e-04
NUOI_MAGSA RecName: Full=NADH-quinone oxidoreductase subunit I; ...    39   1e-04
FER_CLOBU RecName: Full=Ferredoxin;                                    39   1e-04
RNFB_BUCBP RecName: Full=Electron transport complex protein rnfB;      38   1e-04
NUOI_RICAH RecName: Full=NADH-quinone oxidoreductase subunit I; ...    38   1e-04
NUOI1_MYCPA RecName: Full=NADH-quinone oxidoreductase subunit I ...    38   1e-04
NDUS8_RECAM RecName: Full=NADH-ubiquinone oxidoreductase subunit...    38   1e-04
FER_CLOAC RecName: Full=Ferredoxin;                                    38   1e-04
Y749_METJA RecName: Full=Uncharacterized protein MJ0749;               38   2e-04
PNO_CRYPV RecName: Full=Pyruvate dehydrogenase [NADP+];         ...    38   2e-04
PHFL_DESVH RecName: Full=Periplasmic [Fe] hydrogenase large subu...    38   2e-04
NUOI_RICRS RecName: Full=NADH-quinone oxidoreductase subunit I; ...    38   2e-04
NUOI_RICRO RecName: Full=NADH-quinone oxidoreductase subunit I; ...    38   2e-04
NUOI_RICPU RecName: Full=NADH-quinone oxidoreductase subunit I; ...    38   2e-04
NUOI_RICCN RecName: Full=NADH-quinone oxidoreductase subunit I; ...    38   2e-04
NUOI_RICBR RecName: Full=NADH-quinone oxidoreductase subunit I; ...    38   2e-04
NUOI_RICB8 RecName: Full=NADH-quinone oxidoreductase subunit I; ...    38   2e-04
NUOI_RICAE RecName: Full=NADH-quinone oxidoreductase subunit I; ...    38   2e-04
FER_ENTHI RecName: Full=Ferredoxin;                                    38   2e-04
Y51B_METJA RecName: Full=Uncharacterized polyferredoxin-like pro...    37   2e-04
PPD_STRVR RecName: Full=Phosphonopyruvate decarboxylase;        ...    37   2e-04
PHFL_DESVO RecName: Full=Periplasmic [Fe] hydrogenase large subu...    37   2e-04
NUOI_WOLPM RecName: Full=NADH-quinone oxidoreductase subunit I; ...    37   2e-04
NUOI_RICPR RecName: Full=NADH-quinone oxidoreductase subunit I; ...    37   2e-04
NUOI_RICFE RecName: Full=NADH-quinone oxidoreductase subunit I; ...    37   2e-04
NUOI2_GEOMG RecName: Full=NADH-quinone oxidoreductase subunit I ...    37   2e-04
NIFJ_ENTAG RecName: Full=Pyruvate-flavodoxin oxidoreductase;    ...    37   2e-04
NDUS8_CAEEL RecName: Full=Probable NADH dehydrogenase [ubiquinon...    37   2e-04
FER9_METJA RecName: Full=Uncharacterized ferredoxin MJ0265;            37   2e-04
FER3_ANASP RecName: Full=Ferredoxin-3;AltName: Full=Ferredoxin I...    37   2e-04
ASRC_SALTY RecName: Full=Anaerobic sulfite reductase subunit C; ...    37   2e-04
ASRC_SALTI RecName: Full=Anaerobic sulfite reductase subunit C; ...    37   2e-04
Y208_METJA RecName: Full=Uncharacterized protein MJ0208;               37   3e-04
RNFB_SHISS RecName: Full=Electron transport complex protein rnfB;      37   3e-04
RNFB_SHIDS RecName: Full=Electron transport complex protein rnfB;      37   3e-04
RNFB_SHIB3 RecName: Full=Electron transport complex protein rnfB;      37   3e-04
RNFB_SALTY RecName: Full=Electron transport complex protein rnfB;      37   3e-04
RNFB_SALTI RecName: Full=Electron transport complex protein rnfB;      37   3e-04
RNFB_SALSV RecName: Full=Electron transport complex protein rnfB;      37   3e-04
RNFB_SALPK RecName: Full=Electron transport complex protein rnfB;      37   3e-04
RNFB_SALPC RecName: Full=Electron transport complex protein rnfB;      37   3e-04
RNFB_SALPB RecName: Full=Electron transport complex protein rnfB;      37   3e-04
RNFB_SALPA RecName: Full=Electron transport complex protein rnfB;      37   3e-04
RNFB_SALNS RecName: Full=Electron transport complex protein rnfB;      37   3e-04
RNFB_SALHS RecName: Full=Electron transport complex protein rnfB;      37   3e-04
RNFB_SALG2 RecName: Full=Electron transport complex protein rnfB;      37   3e-04
RNFB_SALEP RecName: Full=Electron transport complex protein rnfB;      37   3e-04
RNFB_SALDC RecName: Full=Electron transport complex protein rnfB;      37   3e-04
RNFB_SALCH RecName: Full=Electron transport complex protein rnfB;      37   3e-04
RNFB_SALA4 RecName: Full=Electron transport complex protein rnfB;      37   3e-04
RNFB_RHOCA RecName: Full=Electron transport complex protein rnfB...    37   3e-04
RNFB_ESCF3 RecName: Full=Electron transport complex protein rnfB;      37   3e-04
RNFB_ECOUT RecName: Full=Electron transport complex protein rnfB;      37   3e-04
RNFB_ECOSM RecName: Full=Electron transport complex protein rnfB;      37   3e-04
RNFB_ECOSE RecName: Full=Electron transport complex protein rnfB;      37   3e-04
RNFB_ECOLU RecName: Full=Electron transport complex protein rnfB;      37   3e-04
RNFB_ECOLI RecName: Full=Electron transport complex protein rnfB;      37   3e-04
RNFB_ECOLC RecName: Full=Electron transport complex protein rnfB;      37   3e-04
RNFB_ECOL6 RecName: Full=Electron transport complex protein rnfB;      37   3e-04
RNFB_ECOL5 RecName: Full=Electron transport complex protein rnfB;      37   3e-04
RNFB_ECOK1 RecName: Full=Electron transport complex protein rnfB;      37   3e-04
RNFB_ECOHS RecName: Full=Electron transport complex protein rnfB;      37   3e-04
RNFB_ECODH RecName: Full=Electron transport complex protein rnfB;      37   3e-04
RNFB_ECOBW RecName: Full=Electron transport complex protein rnfB;      37   3e-04
RNFB_ECO8A RecName: Full=Electron transport complex protein rnfB;      37   3e-04
RNFB_ECO81 RecName: Full=Electron transport complex protein rnfB;      37   3e-04
RNFB_ECO7I RecName: Full=Electron transport complex protein rnfB;      37   3e-04
RNFB_ECO5E RecName: Full=Electron transport complex protein rnfB;      37   3e-04
RNFB_ECO57 RecName: Full=Electron transport complex protein rnfB;      37   3e-04
RNFB_ECO55 RecName: Full=Electron transport complex protein rnfB;      37   3e-04
RNFB_ECO45 RecName: Full=Electron transport complex protein rnfB;      37   3e-04
RNFB_ECO27 RecName: Full=Electron transport complex protein rnfB;      37   3e-04
RNFB_ECO24 RecName: Full=Electron transport complex protein rnfB;      37   3e-04
RNFB_CITK8 RecName: Full=Electron transport complex protein rnfB;      37   3e-04
RNFB_BUCAT RecName: Full=Electron transport complex protein rnfB;      37   3e-04
RNFB_BUCAI RecName: Full=Electron transport complex protein rnfB;      37   3e-04
RNFB_BUCA5 RecName: Full=Electron transport complex protein rnfB;      37   3e-04
PORD_METTH RecName: Full=Pyruvate synthase subunit porD;AltName:...    37   3e-04
PORD_METJA RecName: Full=Pyruvate synthase subunit porD;AltName:...    37   3e-04
NUOI_THEFY RecName: Full=NADH-quinone oxidoreductase subunit I; ...    37   3e-04
NUOI_RICTY RecName: Full=NADH-quinone oxidoreductase subunit I; ...    37   3e-04
NUOI_HELHP RecName: Full=NADH-quinone oxidoreductase subunit I; ...    37   3e-04
NUOI_FRASN RecName: Full=NADH-quinone oxidoreductase subunit I; ...    37   3e-04
NUOI_FRASC RecName: Full=NADH-quinone oxidoreductase subunit I; ...    37   3e-04
NQO9_THET8 RecName: Full=NADH-quinone oxidoreductase subunit 9; ...    37   3e-04
NQO9_THET2 RecName: Full=NADH-quinone oxidoreductase subunit 9; ...    37   3e-04
FER7_METJA RecName: Full=Uncharacterized ferredoxin MJ0722;            37   3e-04
FER1_CAUCR RecName: Full=Ferredoxin-1;AltName: Full=Ferredoxin I...    37   3e-04
FDHL_STAAW RecName: Full=Putative formate dehydrogenase MW2229; ...    37   3e-04
FDHL_STAAS RecName: Full=Putative formate dehydrogenase SAS2201;...    37   3e-04
FDHL_STAAR RecName: Full=Putative formate dehydrogenase SAR2393;...    37   3e-04
FDHL_STAAN RecName: Full=Putative formate dehydrogenase SA2102; ...    37   3e-04
FDHL_STAAM RecName: Full=Putative formate dehydrogenase SAV2309;...    37   3e-04
FDHL_STAAC RecName: Full=Putative formate dehydrogenase SACOL230...    37   3e-04
FDHL_STAAB RecName: Full=Putative formate dehydrogenase SAB2186c...    37   3e-04
FDHL_STAA8 RecName: Full=Putative formate dehydrogenase SAOUHSC_...    37   3e-04
FDHL_STAA3 RecName: Full=Putative formate dehydrogenase SAUSA300...    37   3e-04
RNFB_SALAR RecName: Full=Electron transport complex protein rnfB;      37   4e-04
PPD_STRHY RecName: Full=Phosphonopyruvate decarboxylase;        ...    37   4e-04
ODPA_RHIME RecName: Full=Pyruvate dehydrogenase E1 component sub...    37   4e-04
NUOI_WOLTR RecName: Full=NADH-quinone oxidoreductase subunit I; ...    37   4e-04
NUOI_SACEN RecName: Full=NADH-quinone oxidoreductase subunit I; ...    37   4e-04
NUOI_PROAC RecName: Full=NADH-quinone oxidoreductase subunit I; ...    37   4e-04
NUOI_ORITI RecName: Full=NADH-quinone oxidoreductase subunit I; ...    37   4e-04
NUOI_ORITB RecName: Full=NADH-quinone oxidoreductase subunit I; ...    37   4e-04
NUOI_CAMJR RecName: Full=NADH-quinone oxidoreductase subunit I; ...    37   4e-04
NUOI_CAMJJ RecName: Full=NADH-quinone oxidoreductase subunit I; ...    37   4e-04
NUOI_CAMJE RecName: Full=NADH-quinone oxidoreductase subunit I; ...    37   4e-04
NUOI_CAMJD RecName: Full=NADH-quinone oxidoreductase subunit I; ...    37   4e-04
NUOI_CAMJ8 RecName: Full=NADH-quinone oxidoreductase subunit I; ...    37   4e-04
NUOI2_STRCO RecName: Full=NADH-quinone oxidoreductase subunit I ...    37   4e-04
ILVB_PORUM RecName: Full=Acetolactate synthase large subunit;   ...    37   4e-04
ILVB_PORPU RecName: Full=Acetolactate synthase large subunit;   ...    37   4e-04
HYCF_ECOLI RecName: Full=Formate hydrogenlyase subunit 6;       ...    37   4e-04
HMEA_ARCFU RecName: Full=Hdr-like menaquinol oxidoreductase iron...    37   4e-04
FER_CLOPE RecName: Full=Ferredoxin;                                    37   4e-04
FER_CLOPA RecName: Full=Ferredoxin;                                    37   4e-04
YCXI_PORPU RecName: Full=Uncharacterized protein in rpl9-rpl11 i...    36   5e-04
RNFB_SHIFL RecName: Full=Electron transport complex protein rnfB;      36   5e-04
RNFB_SHIBS RecName: Full=Electron transport complex protein rnfB;      36   5e-04
PHSB_SALTY RecName: Full=Thiosulfate reductase electron transpor...    36   5e-04
PHSB_SALTI RecName: Full=Thiosulfate reductase electron transpor...    36   5e-04
NUOI_CARHZ RecName: Full=NADH-quinone oxidoreductase subunit I; ...    36   5e-04
NUOI_ANAPZ RecName: Full=NADH-quinone oxidoreductase subunit I; ...    36   5e-04
FERA_METJA RecName: Full=Uncharacterized ferredoxin MJ0533;            36   5e-04
FDXN_RHOCA RecName: Full=Ferredoxin-1;AltName: Full=Ferredoxin I...    36   5e-04
AB1E_ARATH RecName: Full=ABC transporter E family member 1;     ...    36   5e-04
VHCB_METVO RecName: Full=Polyferredoxin protein vhcB;                  36   6e-04
RPOD_ARCFU RecName: Full=DNA-directed RNA polymerase subunit D; ...    36   6e-04
RNFB_PECCP RecName: Full=Electron transport complex protein rnfB;      36   6e-04
RNFB_MAGSM RecName: Full=Electron transport complex protein rnfB;      36   6e-04
RNFB_HAEDU RecName: Full=Electron transport complex protein rnfB;      36   6e-04
RLI1_YEAST RecName: Full=Translation initiation factor RLI1;AltN...    36   6e-04
NUOI_EHRCR RecName: Full=NADH-quinone oxidoreductase subunit I; ...    36   6e-04
NUOI_EHRCJ RecName: Full=NADH-quinone oxidoreductase subunit I; ...    36   6e-04
NUOI_CAUCR RecName: Full=NADH-quinone oxidoreductase subunit I; ...    36   6e-04
NUOI_CAMHC RecName: Full=NADH-quinone oxidoreductase subunit I; ...    36   6e-04
NDUS8_TOBAC RecName: Full=NADH dehydrogenase [ubiquinone] iron-s...    36   6e-04
NDUS8_SOLTU RecName: Full=NADH dehydrogenase [ubiquinone] iron-s...    36   6e-04
FRHG_METJA RecName: Full=Coenzyme F420 hydrogenase subunit gamma...    36   6e-04
FPRB_MYCTU RecName: Full=Probable ferredoxin/ferredoxin--NADP re...    36   6e-04
FPRB_MYCBO RecName: Full=Probable ferredoxin/ferredoxin--NADP re...    36   6e-04
FDHL_STAHJ RecName: Full=Putative formate dehydrogenase SH0748; ...    36   6e-04
YNFG_ECOLI RecName: Full=Probable anaerobic dimethyl sulfoxide r...    35   8e-04
YNFG_ECOL6 RecName: Full=Probable anaerobic dimethyl sulfoxide r...    35   8e-04
Y726_METJA RecName: Full=Uncharacterized protein MJ0726;               35   8e-04
RNFB_TOLAT RecName: Full=Electron transport complex protein rnfB;      35   8e-04
RNFB_PASMU RecName: Full=Electron transport complex protein rnfB;      35   8e-04
NUOI_RICM5 RecName: Full=NADH-quinone oxidoreductase subunit I; ...    35   8e-04
NUOI_RALEH RecName: Full=NADH-quinone oxidoreductase subunit I; ...    35   8e-04
NUOI_NOCSJ RecName: Full=NADH-quinone oxidoreductase subunit I; ...    35   8e-04
NUOI_CUPTR RecName: Full=NADH-quinone oxidoreductase subunit I; ...    35   8e-04
NUOI2_SYNFM RecName: Full=NADH-quinone oxidoreductase subunit I ...    35   8e-04
NUOI2_STRAW RecName: Full=NADH-quinone oxidoreductase subunit I ...    35   8e-04
NUOI1_SYNFM RecName: Full=NADH-quinone oxidoreductase subunit I ...    35   8e-04
NDUS8_PONAB RecName: Full=NADH dehydrogenase [ubiquinone] iron-s...    35   8e-04
NDUS8_PANTR RecName: Full=NADH dehydrogenase [ubiquinone] iron-s...    35   8e-04
NDUS8_MOUSE RecName: Full=NADH dehydrogenase [ubiquinone] iron-s...    35   8e-04
NDUS8_HUMAN RecName: Full=NADH dehydrogenase [ubiquinone] iron-s...    35   8e-04
NDUS8_GORGO RecName: Full=NADH dehydrogenase [ubiquinone] iron-s...    35   8e-04
NDUS8_ARATH RecName: Full=NADH dehydrogenase [ubiquinone] iron-s...    35   8e-04
NAPH_HAEIN RecName: Full=Ferredoxin-type protein napH homolog;         35   8e-04
HDRA1_METKA RecName: Full=CoB--CoM heterodisulfide reductase iro...    35   8e-04
FWDG_METJA RecName: Full=Polyferredoxin protein fwdG;                  35   8e-04
FPRB_MYCLE RecName: Full=Probable ferredoxin/ferredoxin--NADP re...    35   8e-04
FER_THET8 RecName: Full=Ferredoxin;                                    35   8e-04
FER4_METJA RecName: Full=Uncharacterized ferredoxin MJ0199;            35   8e-04
DPYD_DANRE RecName: Full=Dihydropyrimidine dehydrogenase [NADP+]...    35   8e-04
AB2E_ARATH RecName: Full=ABC transporter E family member 2;     ...    35   8e-04

>IORA_PYRAB RecName: Full=Indolepyruvate oxidoreductase subunit
           iorA;         Short=IOR;         EC=1.2.7.8;AltName:
           Full=Indolepyruvate ferredoxin oxidoreductase subunit
           alpha;
          Length = 648

 Score =  181 bits (458), Expect = 1e-47
 Identities = 108/256 (42%), Positives = 149/256 (58%), Gaps = 31/256 (12%)

Query: 147 HMATFYILRLATAGLNPVWSGDIGCYSLGINTGQQ--DLITHMGSSVGLGAGIALA---- 200
           H  TF+ LR A A    ++  DIGCY+LG+    +  D    MG S+G+  G+++A    
Sbjct: 390 HRNTFFALRKA-ATPRAIYPSDIGCYTLGVLPPLKTVDTTIAMGGSIGVAHGLSIALNGS 448

Query: 201 -------TGQ---FVVATVGDSTFYHAVLPQLVDIATRSVPILIVVMDNAYTAMTGGQPS 250
                  TG+    + AT+GDSTF+H  LP L +       +LIVV+DN  TAMTG QP+
Sbjct: 449 IAEEQRKTGKGKKIIAATIGDSTFFHTGLPALANAIYNRSNVLIVVLDNLVTAMTGDQPN 508

Query: 251 PS---------RAIPAERITEAFGIS-TFVIDPIDVKKSVEIIKKAVEIVKSGRPAVVVS 300
           P          + I  E + +A G     V+DP D+K++ E  KKA+E+      +VVV+
Sbjct: 509 PGTGETPHGPGKRILIEEVAKAMGADFVAVVDPYDIKETYETFKKALEVEGV---SVVVA 565

Query: 301 RRPCALIGVRKARRAGIQLPKYQVDVNKCTGCGLCYNLLKCSAIYKRPD-RKAHVDPALC 359
           RR CAL  + + RRAG Q P YQV+ +KCTGC +C N   C AIY  P+ +KA VDP +C
Sbjct: 566 RRACALYRIGQLRRAGKQWPIYQVNEDKCTGCKICINAYGCPAIYWDPEKKKAKVDPLMC 625

Query: 360 VGCGICAEVCPFNAFK 375
            GCG CA+VCPF+AF+
Sbjct: 626 WGCGGCAQVCPFDAFE 641



 Score = 38.1 bits (87), Expect = 1e-04
 Identities = 27/61 (44%), Positives = 37/61 (60%), Gaps = 4/61 (6%)

Query: 1   MDKWRELEKLSSDFLQIEGSGD--VVIVTSGVAYNYVKEAVRRLNI-RATVVKLGISVPV 57
           ++K+RE E  +S F  IEG  D  V I+  G++Y YVKEA+  L +    V+KLG   PV
Sbjct: 230 IEKFRE-EFNNSPFNWIEGPEDAKVGIIAPGLSYAYVKEALAWLGVDNVKVLKLGTPFPV 288

Query: 58  P 58
           P
Sbjct: 289 P 289


>IORA_ARCFU RecName: Full=Indolepyruvate oxidoreductase subunit
           iorA;         Short=IOR;         EC=1.2.7.8;AltName:
           Full=Indolepyruvate ferredoxin oxidoreductase subunit
           alpha;
          Length = 623

 Score =  179 bits (454), Expect = 4e-47
 Identities = 123/382 (32%), Positives = 193/382 (50%), Gaps = 29/382 (7%)

Query: 18  EGSGDVVIVTSGVAYNYVKEAVRRLNIRATVVKLGISVPVPPKVRE--IARXXXXXXXXX 75
           EG GDV I+  G++Y Y KEA+  LN+   V+KL    P+P ++ E  +++         
Sbjct: 244 EGDGDVGIIACGLSYAYTKEALENLNLNLPVLKLSSMHPLPERLIENFVSQMKKVIVVEE 303

Query: 76  XXXXXXIQLRALGI-NTRGKIDGYFPKHGELDINKTXXXXXXXXXXSYAXXXXXXXXXXX 134
                 + +RA+G+    GK++GY P + E ++ +             +           
Sbjct: 304 VDPFVELHVRAMGLAEVYGKMNGYMPMNYEYNVGRVETGIAKALGIKPSRDYEGIVAESQ 363

Query: 135 XXXXXXXXXXXX------HMATFYILRLATAGL-NPVWSGDIGCYSLGINTGQQ--DLIT 185
                             H A+FY +R     L +     DIGCY+LGIN   +  D+  
Sbjct: 364 KLAAKAXXXXXXXXXXXXHSASFYAIRRVVDELGDAALPSDIGCYTLGINKPLEGVDITI 423

Query: 186 HMGSSVGLGAGIALATGQFVVATVGDSTFYHAVLPQLVDIATRSVPILIVVMDNAYTAMT 245
            MG+SVG+  G+A      ++AT+GDSTF HA +P L++        ++V++DN+ T MT
Sbjct: 424 CMGASVGVSNGLAHVLNNKIIATIGDSTFIHAGIPPLINAVYNHADFVLVILDNSTTGMT 483

Query: 246 GGQPSP----------SRAIPAERITEAFGIS-TFVIDPIDVKKSVEIIKKAVEIVKSGR 294
           G QP P           +A+  E I    G+    V++P +V+K V+++++A   +    
Sbjct: 484 GHQPHPGTGFRGCGEAGKAVRIEDIVRGCGVEFVEVVNPYNVRKMVDVLRRA---LNHDG 540

Query: 295 PAVVVSRRPCALIGVRKARRAGIQLPKYQVDVNKCTGCGLCYNLLKCSAIYKRPDRKAHV 354
            AVV++R+PCA++  R  RR G ++  Y+V    CT C  C N   C A+      K  +
Sbjct: 541 VAVVIARQPCAILWSRARRREG-KIVTYKV-TEDCTLCMECVNTFACPALI-FDGEKVSI 597

Query: 355 DPALCVGCGICAEVCPFNAFKP 376
           D +LCVGC +CA++CP  A KP
Sbjct: 598 DQSLCVGCAVCAKICPNRAIKP 619


>IORA_PYRKO RecName: Full=Indolepyruvate oxidoreductase subunit
           iorA;         Short=IOR;         EC=1.2.7.8;AltName:
           Full=Indolepyruvate ferredoxin oxidoreductase subunit
           alpha;
          Length = 647

 Score =  179 bits (453), Expect = 5e-47
 Identities = 104/257 (40%), Positives = 144/257 (56%), Gaps = 31/257 (12%)

Query: 147 HMATFYILRLATAGLNPVWSGDIGCYSLGINTGQQ--DLITHMGSSVGLGAGIALATG-- 202
           H  +F+ +R A AG   ++  DIGCY+LG+    +  D    MG+S+G+G G+++A    
Sbjct: 390 HRNSFFAIRKA-AGPKAIYPSDIGCYTLGVLPPLRTVDTTVAMGASIGIGHGLSIAMNGS 448

Query: 203 ------------QFVVATVGDSTFYHAVLPQLVDIATRSVPILIVVMDNAYTAMTGGQPS 250
                       Q +VAT+GDSTFYH  LP L +       +LIVV+DN  TAMTG QP+
Sbjct: 449 LAEEEHKEGKEKQIIVATIGDSTFYHTGLPALANAIYNRSNVLIVVLDNLVTAMTGDQPN 508

Query: 251 P---------SRAIPAERITEAFGIS-TFVIDPIDVKKSVEIIKKAVEIVKSGRPAVVVS 300
           P          + IP E + +A G     V+DP D+K + E IKKA   +          
Sbjct: 509 PGTGQTPHGMGKRIPIEDVAKAMGADFVAVVDPYDIKATYETIKKA---LXXXXXXXXXX 565

Query: 301 RRPCALIGVRKARRAGIQLPKYQVDVNKCTGCGLCYNLLKCSAIYKRPD-RKAHVDPALC 359
           R+ CAL  + + RR G++ P Y V  +KCTGC +C N   C AIY  P+ +KA VDP +C
Sbjct: 566 RQVCALYKIGQMRRRGMKWPIYHVVEDKCTGCKICINAYGCPAIYWDPETKKAKVDPTMC 625

Query: 360 VGCGICAEVCPFNAFKP 376
            GCG CA+VCPF+AF+P
Sbjct: 626 WGCGGCAQVCPFDAFEP 642


>IORA_PYRHO RecName: Full=Indolepyruvate oxidoreductase subunit
           iorA;         Short=IOR;         EC=1.2.7.8;AltName:
           Full=Indolepyruvate ferredoxin oxidoreductase subunit
           alpha;
          Length = 648

 Score =  164 bits (415), Expect = 1e-42
 Identities = 102/256 (39%), Positives = 137/256 (53%), Gaps = 31/256 (12%)

Query: 147 HMATFYILRLATAGLNPVWSGDIGCYSLGINTGQQ--DLITHMGSSVGLGAGIALA---- 200
           H  TF+ +R A A    ++  DIGCY+LG+    +  D    MG S+G+  G+++A    
Sbjct: 390 HRNTFFAIRKA-ATPRAIFPSDIGCYTLGVLPPLKTVDTTIAMGGSIGVAHGLSIALNGA 448

Query: 201 -------TGQ---FVVATVGDSTFYHAVLPQLVDIATRSVPILIVVMDNAYTAMTGGQPS 250
                  TG+    +VAT+GDSTF+H  LP L +       +LIVVMDN  TAMTG QP+
Sbjct: 449 LGEEQRKTGKEKKIIVATIGDSTFFHTGLPALANAIYNRSNVLIVVMDNMVTAMTGDQPN 508

Query: 251 ---------PSRAIPAERITEAFGIS-TFVIDPIDVKKSVEIIKKAVEIVKSGRPAVVVS 300
                    P + I  E +  A G     V+DP D+K++ E IKKA+            +
Sbjct: 509 PGTGETPHGPGKRILIEEVARAMGADFVAVVDPYDIKETYETIKKALXXXXXXXXXXXXA 568

Query: 301 RRPCALIGVRKARRAGIQLPKYQVDVNKCTGCGLCYNLLKCSAIY-KRPDRKAHVDPALC 359
              CAL  + + RR G Q P YQV+  KCTGC +C N   C AIY     +KA VDP +C
Sbjct: 569 ---CALYRIGQLRREGKQWPIYQVNEEKCTGCKICINAYGCPAIYWDAEKKKARVDPLMC 625

Query: 360 VGCGICAEVCPFNAFK 375
            GCG CA+VCPF AF+
Sbjct: 626 WGCGGCAQVCPFGAFE 641



 Score = 38.1 bits (87), Expect = 1e-04
 Identities = 27/61 (44%), Positives = 37/61 (60%), Gaps = 4/61 (6%)

Query: 1   MDKWRELEKLSSDFLQIEGSGD--VVIVTSGVAYNYVKEAVRRLNI-RATVVKLGISVPV 57
           ++K+RE E  +S F  IEG  D  V I+  G++Y YVKEA+  L I    ++KLG   PV
Sbjct: 230 IEKFRE-EFNTSPFNWIEGPEDAKVGIIAPGLSYAYVKEALAWLGIDNVKILKLGTPFPV 288

Query: 58  P 58
           P
Sbjct: 289 P 289


>IORA_METTH RecName: Full=Indolepyruvate oxidoreductase subunit
           iorA;         Short=IOR;         EC=1.2.7.8;AltName:
           Full=Indolepyruvate ferredoxin oxidoreductase subunit
           alpha;
          Length = 618

 Score =  152 bits (384), Expect = 5e-39
 Identities = 118/409 (28%), Positives = 183/409 (44%), Gaps = 41/409 (10%)

Query: 1   MDKWRELEKLSSDFLQIE------GSGDVVIVTSGVAYNYVKEAVRRLNIRATVVKLGIS 54
           +DK +EL ++ +D  ++          ++ +V SG A+NYV +A+  L +   V+KLG +
Sbjct: 220 VDKMKEL-RIRADESELNRVFNGGSDSELGVVASGGAFNYVYDALESLGLELPVLKLGFT 278

Query: 55  VPVPPKVREIARXXXXXXXXXXXXXXXIQLRALGI--------NTRGKIDGYFPK---HG 103
            P P  + E                  ++   L +        +  GK+DG  P+   + 
Sbjct: 279 YPFPAGLVEEFLSGLKRVLVVEEVDPIMEREVLAVAGSARLDLDVHGKLDGTLPEIYEYN 338

Query: 104 ELDINKTXXXXXXXXXXSYAXXXXXXXXXXXXXXXXXXXXXXXHMATFYILRLATAGLNP 163
           E  + K                                              L  +G   
Sbjct: 339 EDILRKAISGLTGAPSVERECDVPDIPERPPSLCPGCPHXXXXXXXXXXXDELELSGDEI 398

Query: 164 VWSGDIGCYSLGINT--GQQDLITHMGSSVGLGAGIALATGQFVVATVGDSTFYHAVLPQ 221
           ++  DIGCY+LGI       D +  MGSS+G   G + AT Q +V+ +GDSTF+HA +P 
Sbjct: 399 IFPTDIGCYTLGIEPPYSAADYLLSMGSSIGTSCGFSAATTQRIVSFIGDSTFFHAGIPP 458

Query: 222 LVDIATRSVPILIVVMDNAYTAMTGGQPSP----------SRAIPAERITEAFGIS-TFV 270
           L++        ++VV+DN  TAMTGGQP P          +  I  E I  A G+     
Sbjct: 459 LINAVHNKQRFVLVVLDNRTTAMTGGQPHPGLPVDGMGDEAPEISIEEIVRASGVEFVET 518

Query: 271 IDPIDVKKSVEIIKKAVEIVKSGRPAVVVSRRPCALIGVRKARRAGIQLPKYQVDVNKCT 330
           ++P+++K++ E +K+A+E       AVV+S+ PC L          ++     VD  KC 
Sbjct: 519 VNPMNIKRTSETVKRALE---HESVAVVISKYPCML------SSGAVRGRPMAVDGEKCD 569

Query: 331 GCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCPFNAFKPEGK 379
            C  C   L C A+  R + +  +DP  C GC +C ++CP  A KPEGK
Sbjct: 570 LCLECIRDLACPAMVTR-EGEVFIDPLKCRGCSVCLQICPAGAIKPEGK 617


>Y514_METJA RecName: Full=Uncharacterized polyferredoxin-like
           protein MJ0514;
          Length = 250

 Score = 57.0 bits (136), Expect = 3e-10
 Identities = 26/61 (42%), Positives = 34/61 (55%)

Query: 317 IQLPKYQVDVNKCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCPFNAFKP 376
           I+L KY++D N C  CG+C      +AI     +   V+  LC+GCG CAEVCP    K 
Sbjct: 121 IRLKKYELDENTCIKCGICARFCPTNAIKAVRRKSIEVNLDLCMGCGACAEVCPKKCIKV 180

Query: 377 E 377
           E
Sbjct: 181 E 181



 Score = 49.7 bits (117), Expect = 4e-08
 Identities = 28/89 (31%), Positives = 41/89 (46%), Gaps = 12/89 (13%)

Query: 299 VSRRPCALIGVRKARRAGIQLPKYQVDVNKCTGCGLCYNLL--KCSAIYKR-----PDRK 351
           +  R C    ++  RR  I+     V+++ C GCG C  +   KC  + +        R 
Sbjct: 138 ICARFCPTNAIKAVRRKSIE-----VNLDLCMGCGACAEVCPKKCIKVERELGEVIKTRD 192

Query: 352 AHVDPALCVGCGICAEVCPFNAFKPEGKR 380
             VD  LCVGC +C E CP NA   +G +
Sbjct: 193 IEVDKNLCVGCLVCIEECPINAIDQDGDK 221



 Score = 43.9 bits (102), Expect = 2e-06
 Identities = 25/73 (34%), Positives = 35/73 (47%), Gaps = 1/73 (1%)

Query: 303 PCALIGVRKARRAGIQLPKYQVDVNKCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGC 362
           P   I V +     I+    +VD N C GC +C      +AI +  D K  ++   C+ C
Sbjct: 174 PKKCIKVERELGEVIKTRDIEVDKNLCVGCLVCIEECPINAIDQDGD-KVKINKDKCILC 232

Query: 363 GICAEVCPFNAFK 375
           G C +VCP NA K
Sbjct: 233 GRCVDVCPTNAIK 245



 Score = 40.8 bits (94), Expect = 2e-05
 Identities = 23/60 (38%), Positives = 30/60 (50%), Gaps = 2/60 (3%)

Query: 324 VDVNKCTGCGLCYNLLKCSAIYKRPDRK-AHVDPALCVGCGICAEVCPFNA-FKPEGKRE 381
           ++  KC  C LCY      AI K   +K A +    CV C ICA+ CP  A +  EG+ E
Sbjct: 42  INETKCIRCNLCYKECPVDAIEKAKVKKSAKIIEDKCVKCEICAQTCPVGAIYVIEGRAE 101


>FWDF_METJA RecName: Full=Polyferredoxin protein fwdF;
          Length = 355

 Score = 56.6 bits (135), Expect = 4e-10
 Identities = 31/82 (37%), Positives = 43/82 (52%), Gaps = 16/82 (19%)

Query: 324 VDVNKCTGCGLCYNLLKCSAI-YKRPDRKAH------VDPALCVGCGICAEVCPFNA--- 373
           +DVN C  CG C ++  CSA+ + +P  KA       V+  LCV CG CA+ CP NA   
Sbjct: 271 IDVNACNACGACISICPCSALEFPKPKDKAEKVPRIIVNQNLCVLCGACAKACPVNAIKV 330

Query: 374 ------FKPEGKREAWLELWRQ 389
                 F+ E K  AW E +++
Sbjct: 331 KRTEINFEREPKAIAWKEAFKK 352



 Score = 43.1 bits (100), Expect = 4e-06
 Identities = 20/55 (36%), Positives = 28/55 (50%), Gaps = 10/55 (18%)

Query: 329 CTGCGLCYNLLKCSAIYKRP----------DRKAHVDPALCVGCGICAEVCPFNA 373
           C GCG+C ++   +AI   P            K  +D  +CV CG+CA  CPF+A
Sbjct: 33  CVGCGICADICPVNAIAMGPLGAIAKGDIIAPKLDIDKDVCVLCGMCASACPFDA 87



 Score = 37.4 bits (85), Expect = 2e-04
 Identities = 13/16 (81%), Positives = 15/16 (93%)

Query: 358 LCVGCGICAEVCPFNA 373
           LCVGCGICA++CP NA
Sbjct: 32  LCVGCGICADICPVNA 47


>MVHB_METFE RecName: Full=Polyferredoxin protein mvhB;
          Length = 412

 Score = 55.1 bits (131), Expect = 1e-09
 Identities = 51/172 (29%), Positives = 72/172 (41%), Gaps = 32/172 (18%)

Query: 238 DNAYTAMTGGQPS-----PSRAIPAERITEAFGISTFVI--DPIDVKKSVEIIKKA---- 286
           D  Y  M GG+P      P+ A+  E IT   GI    I   P    K  E +K      
Sbjct: 30  DVIYCDMCGGEPKCVEACPNDALRHEDITLEGGIKKKKITYSPEKCDKCGECVKVCPPGI 89

Query: 287 VEIVKSGRPAVVVSRRPCALI---------------GVRKARRAGIQLPK--YQVDVNKC 329
           +++V  G+ + V     C L                GV++  R  I++ K  Y VD   C
Sbjct: 90  LKLVNDGKASRVPLEGFCVLCQQCVNVCPIEVIGIEGVKEPARVEIKIDKPIYIVD---C 146

Query: 330 TGCGLCYNLLKCSAI-YKRPDRKAHVDPALCVGCGICAEVCPFNAFKPEGKR 380
            GCGLC      +AI   +      +D   C+ CGICA+ CP+N+    GK+
Sbjct: 147 VGCGLCVPECPVNAITLPKYGESIEIDEEKCIKCGICAQTCPWNSVYISGKK 198



 Score = 43.1 bits (100), Expect = 4e-06
 Identities = 19/73 (26%), Positives = 36/73 (49%), Gaps = 1/73 (1%)

Query: 307 IGVRKARRAGIQLPKYQVDVNKCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICA 366
           I  +K +++   +  + +D  +C GC  C  +     I  + D    + P +C  CG+C 
Sbjct: 194 ISGKKPQKSSRTIENFTLDKEECIGCNTCVEICPGGFIEPKSDLTVSL-PEICPACGLCE 252

Query: 367 EVCPFNAFKPEGK 379
           ++CP +A + E K
Sbjct: 253 KLCPTDAIELEVK 265



 Score = 35.4 bits (80), Expect = 8e-04
 Identities = 22/68 (32%), Positives = 26/68 (38%), Gaps = 2/68 (2%)

Query: 316 GIQLPKYQVDVNKCTGCGLCYNLLKCSAIYKRPDRKAHVDP--ALCVGCGICAEVCPFNA 373
           GI+  K      KC  CG C  +     +    D KA   P    CV C  C  VCP   
Sbjct: 62  GIKKKKITYSPEKCDKCGECVKVCPPGILKLVNDGKASRVPLEGFCVLCQQCVNVCPIEV 121

Query: 374 FKPEGKRE 381
              EG +E
Sbjct: 122 IGIEGVKE 129



 Score = 35.4 bits (80), Expect = 8e-04
 Identities = 18/58 (31%), Positives = 27/58 (46%), Gaps = 11/58 (18%)

Query: 329 CTGCGLCYNL-----LKCSAIYKRPD------RKAHVDPALCVGCGICAEVCPFNAFK 375
           CT CG C  +     LK   + K+ +       +   +P+LC  CG C +VCP+   K
Sbjct: 324 CTTCGACTTVCPTGALKLVEVSKKVNGETVKRNRIQYNPSLCDKCGNCVDVCPYGILK 381


>FER_METTE RecName: Full=Probable ferredoxin;
          Length = 58

 Score = 49.3 bits (116), Expect = 6e-08
 Identities = 23/55 (41%), Positives = 31/55 (56%)

Query: 323 QVDVNKCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCPFNAFKPE 377
           +V+V+ CTGCG C +    +AI    D  A VD + C+ CG C + CP NA   E
Sbjct: 4   KVNVDLCTGCGSCVDECPAAAISLNDDGIATVDESECLDCGSCEDACPNNAITIE 58


>MVHB_METTH RecName: Full=Polyferredoxin protein mvhB;
          Length = 412

 Score = 48.5 bits (114), Expect = 1e-07
 Identities = 21/71 (29%), Positives = 33/71 (46%)

Query: 307 IGVRKARRAGIQLPKYQVDVNKCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICA 366
           I  RK  +   ++ K+++D + C GC  C        I  R        PA+C  CG+C 
Sbjct: 194 ISGRKPEKRAKEIKKFELDEDACIGCNTCVEACPGDFIVPRTSNLTVELPAICTACGLCE 253

Query: 367 EVCPFNAFKPE 377
           ++CP +A   E
Sbjct: 254 QLCPVDAIDLE 264



 Score = 43.9 bits (102), Expect = 2e-06
 Identities = 24/81 (29%), Positives = 40/81 (49%), Gaps = 3/81 (3%)

Query: 303 PCALIGVRKARR-AGIQLP-KYQVDVNKCTGCGLCYNLLKCSAI-YKRPDRKAHVDPALC 359
           P  +IGV   +  A ++L  +  + +  C GCG+C       AI   +      +D   C
Sbjct: 118 PVGVIGVEGIKEPAKVELEIEGPIFIADCVGCGMCVPECPVDAITLDKVGGVIEIDEDTC 177

Query: 360 VGCGICAEVCPFNAFKPEGKR 380
           + CG+CA+ CP+NA    G++
Sbjct: 178 IKCGVCAQTCPWNAVYISGRK 198


>Y1303_METJA RecName: Full=Uncharacterized polyferredoxin-like
           protein MJ1303;
          Length = 501

 Score = 48.1 bits (113), Expect = 1e-07
 Identities = 25/74 (33%), Positives = 34/74 (45%), Gaps = 9/74 (12%)

Query: 322 YQVDVNKCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCPFNA-------- 373
           Y VD  +C GCG+C N+     I             +C  CG+C EVCP+NA        
Sbjct: 73  YYVDRRRCNGCGICANVCPIGIIKIVEKDGKKFPMGICSMCGVCVEVCPYNARVSSYELL 132

Query: 374 -FKPEGKREAWLEL 386
             K EG  E +L++
Sbjct: 133 NTKREGLAERYLKV 146



 Score = 39.3 bits (90), Expect = 6e-05
 Identities = 19/47 (40%), Positives = 21/47 (44%)

Query: 329 CTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCPFNAFK 375
           C  CG C       AI +      +VD   C GCGICA VCP    K
Sbjct: 50  CLTCGECARNCPNKAIKRNEFGGYYVDRRRCNGCGICANVCPIGIIK 96



 Score = 38.5 bits (88), Expect = 1e-04
 Identities = 20/62 (32%), Positives = 28/62 (45%), Gaps = 7/62 (11%)

Query: 323 QVDVNKCTGCGLCYNLLKCSA-------IYKRPDRKAHVDPALCVGCGICAEVCPFNAFK 375
           +VD NKC  C  C  +    A       + K  + K     + C+ CG+CAE CP  A +
Sbjct: 223 EVDYNKCILCLKCVEICPNDALKVENFKVIKVKEDKTSQPTSYCINCGLCAEHCPSGALR 282

Query: 376 PE 377
            E
Sbjct: 283 FE 284


>VORD_PYRFU RecName: Full=Ketoisovalerate oxidoreductase subunit
           vorD;         Short=VOR;         EC=1.2.7.7;AltName:
           Full=2-oxoisovalerate oxidoreductase delta chain;
          Length = 105

 Score = 47.4 bits (111), Expect = 2e-07
 Identities = 21/50 (42%), Positives = 26/50 (52%)

Query: 324 VDVNKCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCPFNA 373
           V+  KC  C +C+      AIY +PD    +D   C GCGICA  CP  A
Sbjct: 48  VNEEKCVKCYICWKYCPEPAIYIKPDGYVAIDYDYCKGCGICANECPTKA 97


>Y870_METJA RecName: Full=Uncharacterized protein MJ0870;
          Length = 620

 Score = 47.0 bits (110), Expect = 3e-07
 Identities = 28/70 (40%), Positives = 39/70 (55%), Gaps = 5/70 (7%)

Query: 315 AGIQLPKYQVDVNKCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCPFNAF 374
           AG++ PK  V+  KC GCG C  + K  AI  R +  ++ +  +CVGCG C + CP  A 
Sbjct: 483 AGVKYPK--VNEEKCNGCGRCAEVCKVEAIDIRGE-TSYTNYNVCVGCGKCIKNCPNEA- 538

Query: 375 KPEGKREAWL 384
             E K E +L
Sbjct: 539 -REVKEEGYL 547


>VORD_PYRAB RecName: Full=Ketoisovalerate oxidoreductase subunit
           vorD;         Short=VOR;         EC=1.2.7.7;AltName:
           Full=2-oxoisovalerate oxidoreductase delta chain;
          Length = 105

 Score = 46.2 bits (108), Expect = 5e-07
 Identities = 20/50 (40%), Positives = 26/50 (52%)

Query: 324 VDVNKCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCPFNA 373
           +D +KC  C +C+      AIY + D    +D   C GCGICA  CP  A
Sbjct: 48  IDESKCVKCYICWKFCPEPAIYIKEDGFVAIDYDYCKGCGICANECPTKA 97


>VHUB_METJA RecName: Full=Polyferredoxin protein vhuB;
          Length = 394

 Score = 46.2 bits (108), Expect = 5e-07
 Identities = 21/51 (41%), Positives = 29/51 (56%), Gaps = 1/51 (1%)

Query: 329 CTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCPFNAFKPEGK 379
           C GCG+C      +AI    + KA +D + C+ C ICA+ CP+NA    GK
Sbjct: 142 CVGCGICVPECPVNAITLE-NNKAVIDKSKCIYCSICAQTCPWNAIFVAGK 191


>VORD_PYRHO RecName: Full=Ketoisovalerate oxidoreductase subunit
           vorD;         Short=VOR;         EC=1.2.7.7;AltName:
           Full=2-oxoisovalerate oxidoreductase delta chain;
          Length = 105

 Score = 45.8 bits (107), Expect = 6e-07
 Identities = 20/50 (40%), Positives = 26/50 (52%)

Query: 324 VDVNKCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCPFNA 373
           +D +KC  C +C+      AIY + D    +D   C GCGICA  CP  A
Sbjct: 48  IDESKCVKCYICWKYCPEPAIYIKEDGFVAIDYDYCKGCGICANECPTKA 97


>HDRA_METMA RecName: Full=CoB--CoM heterodisulfide reductase 1
           iron-sulfur subunit A;         EC=1.8.98.1;
          Length = 793

 Score = 45.8 bits (107), Expect = 6e-07
 Identities = 22/52 (42%), Positives = 27/52 (51%), Gaps = 1/52 (1%)

Query: 324 VDVNKCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCPFNAFK 375
           VD +KC GC  C  + K   I    D+KA VD   C GCG C+  CP  A +
Sbjct: 575 VDPDKCIGCRTCVEVCKFGKI-SIVDKKAVVDEVSCYGCGDCSAACPVGAIQ 625



 Score = 36.6 bits (83), Expect = 4e-04
 Identities = 26/80 (32%), Positives = 36/80 (45%), Gaps = 19/80 (23%)

Query: 320 PKYQVDVNKCTGC-GLC-------------YNLLKCSAIY----KRPDRKAHVDPALCVG 361
           P++ ++ +KC GC  LC             Y + K  AIY    +   +   +DP  CVG
Sbjct: 235 PRFVLE-DKCKGCVDLCSEVCPVEIENPMNYGIGKSRAIYMPIPQSVPQVVLIDPDHCVG 293

Query: 362 CGICAEVCPFNAFKPEGKRE 381
           CG+C   CP  A   E K E
Sbjct: 294 CGLCQLACPAEAVDYEQKPE 313



 Score = 35.8 bits (81), Expect = 6e-04
 Identities = 13/20 (65%), Positives = 14/20 (70%)

Query: 352 AHVDPALCVGCGICAEVCPF 371
           AHVDP  C+GC  C EVC F
Sbjct: 573 AHVDPDKCIGCRTCVEVCKF 592


>HDRA_METAC RecName: Full=CoB--CoM heterodisulfide reductase 1
           iron-sulfur subunit A;         EC=1.8.98.1;
          Length = 793

 Score = 44.3 bits (103), Expect = 2e-06
 Identities = 21/52 (40%), Positives = 27/52 (51%), Gaps = 1/52 (1%)

Query: 324 VDVNKCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCPFNAFK 375
           VD +KC GC  C  + K   I    ++KA VD   C GCG C+  CP  A +
Sbjct: 575 VDPDKCIGCRTCVEVCKFGKI-SIENKKAVVDEVSCYGCGDCSAACPVGAIQ 625



 Score = 38.9 bits (89), Expect = 8e-05
 Identities = 15/29 (51%), Positives = 17/29 (58%)

Query: 352 AHVDPALCVGCGICAEVCPFNAFKPEGKR 380
           AHVDP  C+GC  C EVC F     E K+
Sbjct: 573 AHVDPDKCIGCRTCVEVCKFGKISIENKK 601



 Score = 38.1 bits (87), Expect = 1e-04
 Identities = 26/80 (32%), Positives = 37/80 (46%), Gaps = 19/80 (23%)

Query: 320 PKYQVDVNKCTGC-----GLC---------YNLLKCSAIY----KRPDRKAHVDPALCVG 361
           P++ ++ +KC GC     G+C         Y + K  AIY    +   +   +DP  CVG
Sbjct: 235 PRFVLE-DKCKGCVDLCSGVCPVEIENPMNYGIGKTRAIYMPIPQSVPQVVLIDPDHCVG 293

Query: 362 CGICAEVCPFNAFKPEGKRE 381
           CG+C   CP  A   E K E
Sbjct: 294 CGLCQLACPAEAVDYEQKPE 313


>VHUB_METVO RecName: Full=Polyferredoxin protein vhuB;
          Length = 398

 Score = 43.9 bits (102), Expect = 2e-06
 Identities = 21/65 (32%), Positives = 33/65 (50%), Gaps = 2/65 (3%)

Query: 317 IQLPKYQVDVNK-CTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCPFNAFK 375
           + +P+  + V + C GC  C  +    AI    D  A +D   C+ C +CA+ CP+NA  
Sbjct: 119 VTIPQEPIKVTEACVGCSECVPVCPVDAI-SIEDELAVIDTEKCIYCSVCAQTCPWNAIY 177

Query: 376 PEGKR 380
             GK+
Sbjct: 178 VAGKK 182



 Score = 37.7 bits (86), Expect = 2e-04
 Identities = 19/55 (34%), Positives = 26/55 (47%), Gaps = 8/55 (14%)

Query: 324 VDVNKCTGCGLCYNLLKCSAIY---KRPDR-----KAHVDPALCVGCGICAEVCP 370
           +D  KC  C +C      +AIY   K+P +     K+      C+GC  C EVCP
Sbjct: 156 IDTEKCIYCSVCAQTCPWNAIYVAGKKPSKRQKEIKSFTVTEECIGCEKCVEVCP 210



 Score = 36.6 bits (83), Expect = 4e-04
 Identities = 25/96 (26%), Positives = 36/96 (37%), Gaps = 16/96 (16%)

Query: 304 CALIGVRKARRAGIQLPKY-----QVDVNKCTGCGLCYNLLKCSAIYKRPDRKAH----- 353
           C    +    + G+ LP         +   C  CG C  ++KC     +  +  H     
Sbjct: 281 CPTNAINMINQKGLALPSRTKTDKDPEFRMCIRCGAC--VMKCPTGALKMGKITHEGKEY 338

Query: 354 ----VDPALCVGCGICAEVCPFNAFKPEGKREAWLE 385
                 PALC  CG C +VCP +  K  G  +  LE
Sbjct: 339 NRIEFSPALCNECGECVDVCPQDTLKLTGDEKKPLE 374


>HDRA2_METKA RecName: Full=CoB--CoM heterodisulfide reductase
           iron-sulfur subunit A 2;         EC=1.8.98.1;
          Length = 656

 Score = 43.9 bits (102), Expect = 2e-06
 Identities = 24/56 (42%), Positives = 26/56 (46%), Gaps = 3/56 (5%)

Query: 323 QVDVNKCTGCGLCYNLLKCSAIY---KRPDRKAHVDPALCVGCGICAEVCPFNAFK 375
           +VD   C GCG C  L    AI    K     A V  ALC GCG CA  CP  A +
Sbjct: 580 EVDEEICGGCGTCVELCPYGAIELVEKDGKLVAEVTAALCKGCGTCAAACPSGAME 635



 Score = 36.6 bits (83), Expect = 4e-04
 Identities = 25/72 (34%), Positives = 33/72 (45%), Gaps = 20/72 (27%)

Query: 320 PKYQVDVNKCTGCGLCYNLLKCS-------------AIYKRPDRKA-----HVDPALCVG 361
           P+Y VD + CTGCG C  +                 AIYK P  +A      +D   C+ 
Sbjct: 240 PRY-VDEDACTGCGACAEVCPIEVPNEFDEGLGMRKAIYK-PFPQAVPSVFTIDEEHCIR 297

Query: 362 CGICAEVCPFNA 373
           CG+C EVC  +A
Sbjct: 298 CGLCEEVCDADA 309



 Score = 35.8 bits (81), Expect = 6e-04
 Identities = 43/165 (26%), Positives = 63/165 (38%), Gaps = 42/165 (25%)

Query: 235 VVMDNAYTAMTGGQPSPSRAIPAERITEAFGISTFVIDPID----VKKSVEIIKKAVEIV 290
           V MD+   A    +     A+   R+ E+  + T  +D  D    +   V  I+ A+++ 
Sbjct: 108 VHMDDPARATEKAKDLVRMAVAKARLLES--LETIKVDVTDRALVIGGGVSGIQAALDLA 165

Query: 291 KSGRPAVVVSRRPCALIGVRKARRAGIQLPKYQVDVNKCTGCGLCYNLLKCSA------- 343
             G   ++V + P   IG R A     QL K     N C+ C L   ++  S        
Sbjct: 166 DMGFEVILVEKEPS--IGGRMA-----QLDK-TFPTNDCSICILAPKMVDVSKHPNIKMY 217

Query: 344 ------------------IYKRPDRKAHVDPALCVGCGICAEVCP 370
                             I K+P    +VD   C GCG CAEVCP
Sbjct: 218 TYAEVVEVDGYVGNFTVKIEKKP---RYVDEDACTGCGACAEVCP 259


>PORD_PYRAB RecName: Full=Pyruvate synthase subunit porD;AltName:
           Full=Pyruvate oxidoreductase delta chain;       
           Short=POR;AltName: Full=Pyruvic-ferredoxin
           oxidoreductase subunit delta;
          Length = 105

 Score = 43.5 bits (101), Expect = 3e-06
 Identities = 23/56 (41%), Positives = 28/56 (50%), Gaps = 2/56 (3%)

Query: 320 PKYQVDVNKCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCPFNAFK 375
           P+++ D  KC  C LCY      AIY   +     D   C GCGICA  CP NA +
Sbjct: 46  PEFKKD--KCVRCFLCYIYCPEPAIYLDEEGYPVFDYDYCKGCGICANECPTNAIE 99


>Y264_METJA RecName: Full=Uncharacterized protein MJ0264;
          Length = 153

 Score = 43.1 bits (100), Expect = 4e-06
 Identities = 32/101 (31%), Positives = 46/101 (45%), Gaps = 10/101 (9%)

Query: 283 IKKAVEIVKSGRPAVVVSRRPCALIGVRKARRA----GIQLPKYQVDVNKCTGCGLCYNL 338
           +K  + +   G   VVV+   C  IG R+  R+    GI   ++ +   KC  C     L
Sbjct: 4   VKSFLLLAIDGEKMVVVNVGSC--IGCRRCERSCPINGITFNEFPI---KCMHCDRNPCL 58

Query: 339 LKCSA-IYKRPDRKAHVDPALCVGCGICAEVCPFNAFKPEG 378
             C     +R + K  V    CVGCG+CA  CPF A + +G
Sbjct: 59  YACPENAIERINNKVVVIKDKCVGCGLCALACPFGAIRIDG 99


>RNFB_AZOSB RecName: Full=Electron transport complex protein
           rnfB;AltName: Full=Nitrogen fixation protein rnfB;
          Length = 183

 Score = 43.1 bits (100), Expect = 4e-06
 Identities = 22/65 (33%), Positives = 28/65 (43%), Gaps = 1/65 (1%)

Query: 324 VDVNKCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCPFNAFKPEGKREAW 383
           +D N C GC LC       AI     +   V   LC GC +C   CP +    E  RE  
Sbjct: 108 IDENVCIGCTLCLQACPVDAIVGAAKQMHTVVDPLCTGCELCVAPCPVDCIYMEPVRET- 166

Query: 384 LELWR 388
           ++ WR
Sbjct: 167 VQTWR 171


>FER2_DESNO RecName: Full=Ferredoxin-2;AltName: Full=Ferredoxin II;
          Length = 59

 Score = 43.1 bits (100), Expect = 4e-06
 Identities = 19/50 (38%), Positives = 26/50 (52%)

Query: 324 VDVNKCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCPFNA 373
           VD +KC GCG C ++        +  +   V+   C+GC  C EVCP NA
Sbjct: 7   VDSDKCIGCGECVDVCPVEVYELQNGKAVPVNEEECLGCESCIEVCPQNA 56


>NUOI_MYCA1 RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 181

 Score = 42.7 bits (99), Expect = 5e-06
 Identities = 23/71 (32%), Positives = 30/71 (42%), Gaps = 15/71 (21%)

Query: 318 QLPKYQVDVNKCTGCGLCYNLLKCSAIY---------------KRPDRKAHVDPALCVGC 362
           QL +Y   + KC GC LC       AIY               +R  R   ++   C+GC
Sbjct: 43  QLNRYPDGLEKCIGCELCAWACPADAIYVEGADNTEELRYSPGERYGRVYQINYLRCIGC 102

Query: 363 GICAEVCPFNA 373
           G+C E CP  A
Sbjct: 103 GLCVEACPTRA 113


>NUOI2_MYCPA RecName: Full=NADH-quinone oxidoreductase subunit I 2; 
                  EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I 2;
          Length = 181

 Score = 42.7 bits (99), Expect = 5e-06
 Identities = 23/71 (32%), Positives = 30/71 (42%), Gaps = 15/71 (21%)

Query: 318 QLPKYQVDVNKCTGCGLCYNLLKCSAIY---------------KRPDRKAHVDPALCVGC 362
           QL +Y   + KC GC LC       AIY               +R  R   ++   C+GC
Sbjct: 43  QLNRYPDGLEKCIGCELCAWACPADAIYVEGADNTEELRYSPGERYGRVYQINYLRCIGC 102

Query: 363 GICAEVCPFNA 373
           G+C E CP  A
Sbjct: 103 GLCVEACPTRA 113


>FER_CLOST RecName: Full=Ferredoxin;
          Length = 55

 Score = 42.7 bits (99), Expect = 5e-06
 Identities = 20/51 (39%), Positives = 27/51 (52%), Gaps = 1/51 (1%)

Query: 327 NKCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCPFNAFKPE 377
           + C  CG C      +AI    D+   +D A C+ CG CA VCP +A +PE
Sbjct: 6   DSCISCGACEPECPVNAITAGDDKYV-IDAATCIDCGACAGVCPVDAPQPE 55


>RNFB_AZOSE RecName: Full=Electron transport complex protein rnfB;
          Length = 183

 Score = 42.4 bits (98), Expect = 7e-06
 Identities = 22/66 (33%), Positives = 27/66 (40%), Gaps = 1/66 (1%)

Query: 323 QVDVNKCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCPFNAFKPEGKREA 382
           ++D   C GC LC       AI         V PALC GC +C   CP +        E 
Sbjct: 107 RIDEQLCIGCTLCIQACPVDAIVGAAKHMHTVVPALCTGCELCVAPCPVDCIAMTPLPET 166

Query: 383 WLELWR 388
            LE W+
Sbjct: 167 -LETWK 171


>PORD_METBF RecName: Full=Pyruvate synthase subunit porD;AltName:
           Full=Pyruvate oxidoreductase delta chain;       
           Short=POR;AltName: Full=Pyruvic-ferredoxin
           oxidoreductase subunit delta;
          Length = 95

 Score = 42.4 bits (98), Expect = 7e-06
 Identities = 18/48 (37%), Positives = 26/48 (54%)

Query: 328 KCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCPFNAFK 375
           KCT CG+C+ +    ++  R +     D   C GCGICA  CP +A +
Sbjct: 42  KCTKCGICHIVCPDMSVKPRENGFFEYDYDYCKGCGICANECPADAIE 89


>NUOI_MYCUA RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 181

 Score = 42.4 bits (98), Expect = 7e-06
 Identities = 23/71 (32%), Positives = 30/71 (42%), Gaps = 15/71 (21%)

Query: 318 QLPKYQVDVNKCTGCGLCYNLLKCSAIY---------------KRPDRKAHVDPALCVGC 362
           QL +Y   + KC GC LC       AIY               +R  R   ++   C+GC
Sbjct: 43  QLNRYPDGLEKCIGCELCAWACPADAIYVEGADNTDEQRFSPGERYGRVYQINYLRCIGC 102

Query: 363 GICAEVCPFNA 373
           G+C E CP  A
Sbjct: 103 GLCIEACPTRA 113


>NUOI_MYCTU RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 211

 Score = 42.4 bits (98), Expect = 7e-06
 Identities = 23/71 (32%), Positives = 30/71 (42%), Gaps = 15/71 (21%)

Query: 318 QLPKYQVDVNKCTGCGLCYNLLKCSAIY---------------KRPDRKAHVDPALCVGC 362
           QL +Y   + KC GC LC       AIY               +R  R   ++   C+GC
Sbjct: 70  QLNRYPDGLEKCIGCELCAWACPADAIYVEGADNTEEERFSPGERYGRVYQINYLRCIGC 129

Query: 363 GICAEVCPFNA 373
           G+C E CP  A
Sbjct: 130 GLCIEACPTRA 140


>NUOI_MYCTA RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 211

 Score = 42.4 bits (98), Expect = 7e-06
 Identities = 23/71 (32%), Positives = 30/71 (42%), Gaps = 15/71 (21%)

Query: 318 QLPKYQVDVNKCTGCGLCYNLLKCSAIY---------------KRPDRKAHVDPALCVGC 362
           QL +Y   + KC GC LC       AIY               +R  R   ++   C+GC
Sbjct: 70  QLNRYPDGLEKCIGCELCAWACPADAIYVEGADNTEEERFSPGERYGRVYQINYLRCIGC 129

Query: 363 GICAEVCPFNA 373
           G+C E CP  A
Sbjct: 130 GLCIEACPTRA 140


>NUOI_MYCSS RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 174

 Score = 42.4 bits (98), Expect = 7e-06
 Identities = 23/71 (32%), Positives = 29/71 (40%), Gaps = 15/71 (21%)

Query: 318 QLPKYQVDVNKCTGCGLCYNLLKCSAIYKRPD---------------RKAHVDPALCVGC 362
           QL +Y   + KC GC LC       AIY   D               R   ++   C+GC
Sbjct: 43  QLNRYPDGLEKCIGCELCAWACPADAIYVEGDDNTADERYSPGERYGRVYQINYLRCIGC 102

Query: 363 GICAEVCPFNA 373
           G+C E CP  A
Sbjct: 103 GLCIEACPTRA 113


>NUOI_MYCSK RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 174

 Score = 42.4 bits (98), Expect = 7e-06
 Identities = 23/71 (32%), Positives = 29/71 (40%), Gaps = 15/71 (21%)

Query: 318 QLPKYQVDVNKCTGCGLCYNLLKCSAIYKRPD---------------RKAHVDPALCVGC 362
           QL +Y   + KC GC LC       AIY   D               R   ++   C+GC
Sbjct: 43  QLNRYPDGLEKCIGCELCAWACPADAIYVEGDDNTADERYSPGERYGRVYQINYLRCIGC 102

Query: 363 GICAEVCPFNA 373
           G+C E CP  A
Sbjct: 103 GLCIEACPTRA 113


>NUOI_MYCSJ RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 174

 Score = 42.4 bits (98), Expect = 7e-06
 Identities = 23/71 (32%), Positives = 29/71 (40%), Gaps = 15/71 (21%)

Query: 318 QLPKYQVDVNKCTGCGLCYNLLKCSAIYKRPD---------------RKAHVDPALCVGC 362
           QL +Y   + KC GC LC       AIY   D               R   ++   C+GC
Sbjct: 43  QLNRYPDGLEKCIGCELCAWACPADAIYVEGDDNTADERYSPGERYGRVYQINYLRCIGC 102

Query: 363 GICAEVCPFNA 373
           G+C E CP  A
Sbjct: 103 GLCIEACPTRA 113


>NUOI_MYCS2 RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 180

 Score = 42.4 bits (98), Expect = 7e-06
 Identities = 23/71 (32%), Positives = 30/71 (42%), Gaps = 15/71 (21%)

Query: 318 QLPKYQVDVNKCTGCGLCYNLLKCSAIY---------------KRPDRKAHVDPALCVGC 362
           QL +Y   + KC GC LC       AIY               +R  R   ++   C+GC
Sbjct: 43  QLNRYPDGLEKCIGCELCAWACPADAIYVEGADNTADERYSPGERYGRVYQINYLRCIGC 102

Query: 363 GICAEVCPFNA 373
           G+C E CP  A
Sbjct: 103 GLCIEACPTRA 113


>NUOI_MYCMM RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 181

 Score = 42.4 bits (98), Expect = 7e-06
 Identities = 23/71 (32%), Positives = 30/71 (42%), Gaps = 15/71 (21%)

Query: 318 QLPKYQVDVNKCTGCGLCYNLLKCSAIY---------------KRPDRKAHVDPALCVGC 362
           QL +Y   + KC GC LC       AIY               +R  R   ++   C+GC
Sbjct: 43  QLNRYPDGLEKCIGCELCAWACPADAIYVEGADNTDEQRFSPGERYGRVYQINYLRCIGC 102

Query: 363 GICAEVCPFNA 373
           G+C E CP  A
Sbjct: 103 GLCIEACPTRA 113


>NUOI_MYCBT RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 211

 Score = 42.4 bits (98), Expect = 7e-06
 Identities = 23/71 (32%), Positives = 30/71 (42%), Gaps = 15/71 (21%)

Query: 318 QLPKYQVDVNKCTGCGLCYNLLKCSAIY---------------KRPDRKAHVDPALCVGC 362
           QL +Y   + KC GC LC       AIY               +R  R   ++   C+GC
Sbjct: 70  QLNRYPDGLEKCIGCELCAWACPADAIYVEGADNTEEERFSPGERYGRVYQINYLRCIGC 129

Query: 363 GICAEVCPFNA 373
           G+C E CP  A
Sbjct: 130 GLCIEACPTRA 140


>NUOI_MYCBP RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 211

 Score = 42.4 bits (98), Expect = 7e-06
 Identities = 23/71 (32%), Positives = 30/71 (42%), Gaps = 15/71 (21%)

Query: 318 QLPKYQVDVNKCTGCGLCYNLLKCSAIY---------------KRPDRKAHVDPALCVGC 362
           QL +Y   + KC GC LC       AIY               +R  R   ++   C+GC
Sbjct: 70  QLNRYPDGLEKCIGCELCAWACPADAIYVEGADNTEEERFSPGERYGRVYQINYLRCIGC 129

Query: 363 GICAEVCPFNA 373
           G+C E CP  A
Sbjct: 130 GLCIEACPTRA 140


>NUOI_MYCBO RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 211

 Score = 42.4 bits (98), Expect = 7e-06
 Identities = 23/71 (32%), Positives = 30/71 (42%), Gaps = 15/71 (21%)

Query: 318 QLPKYQVDVNKCTGCGLCYNLLKCSAIY---------------KRPDRKAHVDPALCVGC 362
           QL +Y   + KC GC LC       AIY               +R  R   ++   C+GC
Sbjct: 70  QLNRYPDGLEKCIGCELCAWACPADAIYVEGADNTEEERFSPGERYGRVYQINYLRCIGC 129

Query: 363 GICAEVCPFNA 373
           G+C E CP  A
Sbjct: 130 GLCIEACPTRA 140


>YEIA_ECOLI RecName: Full=Uncharacterized protein yeiA;
          Length = 411

 Score = 41.6 bits (96), Expect = 1e-05
 Identities = 18/54 (33%), Positives = 28/54 (51%), Gaps = 8/54 (14%)

Query: 323 QVDVNKCTGCGLCYNLLKC------SAIYKRPDRKAHVDPALCVGCGICAEVCP 370
           +++++KC GCG CY  + C      +  +    R  H +   CVGC +C  VCP
Sbjct: 338 RINLDKCVGCGRCY--ISCYDGGHQAMEWSEKTRTPHCNTEKCVGCLLCGHVCP 389


>FER6_METJA RecName: Full=Uncharacterized ferredoxin MJ0624;
          Length = 58

 Score = 41.6 bits (96), Expect = 1e-05
 Identities = 22/50 (44%), Positives = 24/50 (48%), Gaps = 2/50 (4%)

Query: 326 VNKCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCPFNAFK 375
           + KC GCG C       AI  +    A VD   C  CGICA  CP NA K
Sbjct: 6   LEKCVGCGNCVVFCPRRAI--KTYGVAIVDENKCSNCGICARYCPINAIK 53


>FER2_METJA RecName: Full=Uncharacterized ferredoxin MJ0099;
          Length = 131

 Score = 41.6 bits (96), Expect = 1e-05
 Identities = 18/51 (35%), Positives = 22/51 (43%)

Query: 325 DVNKCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCPFNAFK 375
           D+ KC  CG C      + IY   D         CVGC  C + CPF A +
Sbjct: 78  DLEKCVHCGCCITQCPINVIYMDEDYNVVFKEEDCVGCKNCLKACPFKAIE 128


>ODPA_ZYMMO RecName: Full=Pyruvate dehydrogenase E1 component
           subunit alpha;         EC=1.2.4.1;
          Length = 354

 Score = 41.2 bits (95), Expect = 2e-05
 Identities = 32/122 (26%), Positives = 59/122 (48%), Gaps = 7/122 (5%)

Query: 187 MGSSVGLGAGIALA-----TGQFVVATVGDSTFYHAVLPQLVDIATR-SVPILIVVMDNA 240
           +G+ V LGAG+A A      G    A  GD +     + +  ++A    +P++ V+ +N 
Sbjct: 148 VGAQVPLGAGLAFAHKYRNDGGCSAAYFGDGSANQGQVYEAYNMAALWKLPVIFVIENNG 207

Query: 241 YTAMTGGQPSPSRAIPAERITEAFGISTFVIDPIDVKKSVEIIKKAVEIVKSGRPAVVVS 300
           Y   T  Q + +    +ER    FGI   V+D +DV +       AV+ V++G+  +++ 
Sbjct: 208 YAMGTSIQRANAHTALSER-GAGFGIPALVVDGMDVLEVRGAATVAVDWVQAGKGPIILE 266

Query: 301 RR 302
            +
Sbjct: 267 MK 268


>NUOI_SULDN RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 211

 Score = 41.2 bits (95), Expect = 2e-05
 Identities = 22/69 (31%), Positives = 32/69 (46%), Gaps = 9/69 (13%)

Query: 322 YQVDVNKCTGCGLCYNLL--KCSAIYKRPDRKAH-------VDPALCVGCGICAEVCPFN 372
           ++ D  +C GCGLC  +    C  I  + D  +        ++   C+ CG CAEVCP  
Sbjct: 92  WESDTERCIGCGLCEKICISNCIRIDTKLDENSRKEVTEYSINLGRCIFCGYCAEVCPEL 151

Query: 373 AFKPEGKRE 381
           A    G+ E
Sbjct: 152 AITHGGEYE 160


>NUOI_RHOE4 RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 195

 Score = 41.2 bits (95), Expect = 2e-05
 Identities = 22/71 (30%), Positives = 30/71 (42%), Gaps = 15/71 (21%)

Query: 318 QLPKYQVDVNKCTGCGLCYNLLKCSAIY---------------KRPDRKAHVDPALCVGC 362
           QL +Y   + KC GC LC       AIY               +R  +   ++   C+GC
Sbjct: 43  QLNRYADGLEKCIGCELCAWACPADAIYVEGADNTEEERFSPGERYGQVYQINYLRCIGC 102

Query: 363 GICAEVCPFNA 373
           G+C E CP  A
Sbjct: 103 GLCVEACPTRA 113


>NUOI_MAGSM RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 164

 Score = 41.2 bits (95), Expect = 2e-05
 Identities = 20/65 (30%), Positives = 28/65 (43%), Gaps = 10/65 (15%)

Query: 319 LPKYQVDVNKCTGCGLCYNLLKCSAIYKRPDRKAHVDPAL----------CVGCGICAEV 368
           L +Y+    +C  C LC  +    AIY   D ++  D  L          C+ CG+C E 
Sbjct: 54  LRRYEGGEERCVACKLCEAICPAQAIYIEIDTESRADKRLTKVYDIDLFKCIYCGLCEEA 113

Query: 369 CPFNA 373
           CP  A
Sbjct: 114 CPVEA 118


>NUOI_HELPY RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 220

 Score = 41.2 bits (95), Expect = 2e-05
 Identities = 19/52 (36%), Positives = 27/52 (51%), Gaps = 9/52 (17%)

Query: 328 KCTGCGLCYNLLKCSAI----YKRPDRKAHVDP-----ALCVGCGICAEVCP 370
           +C GCGLC  +   + I    +K  D +  +D        C+ CG+CAEVCP
Sbjct: 81  RCIGCGLCEKICTSNCIRIITHKGEDNRKKIDSYTINLGRCIYCGLCAEVCP 132


>NUOI_HELPS RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 220

 Score = 41.2 bits (95), Expect = 2e-05
 Identities = 19/52 (36%), Positives = 27/52 (51%), Gaps = 9/52 (17%)

Query: 328 KCTGCGLCYNLLKCSAI----YKRPDRKAHVDP-----ALCVGCGICAEVCP 370
           +C GCGLC  +   + I    +K  D +  +D        C+ CG+CAEVCP
Sbjct: 81  RCIGCGLCEKICTSNCIRIITHKGEDNRKKIDSYTINLGRCIYCGLCAEVCP 132


>NUOI_HELPJ RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 220

 Score = 41.2 bits (95), Expect = 2e-05
 Identities = 19/52 (36%), Positives = 27/52 (51%), Gaps = 9/52 (17%)

Query: 328 KCTGCGLCYNLLKCSAI----YKRPDRKAHVDP-----ALCVGCGICAEVCP 370
           +C GCGLC  +   + I    +K  D +  +D        C+ CG+CAEVCP
Sbjct: 81  RCIGCGLCEKICTSNCIRIITHKGEDNRKKIDSYTINLGRCIYCGLCAEVCP 132


>NUOI_HELPH RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 220

 Score = 41.2 bits (95), Expect = 2e-05
 Identities = 19/52 (36%), Positives = 27/52 (51%), Gaps = 9/52 (17%)

Query: 328 KCTGCGLCYNLLKCSAI----YKRPDRKAHVDP-----ALCVGCGICAEVCP 370
           +C GCGLC  +   + I    +K  D +  +D        C+ CG+CAEVCP
Sbjct: 81  RCIGCGLCEKICTSNCIRIITHKGEDNRKKIDSYTINLGRCIYCGLCAEVCP 132


>NUOI_HELPG RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 220

 Score = 41.2 bits (95), Expect = 2e-05
 Identities = 19/52 (36%), Positives = 27/52 (51%), Gaps = 9/52 (17%)

Query: 328 KCTGCGLCYNLLKCSAI----YKRPDRKAHVDP-----ALCVGCGICAEVCP 370
           +C GCGLC  +   + I    +K  D +  +D        C+ CG+CAEVCP
Sbjct: 81  RCIGCGLCEKICTSNCIRIITHKGEDNRKKIDSYTINLGRCIYCGLCAEVCP 132


>NUOI_HELP2 RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 220

 Score = 41.2 bits (95), Expect = 2e-05
 Identities = 19/52 (36%), Positives = 27/52 (51%), Gaps = 9/52 (17%)

Query: 328 KCTGCGLCYNLLKCSAI----YKRPDRKAHVDP-----ALCVGCGICAEVCP 370
           +C GCGLC  +   + I    +K  D +  +D        C+ CG+CAEVCP
Sbjct: 81  RCIGCGLCEKICTSNCIRIITHKGEDNRKKIDSYTINLGRCIYCGLCAEVCP 132


>NUOI_HELAH RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 220

 Score = 41.2 bits (95), Expect = 2e-05
 Identities = 19/52 (36%), Positives = 27/52 (51%), Gaps = 9/52 (17%)

Query: 328 KCTGCGLCYNLLKCSAI----YKRPDRKAHVDP-----ALCVGCGICAEVCP 370
           +C GCGLC  +   + I    +K  D +  +D        C+ CG+CAEVCP
Sbjct: 81  RCIGCGLCEKICTSNCIRIITHKGEDNRKKIDSYTINLGRCIYCGLCAEVCP 132


>FER_ALIAC RecName: Full=Ferredoxin;
          Length = 78

 Score = 41.2 bits (95), Expect = 2e-05
 Identities = 20/52 (38%), Positives = 28/52 (53%), Gaps = 6/52 (11%)

Query: 335 CYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCPFNA-----FKPEGKRE 381
           C       AI++ PD+  ++DP LC+ C  C  VCP NA     F PE ++E
Sbjct: 16  CVETCPVDAIHEGPDQY-YIDPDLCIDCAACEPVCPVNAIYQEEFVPEDEKE 66


>Y1043_HAEIN RecName: Full=Uncharacterized protein HI1043;
          Length = 166

 Score = 40.8 bits (94), Expect = 2e-05
 Identities = 21/49 (42%), Positives = 24/49 (48%), Gaps = 1/49 (2%)

Query: 329 CTGCGLCYNLLKCSAIY-KRPDRKAHVDPALCVGCGICAEVCPFNAFKP 376
           C GCG C +      I  K+      +D A C  CG CAEVCP NA  P
Sbjct: 53  CNGCGECASACPNGLIQLKQQQATLEIDYAPCDLCGKCAEVCPTNALHP 101


>PORD_PYRHO RecName: Full=Pyruvate synthase subunit porD;AltName:
           Full=Pyruvate oxidoreductase delta chain;       
           Short=POR;AltName: Full=Pyruvic-ferredoxin
           oxidoreductase subunit delta;
          Length = 105

 Score = 40.8 bits (94), Expect = 2e-05
 Identities = 22/56 (39%), Positives = 26/56 (46%), Gaps = 2/56 (3%)

Query: 320 PKYQVDVNKCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCPFNAFK 375
           P++  D  KC  C LCY      AIY   +     D   C GCGICA  CP  A +
Sbjct: 46  PEFHKD--KCVRCFLCYIYCPEPAIYLDEEGYPVFDYDYCKGCGICANECPTKAIE 99


>PORD_PYRFU RecName: Full=Pyruvate synthase subunit porD;AltName:
           Full=Pyruvate oxidoreductase delta chain;       
           Short=POR;AltName: Full=Pyruvic-ferredoxin
           oxidoreductase subunit delta;
          Length = 105

 Score = 40.8 bits (94), Expect = 2e-05
 Identities = 21/55 (38%), Positives = 26/55 (47%)

Query: 321 KYQVDVNKCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCPFNAFK 375
           K + + +KC  C LCY      AIY   +     D   C GCGICA  CP  A +
Sbjct: 45  KPEFNRDKCVRCYLCYIYCPEPAIYLDEEGYPVFDYDYCKGCGICANECPTKAIE 99


>ODBA_THET8 RecName: Full=2-oxoisovalerate dehydrogenase subunit
           alpha;         EC=1.2.4.4;AltName: Full=Branched-chain
           alpha-keto acid dehydrogenase E1 component alpha chain;
          Length = 367

 Score = 40.8 bits (94), Expect = 2e-05
 Identities = 33/135 (24%), Positives = 57/135 (42%), Gaps = 3/135 (2%)

Query: 170 GCYSLGINTGQQDLITHMGSSVGLGAGIALA-TGQFVVATVGDSTFYHAVLPQLVDIAT- 227
           G  +L   T    + +H+  + G    + L  TGQ  V T GD           ++ A  
Sbjct: 133 GSKALNFFTVASPIASHVPPAAGAAISMKLLRTGQVAVCTFGDGATSEGDWYAGINFAAV 192

Query: 228 RSVPILIVVMDNAYTAMTGGQPSPSRAIPAERITEAFGISTFVIDPIDVKKSVEIIKKAV 287
           +  P + +  +N Y      +        A++   AFGI  +++D +DV  S  ++K+AV
Sbjct: 193 QGAPAVFIAENNFYAISVDYRHQTHSPTIADK-AHAFGIPGYLVDGMDVLASYYVVKEAV 251

Query: 288 EIVKSGRPAVVVSRR 302
           E  + G    +V  R
Sbjct: 252 ERARRGEGPSLVELR 266


>ODBA_THET2 RecName: Full=2-oxoisovalerate dehydrogenase subunit
           alpha;         EC=1.2.4.4;AltName: Full=Branched-chain
           alpha-keto acid dehydrogenase E1 component alpha chain;
          Length = 367

 Score = 40.8 bits (94), Expect = 2e-05
 Identities = 34/135 (25%), Positives = 57/135 (42%), Gaps = 3/135 (2%)

Query: 170 GCYSLGINTGQQDLITHMGSSVGLGAGIALA-TGQFVVATVGDSTFYHAVLPQLVDIAT- 227
           G  +L   T    + +H+  + G    + L  TGQ  V T GD           ++ A  
Sbjct: 133 GSKALNFFTVASPIASHVPPAAGAAISMKLLRTGQVAVCTFGDGATSEGDWYAGINFAAV 192

Query: 228 RSVPILIVVMDNAYTAMTGGQPSPSRAIPAERITEAFGISTFVIDPIDVKKSVEIIKKAV 287
           +  P + V  +N Y      +        A++   AFGI  +++D +DV  S  ++K+AV
Sbjct: 193 QGAPAVFVCENNFYAISVDYRHQTHSPTIADK-AHAFGIPGYLVDGMDVLASYYVVKEAV 251

Query: 288 EIVKSGRPAVVVSRR 302
           E  + G    +V  R
Sbjct: 252 ERARRGEGPSLVELR 266


>NUOI_RHOSR RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 188

 Score = 40.8 bits (94), Expect = 2e-05
 Identities = 22/71 (30%), Positives = 30/71 (42%), Gaps = 15/71 (21%)

Query: 318 QLPKYQVDVNKCTGCGLCYNLLKCSAIY---------------KRPDRKAHVDPALCVGC 362
           QL +Y   + KC GC LC       AIY               +R  +   ++   C+GC
Sbjct: 43  QLNRYADGLEKCIGCELCAWACPADAIYVEGADNTDEERFSPGERYGQVYQINYLRCIGC 102

Query: 363 GICAEVCPFNA 373
           G+C E CP  A
Sbjct: 103 GLCIEACPTRA 113


>NUOI_RHOOB RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 188

 Score = 40.8 bits (94), Expect = 2e-05
 Identities = 22/71 (30%), Positives = 30/71 (42%), Gaps = 15/71 (21%)

Query: 318 QLPKYQVDVNKCTGCGLCYNLLKCSAIY---------------KRPDRKAHVDPALCVGC 362
           QL +Y   + KC GC LC       AI+               +R  R   ++   C+GC
Sbjct: 43  QLNRYADGLEKCIGCELCAWACPADAIFVEGADNTDEERYSPGERYGRVYQINYLRCIGC 102

Query: 363 GICAEVCPFNA 373
           G+C E CP  A
Sbjct: 103 GLCIEACPTRA 113


>NUOI_MYCVP RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 174

 Score = 40.8 bits (94), Expect = 2e-05
 Identities = 22/71 (30%), Positives = 30/71 (42%), Gaps = 15/71 (21%)

Query: 318 QLPKYQVDVNKCTGCGLCYNLLKCSAIY---------------KRPDRKAHVDPALCVGC 362
           QL +Y   + KC GC LC       AI+               +R  R   ++   C+GC
Sbjct: 43  QLNRYPDGLEKCIGCELCAWACPADAIFVEGADNTESERYSPGERYGRVYQINYLRCIGC 102

Query: 363 GICAEVCPFNA 373
           G+C E CP  A
Sbjct: 103 GLCIEACPTRA 113


>NUOI_MYCGI RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 175

 Score = 40.8 bits (94), Expect = 2e-05
 Identities = 22/71 (30%), Positives = 30/71 (42%), Gaps = 15/71 (21%)

Query: 318 QLPKYQVDVNKCTGCGLCYNLLKCSAIY---------------KRPDRKAHVDPALCVGC 362
           QL +Y   + KC GC LC       AI+               +R  R   ++   C+GC
Sbjct: 43  QLNRYADGLEKCIGCELCAWACPADAIFVEGADNTEAERYSPGERYGRVYQINYLRCIGC 102

Query: 363 GICAEVCPFNA 373
           G+C E CP  A
Sbjct: 103 GLCIEACPTRA 113


>HYFA_ECOLI RecName: Full=Hydrogenase-4 component A;       
           EC=1.-.-.-;
          Length = 205

 Score = 40.8 bits (94), Expect = 2e-05
 Identities = 18/46 (39%), Positives = 26/46 (56%), Gaps = 1/46 (2%)

Query: 335 CYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCPFNAFKPEGKR 380
           C  +   +AI +R D    ++ +LC+GC +CA VCPF A    G R
Sbjct: 59  CLQVCPVNAISQRDDA-IQLNESLCIGCKLCAVVCPFGAISASGSR 103


>FDHL_STAS1 RecName: Full=Putative formate dehydrogenase SSP0601;   
                EC=1.2.1.2;
          Length = 984

 Score = 40.8 bits (94), Expect = 2e-05
 Identities = 22/67 (32%), Positives = 32/67 (47%), Gaps = 13/67 (19%)

Query: 320 PKYQVDVNKCTGCGLCYNLLKCSAIYK---------RP----DRKAHVDPALCVGCGICA 366
           P Y+ D N+C  CG C  + +   + +         +P    D    ++ + CVGCG CA
Sbjct: 138 PFYRYDPNQCILCGRCVEVCQDVQVNETLTIDWERQQPRVIWDNDTSINDSSCVGCGQCA 197

Query: 367 EVCPFNA 373
            VCP NA
Sbjct: 198 TVCPCNA 204


>NUOI1_GEOSL RecName: Full=NADH-quinone oxidoreductase subunit I 1; 
                  EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I 1;
          Length = 132

 Score = 40.4 bits (93), Expect = 3e-05
 Identities = 23/75 (30%), Positives = 31/75 (41%), Gaps = 9/75 (12%)

Query: 316 GIQLPKYQVDVNKCTGCGLCYNLL--KCSAIYKRPD-------RKAHVDPALCVGCGICA 366
           G+   K   D  KC  C LC  +   KC  +    D        +  +D   C+ CG C 
Sbjct: 38  GLHALKVSHDKAKCVACYLCPTVCPAKCITVEAGEDATHDKYAERYEIDMLRCIFCGYCV 97

Query: 367 EVCPFNAFKPEGKRE 381
           E CP +A K  G+ E
Sbjct: 98  EACPVDALKMTGQFE 112


>NUOHI_NOCFA RecName: Full=NADH-quinone oxidoreductase subunits H/I;
                   EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunits H/I;
          Length = 597

 Score = 40.4 bits (93), Expect = 3e-05
 Identities = 22/71 (30%), Positives = 30/71 (42%), Gaps = 15/71 (21%)

Query: 318 QLPKYQVDVNKCTGCGLCYNLLKCSAIY---------------KRPDRKAHVDPALCVGC 362
           QL ++   + KC GC LC       AIY               +R  R   ++   C+GC
Sbjct: 454 QLNRHPDGLEKCIGCELCAWACPADAIYVEGADNTEDERYSPGERYGRVYQINYLRCIGC 513

Query: 363 GICAEVCPFNA 373
           G+C E CP  A
Sbjct: 514 GLCIEACPTRA 524


>FER_BUTME RecName: Full=Ferredoxin;
          Length = 55

 Score = 40.4 bits (93), Expect = 3e-05
 Identities = 19/51 (37%), Positives = 26/51 (50%), Gaps = 2/51 (3%)

Query: 327 NKCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCPFNAFKPE 377
           ++C  CG C +     AI +    +  +D ALC  CG CA+ CP  A  PE
Sbjct: 6   DECIACGSCADQCPVEAISEGSIYE--IDEALCTDCGACADQCPVEAIVPE 54


>Y578_METJA RecName: Full=Uncharacterized protein MJ0578;
          Length = 276

 Score = 40.0 bits (92), Expect = 3e-05
 Identities = 23/61 (37%), Positives = 36/61 (59%), Gaps = 7/61 (11%)

Query: 322 YQVDVNKCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCPFNAFKPEGKRE 381
           Y+++ + C  CG C ++ +  AI    D K  ++P LC GCG C  +C F+A +P  KRE
Sbjct: 70  YEIN-DDCIRCGKCLDVCQFDAI---GDFK--INPILCEGCGACELICEFDAIEPI-KRE 122

Query: 382 A 382
           +
Sbjct: 123 S 123


>HMC2_DESVH RecName: Full=Protein DVU_0535;AltName: Full=HMC operon
           ORF 2;
          Length = 370

 Score = 40.0 bits (92), Expect = 3e-05
 Identities = 22/66 (33%), Positives = 29/66 (43%), Gaps = 4/66 (6%)

Query: 309 VRKARRAGIQLPKYQVDVNKCTGC--GLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICA 366
           V +   AG+  P ++    +C  C    C +     A  K PD     D +LCVGC  C 
Sbjct: 92  VNRYNAAGLDHPVFRKQ--QCNHCLEPACASACFVKAFTKNPDGSVTYDGSLCVGCRYCM 149

Query: 367 EVCPFN 372
             CPFN
Sbjct: 150 VACPFN 155


>HDRA_METTM RecName: Full=CoB--CoM heterodisulfide reductase
           iron-sulfur subunit A;         EC=1.8.98.1;
          Length = 659

 Score = 40.0 bits (92), Expect = 3e-05
 Identities = 20/49 (40%), Positives = 25/49 (51%), Gaps = 1/49 (2%)

Query: 325 DVNKCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCPFNA 373
           D + C GC +C  L    AI    +  A+V+ ALC GCG C   CP  A
Sbjct: 587 DSDVCGGCEVCIELCPFGAI-SIEEGHANVNVALCKGCGTCVAACPSGA 634


>HDRA_METTH RecName: Full=CoB--CoM heterodisulfide reductase
           iron-sulfur subunit A;         EC=1.8.98.1;
          Length = 659

 Score = 40.0 bits (92), Expect = 3e-05
 Identities = 20/49 (40%), Positives = 25/49 (51%), Gaps = 1/49 (2%)

Query: 325 DVNKCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCPFNA 373
           D + C GC +C  L    AI    +  A+V+ ALC GCG C   CP  A
Sbjct: 588 DSDVCGGCEVCIELCPFGAI-SIEEGHANVNVALCKGCGTCVAACPSGA 635


>RNFB_HAEIN RecName: Full=Electron transport complex protein rnfB;
          Length = 193

 Score = 39.7 bits (91), Expect = 4e-05
 Identities = 30/100 (30%), Positives = 39/100 (39%), Gaps = 9/100 (9%)

Query: 277 KKSVEIIKKAVEIVK---SGRPAVVVSRRPCALIGVRKARRAGIQLPKYQV---DVNKCT 330
           K   E I    EI K    G+  +V   +   ++GV      GI+ P  +V   D N C 
Sbjct: 55  KPYAEAICNGDEITKCIPGGQTTIV---KIAEILGVDVPTMEGIEEPIEKVAFIDENMCI 111

Query: 331 GCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCP 370
           GC  C       AI         + P LC GC +C   CP
Sbjct: 112 GCTKCIQACPVDAIIGTNKAMHTIIPDLCTGCELCVAPCP 151


>RNFB_HAEIE RecName: Full=Electron transport complex protein rnfB;
          Length = 193

 Score = 39.7 bits (91), Expect = 4e-05
 Identities = 30/100 (30%), Positives = 39/100 (39%), Gaps = 9/100 (9%)

Query: 277 KKSVEIIKKAVEIVK---SGRPAVVVSRRPCALIGVRKARRAGIQLPKYQV---DVNKCT 330
           K   E I    EI K    G+  +V   +   ++GV      GI+ P  +V   D N C 
Sbjct: 55  KPYAEAICNGDEITKCIPGGQTTIV---KIAEILGVDVPTMEGIEEPIEKVAFIDENMCI 111

Query: 331 GCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCP 370
           GC  C       AI         + P LC GC +C   CP
Sbjct: 112 GCTKCIQACPVDAIIGTNKAMHTIIPDLCTGCELCVAPCP 151


>RNFB_HAEI8 RecName: Full=Electron transport complex protein rnfB;
          Length = 193

 Score = 39.7 bits (91), Expect = 4e-05
 Identities = 30/100 (30%), Positives = 39/100 (39%), Gaps = 9/100 (9%)

Query: 277 KKSVEIIKKAVEIVK---SGRPAVVVSRRPCALIGVRKARRAGIQLPKYQV---DVNKCT 330
           K   E I    EI K    G+  +V   +   ++GV      GI+ P  +V   D N C 
Sbjct: 55  KPYAEAICNGDEITKCIPGGQTTIV---KIAEILGVDVPTMEGIEEPIEKVAFIDENMCI 111

Query: 331 GCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCP 370
           GC  C       AI         + P LC GC +C   CP
Sbjct: 112 GCTKCIQACPVDAIIGTNKAMHTIIPDLCTGCELCVAPCP 151


>RNFB_BUCAP RecName: Full=Electron transport complex protein rnfB;
          Length = 168

 Score = 39.7 bits (91), Expect = 4e-05
 Identities = 18/52 (34%), Positives = 21/52 (40%)

Query: 324 VDVNKCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCPFNAFK 375
           +D   C GC  C +     AI   P+    V    C GC IC   CP N  K
Sbjct: 113 IDEKNCVGCSKCASFCPVDAIIGTPNFMHTVLQKFCTGCNICLLHCPTNCIK 164


>NUOI_PARUW RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 157

 Score = 39.7 bits (91), Expect = 4e-05
 Identities = 28/113 (24%), Positives = 45/113 (39%), Gaps = 15/113 (13%)

Query: 276 VKKSVEIIKKAVEIVKSGRPAVVVSRRPCALIGVRKARRAGIQLPKYQVDVNKCTGCGLC 335
           + K + ++K  + ++K      V  R P     +    R    L K+   + +C GC LC
Sbjct: 5   IHKVITMMKGLIIVLKHAFQTPVTLRYPEEKRILPARSRGRHYLTKWNDGLERCVGCELC 64

Query: 336 YNLLKCSAIYKRP------------DRKA---HVDPALCVGCGICAEVCPFNA 373
             +    AIY +P            +R A    ++   C+ CG C E CP  A
Sbjct: 65  AIVCPAQAIYVKPAANEPGHIHSHGERYASDFQINMLRCIFCGYCEEACPTGA 117


>FDHL_BACSU RecName: Full=Putative formate dehydrogenase yrhE;      
             EC=1.2.1.2;
          Length = 980

 Score = 39.7 bits (91), Expect = 4e-05
 Identities = 24/67 (35%), Positives = 31/67 (46%), Gaps = 13/67 (19%)

Query: 320 PKYQVDVNKCTGCG----LCYNL-----LKCSAIYKRP----DRKAHVDPALCVGCGICA 366
           P Y+ D N+C  CG    +C NL     L      +RP    D    ++ + CV CG C 
Sbjct: 144 PFYRYDPNQCIACGQCVEVCQNLQVNETLSIDWERERPRVIWDEGVPINESSCVSCGQCV 203

Query: 367 EVCPFNA 373
            VCP NA
Sbjct: 204 TVCPCNA 210


>YJGC_BACSU RecName: Full=Probable oxidoreductase yjgC;       
           EC=1.-.-.-;
          Length = 985

 Score = 39.3 bits (90), Expect = 6e-05
 Identities = 22/72 (30%), Positives = 32/72 (44%), Gaps = 13/72 (18%)

Query: 320 PKYQVDVNKCTGCGLCYNLLKCSAIY---------KRP----DRKAHVDPALCVGCGICA 366
           P Y+ D ++C  CG C    +   +          KRP    D    ++ + CV CG C+
Sbjct: 139 PFYRYDPDQCILCGRCVEACQDVQVTETLTIDWERKRPRVIWDNDVPINESSCVSCGHCS 198

Query: 367 EVCPFNAFKPEG 378
            VCP NA   +G
Sbjct: 199 TVCPCNAMMEKG 210


>Y934_METJA RecName: Full=Uncharacterized polyferredoxin-like
           protein MJ0934;
          Length = 209

 Score = 39.3 bits (90), Expect = 6e-05
 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 5/50 (10%)

Query: 324 VDVNKCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCPFNA 373
           + + +C GCGLC ++   +AI     R+      +C  CG C +VCP NA
Sbjct: 42  IQLTECIGCGLCVDVCPTNAIKIFSFRET-----ICSVCGTCVDVCPNNA 86



 Score = 38.9 bits (89), Expect = 8e-05
 Identities = 18/56 (32%), Positives = 28/56 (50%), Gaps = 5/56 (8%)

Query: 331 GCGLCYNLLKCSAI-----YKRPDRKAHVDPALCVGCGICAEVCPFNAFKPEGKRE 381
           G GL   L++   +     + +P +   +    C+GCG+C +VCP NA K    RE
Sbjct: 14  GAGLIKTLIRSIFLTNRNKFSKPSKTKPIQLTECIGCGLCVDVCPTNAIKIFSFRE 69


>NUOI_WOLSU RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 205

 Score = 39.3 bits (90), Expect = 6e-05
 Identities = 22/63 (34%), Positives = 29/63 (46%), Gaps = 9/63 (14%)

Query: 328 KCTGCGLCY-----NLLKCSAIYKRPDRKA----HVDPALCVGCGICAEVCPFNAFKPEG 378
           +C GCGLC      N ++    Y    RK      ++   C+ CG CAEVCP  A    G
Sbjct: 83  RCIGCGLCEKICISNCIRMETSYGEDGRKKVHEYTINFGRCIFCGFCAEVCPELAIVHGG 142

Query: 379 KRE 381
           + E
Sbjct: 143 RYE 145


>NUOI_RICCK RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 159

 Score = 39.3 bits (90), Expect = 6e-05
 Identities = 19/64 (29%), Positives = 28/64 (43%), Gaps = 9/64 (14%)

Query: 319 LPKYQVDVNKCTGCGLCYNLLKCSAIY---------KRPDRKAHVDPALCVGCGICAEVC 369
           L +Y+  V +C  C LC  +    AI           R   +  +D   C+ CG+C E C
Sbjct: 50  LRRYENGVERCIACKLCEAICPAQAIVIEAEALDDGSRRTTRYDIDMTKCIYCGLCQEAC 109

Query: 370 PFNA 373
           P +A
Sbjct: 110 PVDA 113


>NUOI2_RHIME RecName: Full=NADH-quinone oxidoreductase subunit I 2; 
                  EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I 2;
          Length = 188

 Score = 39.3 bits (90), Expect = 6e-05
 Identities = 18/55 (32%), Positives = 24/55 (43%), Gaps = 9/55 (16%)

Query: 328 KCTGCGLCYNLLKCSAIY---------KRPDRKAHVDPALCVGCGICAEVCPFNA 373
           KC  C LC  +  C  I           R   K  +D A C+ CG+C + CP +A
Sbjct: 67  KCVACELCARICPCDCIEVVPYEDEKGNRRPAKFEIDTARCLFCGLCEDACPADA 121


>NUOI2_RHIEC RecName: Full=NADH-quinone oxidoreductase subunit I 2; 
                  EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I 2;
          Length = 188

 Score = 39.3 bits (90), Expect = 6e-05
 Identities = 18/55 (32%), Positives = 24/55 (43%), Gaps = 9/55 (16%)

Query: 328 KCTGCGLCYNLLKCSAIY---------KRPDRKAHVDPALCVGCGICAEVCPFNA 373
           KC  C LC  +  C  I           R   K  +D A C+ CG+C + CP +A
Sbjct: 67  KCVACELCARICPCDCIEVVPYEDEKGNRHPAKFEIDTARCLFCGLCEDACPADA 121


>FER3_DESAF RecName: Full=Ferredoxin-3;AltName: Full=Ferredoxin III;
          Length = 61

 Score = 39.3 bits (90), Expect = 6e-05
 Identities = 22/58 (37%), Positives = 31/58 (53%), Gaps = 2/58 (3%)

Query: 321 KYQVDVNKCTGCGLCYNLLKCSAIYKRPDRKA-HVDPALCVGCGICAEVCPFNAFKPE 377
           K  +D +KCTG G C ++     +Y+  D KA  V+   C+GC  C EVC  +A   E
Sbjct: 3   KITIDTDKCTGDGECVDVCPVE-VYELQDGKAVAVNEDECLGCESCVEVCEQDALTVE 59


>DPYD_DICDI RecName: Full=Dihydropyrimidine dehydrogenase [NADP+];  
                 Short=DHPDHase;         Short=DPD;       
           EC=1.3.1.2;AltName: Full=Dihydrouracil dehydrogenase;
          Length = 1009

 Score = 39.3 bits (90), Expect = 6e-05
 Identities = 19/50 (38%), Positives = 24/50 (48%), Gaps = 3/50 (6%)

Query: 324 VDVNKCTGCGLCYNLLKCSAIYK-RPDRKAHVDPA--LCVGCGICAEVCP 370
           +D +KC  CG CY     S     + D K H+     LC GC +C  VCP
Sbjct: 936 IDEDKCINCGKCYMTCNDSGYQAIKFDGKTHIPLVTDLCTGCDLCLSVCP 985


>NUOI1_STRCO RecName: Full=NADH-quinone oxidoreductase subunit I 1; 
                  EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I 1;
          Length = 211

 Score = 38.9 bits (89), Expect = 8e-05
 Identities = 22/71 (30%), Positives = 30/71 (42%), Gaps = 15/71 (21%)

Query: 318 QLPKYQVDVNKCTGCGLCYNLLKCSAIY---------------KRPDRKAHVDPALCVGC 362
           QL ++   + KC GC LC       AIY               +R  R   ++ A C+ C
Sbjct: 49  QLNRHPDGLEKCVGCELCAWACPADAIYVEGADNTDEERYSPGERYGRVYQINYARCILC 108

Query: 363 GICAEVCPFNA 373
           G+C E CP  A
Sbjct: 109 GLCIEACPTRA 119


>NUOI1_STRAW RecName: Full=NADH-quinone oxidoreductase subunit I 1; 
                  EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I 1;
          Length = 200

 Score = 38.9 bits (89), Expect = 8e-05
 Identities = 22/71 (30%), Positives = 30/71 (42%), Gaps = 15/71 (21%)

Query: 318 QLPKYQVDVNKCTGCGLCYNLLKCSAIY---------------KRPDRKAHVDPALCVGC 362
           QL ++   + KC GC LC       AIY               +R  R   ++ A C+ C
Sbjct: 51  QLNRHPDGLEKCVGCELCAWACPADAIYVEGADNTDEERYSPGERYGRVYQINYARCILC 110

Query: 363 GICAEVCPFNA 373
           G+C E CP  A
Sbjct: 111 GLCIEACPTRA 121


>FRHG_METVO RecName: Full=Coenzyme F420 hydrogenase subunit gamma;  
                 EC=1.12.98.1;AltName:
           Full=8-hydroxy-5-deazaflavin-reducing hydrogenase
           subunit gamma;
          Length = 243

 Score = 38.9 bits (89), Expect = 8e-05
 Identities = 17/55 (30%), Positives = 29/55 (52%), Gaps = 1/55 (1%)

Query: 316 GIQLPKYQVDVNKCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCP 370
           G  + K  ++ + C GCG C    + +AI    + K +++   C+ CGIC+  CP
Sbjct: 178 GCDVIKEVINKSLCMGCGTCAAACQVNAI-DMVEAKPNINSEFCIKCGICSAQCP 231


>FER_CLOTS RecName: Full=Ferredoxin;
          Length = 55

 Score = 38.9 bits (89), Expect = 8e-05
 Identities = 19/51 (37%), Positives = 24/51 (47%), Gaps = 1/51 (1%)

Query: 327 NKCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCPFNAFKPE 377
           ++C  CG C       AI++    K  VD   C+ CG C  VCP  A K E
Sbjct: 6   DECISCGACAAECPVEAIHEGTG-KYEVDADTCIDCGACEAVCPTGAVKAE 55


>FER1_DESVM RecName: Full=Ferredoxin-1;AltName: Full=Ferredoxin I;  
                 Short=Fd I;
          Length = 62

 Score = 38.9 bits (89), Expect = 8e-05
 Identities = 22/55 (40%), Positives = 29/55 (52%), Gaps = 2/55 (3%)

Query: 324 VDVNKCTGCGLCYNLLKCSAIYKRPDRKA-HVDPALCVGCGICAEVCPFNAFKPE 377
           VD +KCTG G C ++     +Y+  D KA  V+   C+GC  C EVC   A   E
Sbjct: 7   VDTDKCTGDGECVDVCPVE-VYELQDGKAVPVNEEECLGCESCVEVCEAGAITVE 60


>YOX6_SCHPO RecName: Full=Uncharacterized ABC transporter
           ATP-binding protein C14F5.06;
          Length = 593

 Score = 38.5 bits (88), Expect = 1e-04
 Identities = 14/25 (56%), Positives = 17/25 (68%)

Query: 349 DRKAHVDPALCVGCGICAEVCPFNA 373
           DR A +   LC+GCGIC + CPF A
Sbjct: 45  DRIAFISETLCIGCGICVKKCPFGA 69


>NUOI_MAGSA RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 162

 Score = 38.5 bits (88), Expect = 1e-04
 Identities = 19/64 (29%), Positives = 28/64 (43%), Gaps = 9/64 (14%)

Query: 319 LPKYQVDVNKCTGCGLCYNLLKCSAIYKRPD---------RKAHVDPALCVGCGICAEVC 369
           L +Y     +C  C LC  +    AI   P+         R+  +D   C+ CG+C E C
Sbjct: 53  LRRYPNGEERCIACKLCEAICPAQAITIEPEPRDDGSRRARRYDLDMTKCIYCGLCQEAC 112

Query: 370 PFNA 373
           P +A
Sbjct: 113 PVDA 116


>FER_CLOBU RecName: Full=Ferredoxin;
          Length = 55

 Score = 38.5 bits (88), Expect = 1e-04
 Identities = 18/47 (38%), Positives = 23/47 (48%), Gaps = 1/47 (2%)

Query: 327 NKCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCPFNA 373
           + C  CG C      SAI  + D +  +D   C+ CG CA VCP  A
Sbjct: 6   DSCVSCGACAGECPVSAI-TQGDTQFVIDADTCIDCGNCANVCPVGA 51


>RNFB_BUCBP RecName: Full=Electron transport complex protein rnfB;
          Length = 169

 Score = 38.1 bits (87), Expect = 1e-04
 Identities = 16/53 (30%), Positives = 24/53 (45%)

Query: 323 QVDVNKCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCPFNAFK 375
           ++D N C GC  C  +    A+    + +  V    C GC +C  +CP N  K
Sbjct: 110 EIDENNCVGCSKCRLVCPVDAVVGTYNFRHTVLIDSCTGCNLCIPLCPTNCIK 162


>NUOI_RICAH RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 159

 Score = 38.1 bits (87), Expect = 1e-04
 Identities = 18/64 (28%), Positives = 27/64 (42%), Gaps = 9/64 (14%)

Query: 319 LPKYQVDVNKCTGCGLCYNLLKCSAIYKRPDRKAH---------VDPALCVGCGICAEVC 369
           L +Y+    +C  C LC  +    AI    D +           +D   C+ CG+C E C
Sbjct: 50  LRRYESGEERCIACKLCEAICPAQAIVIEADEREDGSRRTTRYDIDMTKCIYCGLCQEAC 109

Query: 370 PFNA 373
           P +A
Sbjct: 110 PVDA 113


>NUOI1_MYCPA RecName: Full=NADH-quinone oxidoreductase subunit I 1; 
                  EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I 1;
          Length = 175

 Score = 38.1 bits (87), Expect = 1e-04
 Identities = 21/71 (29%), Positives = 29/71 (40%), Gaps = 15/71 (21%)

Query: 318 QLPKYQVDVNKCTGCGLCYNLLKCSAIY---------------KRPDRKAHVDPALCVGC 362
           QL ++   + KC GC LC       AI+               +R  R   ++   C+GC
Sbjct: 43  QLNRWPDGLEKCIGCELCAWACPADAIFVESADNTEAERFSPGERYGRVYQINYLRCIGC 102

Query: 363 GICAEVCPFNA 373
           G C E CP  A
Sbjct: 103 GFCIEACPTRA 113


>NDUS8_RECAM RecName: Full=NADH-ubiquinone oxidoreductase subunit 8;
                   EC=1.6.5.3;
          Length = 162

 Score = 38.1 bits (87), Expect = 1e-04
 Identities = 19/64 (29%), Positives = 26/64 (40%), Gaps = 9/64 (14%)

Query: 319 LPKYQVDVNKCTGCGLCYNLLKCSAIY---------KRPDRKAHVDPALCVGCGICAEVC 369
           L +YQ    +C  C LC  +    AI           R   +  +D   C+ CG C E C
Sbjct: 53  LRRYQTGEERCIACKLCEAICPAQAITIESEPRIDGSRRTTRYDIDMTKCIYCGFCQEAC 112

Query: 370 PFNA 373
           P +A
Sbjct: 113 PVDA 116


>FER_CLOAC RecName: Full=Ferredoxin;
          Length = 55

 Score = 38.1 bits (87), Expect = 1e-04
 Identities = 18/45 (40%), Positives = 22/45 (48%), Gaps = 1/45 (2%)

Query: 329 CTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCPFNA 373
           C  CG C      +AI    DR   +D   C+ CG CA VCP +A
Sbjct: 8   CISCGACEPECPVNAISSGDDRYV-IDADTCIDCGACAGVCPVDA 51


>Y749_METJA RecName: Full=Uncharacterized protein MJ0749;
          Length = 246

 Score = 37.7 bits (86), Expect = 2e-04
 Identities = 23/66 (34%), Positives = 31/66 (46%), Gaps = 10/66 (15%)

Query: 321 KYQVDVNKCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVC-----PFNAFK 375
           K ++D NKC GC LC    KC    K  ++   +D   C+ C  C  VC      F+AF 
Sbjct: 186 KLKLDENKCVGCRLCER--KCPMQIKITEK---IDQMECIRCFECMSVCKKGALSFSAFT 240

Query: 376 PEGKRE 381
              K+E
Sbjct: 241 KNTKKE 246


>PNO_CRYPV RecName: Full=Pyruvate dehydrogenase [NADP+];       
           EC=1.2.1.51;AltName: Full=Pyruvate:NADP+
           oxidoreductase;AltName: Full=CpPNO;
          Length = 1934

 Score = 37.7 bits (86), Expect = 2e-04
 Identities = 33/132 (25%), Positives = 46/132 (34%), Gaps = 28/132 (21%)

Query: 275 DVKKSVEIIKKAVEIVKSGR-PAVVVSRRPCALIGVRKARRAGIQLPKYQVDVNKCTGCG 333
           DV + V+ I   V  +K    P  +        +G     + GI +    VD+NKCT C 
Sbjct: 664 DVNQFVKDILGPVNALKGDELPVSMFEPTGTVPLGTTAYEKRGIAMSIPIVDMNKCTQCN 723

Query: 334 LCYNLLKCSAI---------YKRPDRKAH------------------VDPALCVGCGICA 366
            C  +   +AI         +K      H                  V P  C GC +C 
Sbjct: 724 YCSIVCPHAAIRPFLLDEAEFKNAPETMHIPKAKGGQEFSSYYYRIQVTPLDCTGCELCV 783

Query: 367 EVCPFNAFKPEG 378
             CP +A   EG
Sbjct: 784 HACPDDALHMEG 795


>PHFL_DESVH RecName: Full=Periplasmic [Fe] hydrogenase large
           subunit;         EC=1.12.7.2;AltName: Full=Fe
           hydrogenlyase;
          Length = 421

 Score = 37.7 bits (86), Expect = 2e-04
 Identities = 19/54 (35%), Positives = 25/54 (46%), Gaps = 5/54 (9%)

Query: 323 QVDVNKCTGCGLCYNLLKCSAIY---KRPDRKAHVDPALCVGCGICAEVCPFNA 373
           Q+D  KC GC  C      +AI+     P    H++   C+ CG C   CP NA
Sbjct: 29  QIDEAKCIGCDTCSQYCPTAAIFGEMGEPHSIPHIE--ACINCGQCLTHCPENA 80


>NUOI_RICRS RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 159

 Score = 37.7 bits (86), Expect = 2e-04
 Identities = 18/64 (28%), Positives = 27/64 (42%), Gaps = 9/64 (14%)

Query: 319 LPKYQVDVNKCTGCGLCYNLLKCSAIYKRPDRKAH---------VDPALCVGCGICAEVC 369
           L +Y+    +C  C LC  +    AI    D +           +D   C+ CG+C E C
Sbjct: 50  LRRYEHGEERCIACKLCEAICPAQAIVIEADEREDGSRRTTRYDIDMTKCIYCGLCQEAC 109

Query: 370 PFNA 373
           P +A
Sbjct: 110 PVDA 113


>NUOI_RICRO RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 159

 Score = 37.7 bits (86), Expect = 2e-04
 Identities = 18/64 (28%), Positives = 27/64 (42%), Gaps = 9/64 (14%)

Query: 319 LPKYQVDVNKCTGCGLCYNLLKCSAIYKRPDRKAH---------VDPALCVGCGICAEVC 369
           L +Y+    +C  C LC  +    AI    D +           +D   C+ CG+C E C
Sbjct: 50  LRRYEHGEERCIACKLCEAICPAQAIVIEADEREDGSRRTTRYDIDMTKCIYCGLCQEAC 109

Query: 370 PFNA 373
           P +A
Sbjct: 110 PVDA 113


>NUOI_RICPU RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 159

 Score = 37.7 bits (86), Expect = 2e-04
 Identities = 18/64 (28%), Positives = 27/64 (42%), Gaps = 9/64 (14%)

Query: 319 LPKYQVDVNKCTGCGLCYNLLKCSAIYKRPDRKAH---------VDPALCVGCGICAEVC 369
           L +Y+    +C  C LC  +    AI    D +           +D   C+ CG+C E C
Sbjct: 50  LRRYENGEERCIACKLCEAICPAQAIVIEADEREDGSRRTTRYDIDMTKCIYCGLCQEAC 109

Query: 370 PFNA 373
           P +A
Sbjct: 110 PVDA 113


>NUOI_RICCN RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 159

 Score = 37.7 bits (86), Expect = 2e-04
 Identities = 18/64 (28%), Positives = 27/64 (42%), Gaps = 9/64 (14%)

Query: 319 LPKYQVDVNKCTGCGLCYNLLKCSAIYKRPDRKAH---------VDPALCVGCGICAEVC 369
           L +Y+    +C  C LC  +    AI    D +           +D   C+ CG+C E C
Sbjct: 50  LRRYENGEERCIACKLCEAICPAQAIVIEADEREDGSRRTTRYDIDMTKCIYCGLCQEAC 109

Query: 370 PFNA 373
           P +A
Sbjct: 110 PVDA 113


>NUOI_RICBR RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 159

 Score = 37.7 bits (86), Expect = 2e-04
 Identities = 18/64 (28%), Positives = 27/64 (42%), Gaps = 9/64 (14%)

Query: 319 LPKYQVDVNKCTGCGLCYNLLKCSAIYKRPDRKAH---------VDPALCVGCGICAEVC 369
           L +Y+    +C  C LC  +    AI    D +           +D   C+ CG+C E C
Sbjct: 50  LRRYENGEERCIACKLCEAICPAQAIVIEADEREDGSRRTTRYDIDMTKCIYCGLCQEAC 109

Query: 370 PFNA 373
           P +A
Sbjct: 110 PVDA 113


>NUOI_RICB8 RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 159

 Score = 37.7 bits (86), Expect = 2e-04
 Identities = 18/64 (28%), Positives = 27/64 (42%), Gaps = 9/64 (14%)

Query: 319 LPKYQVDVNKCTGCGLCYNLLKCSAIYKRPDRKAH---------VDPALCVGCGICAEVC 369
           L +Y+    +C  C LC  +    AI    D +           +D   C+ CG+C E C
Sbjct: 50  LRRYENGEERCIACKLCEAICPAQAIVIEADEREDGSRRTTRYDIDMTKCIYCGLCQEAC 109

Query: 370 PFNA 373
           P +A
Sbjct: 110 PVDA 113


>NUOI_RICAE RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 159

 Score = 37.7 bits (86), Expect = 2e-04
 Identities = 18/64 (28%), Positives = 27/64 (42%), Gaps = 9/64 (14%)

Query: 319 LPKYQVDVNKCTGCGLCYNLLKCSAIYKRPDRKAH---------VDPALCVGCGICAEVC 369
           L +Y+    +C  C LC  +    AI    D +           +D   C+ CG+C E C
Sbjct: 50  LRRYENGEERCIACKLCEAICPAQAIVIEADEREDGSRRTTRYDIDMTKCIYCGLCQEAC 109

Query: 370 PFNA 373
           P +A
Sbjct: 110 PVDA 113


>FER_ENTHI RecName: Full=Ferredoxin;
          Length = 59

 Score = 37.7 bits (86), Expect = 2e-04
 Identities = 17/54 (31%), Positives = 24/54 (44%), Gaps = 1/54 (1%)

Query: 324 VDVNKCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCPFNAFKPE 377
           V+++ C  CG C      S +    D     +P  C+GCG C + CP    K E
Sbjct: 7   VNIDDCVACGACSGTCPQSVLEVN-DHVEIKNPDDCIGCGACVDACPQGVLKVE 59


>Y51B_METJA RecName: Full=Uncharacterized polyferredoxin-like
           protein MJ0514.2;
          Length = 408

 Score = 37.4 bits (85), Expect = 2e-04
 Identities = 19/54 (35%), Positives = 27/54 (50%), Gaps = 4/54 (7%)

Query: 320 PKYQ---VDVNKCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCP 370
           PKY    +D   C  CG C      + I +R + K  ++ ALC+ C  C +VCP
Sbjct: 119 PKYSNLIIDEEVCVRCGNCERACPINVI-ERKEGKYVINMALCISCKECIKVCP 171



 Score = 37.4 bits (85), Expect = 2e-04
 Identities = 18/50 (36%), Positives = 25/50 (50%), Gaps = 1/50 (2%)

Query: 322 YQVDVNKCTGCGLCYNLLKCSAIYKRPDRKA-HVDPALCVGCGICAEVCP 370
           Y +D + C GC +C  +    AI    + K  ++ P LCV  G CA  CP
Sbjct: 275 YVIDEDLCIGCRICQKVCGSGAIKISKETKLPYIVPELCVRGGACARECP 324



 Score = 36.6 bits (83), Expect = 4e-04
 Identities = 34/126 (26%), Positives = 52/126 (41%), Gaps = 21/126 (16%)

Query: 258 ERITEAFGISTFVID-PIDVKKSVEIIKKAVEIVKSGRPAVVVSRRPCALIGVRKARRAG 316
           E+I +AF I    I   +++K++V  I+K   IV             C   G+ K    G
Sbjct: 186 EKIDKAFEIKNKKITGKLEIKENV--IEKIPHIVSG----------LCVSCGICKDVCVG 233

Query: 317 IQLPKYQVDVNKCTGCGLCYNLLKCSAIYKRPDRKAH-------VDPALCVGCGICAEVC 369
            ++   +  V +C  CGLC  +   +A                 +D  LC+GC IC +VC
Sbjct: 234 -EIDLNEKKVVECVKCGLCIEVCSTTAXXXXXXXXXXXXXXCYVIDEDLCIGCRICQKVC 292

Query: 370 PFNAFK 375
              A K
Sbjct: 293 GSGAIK 298


>PPD_STRVR RecName: Full=Phosphonopyruvate decarboxylase;       
           EC=4.1.1.82;
          Length = 397

 Score = 37.4 bits (85), Expect = 2e-04
 Identities = 28/87 (32%), Positives = 44/87 (50%), Gaps = 8/87 (9%)

Query: 183 LITHMGSSVGLGAGIALATGQFVVATVGDSTFYHAVLPQLVDIATRSV----PILIVVMD 238
           ++  MGS+  +G G+AL T + VV   GD     +VL +L  +AT        ++ +V+D
Sbjct: 237 MVGAMGSAATVGLGVALHTPRPVVVVDGDG----SVLMRLGSLATVGAHAPGNLVHLVLD 292

Query: 239 NAYTAMTGGQPSPSRAIPAERITEAFG 265
           N     TGGQ + S A+    +  A G
Sbjct: 293 NGVHDSTGGQRTLSSAVDLPAVAAACG 319


>PHFL_DESVO RecName: Full=Periplasmic [Fe] hydrogenase large
           subunit;         EC=1.12.7.2;AltName: Full=Fe
           hydrogenlyase;
          Length = 421

 Score = 37.4 bits (85), Expect = 2e-04
 Identities = 20/53 (37%), Positives = 24/53 (45%), Gaps = 3/53 (5%)

Query: 323 QVDVNKCTGCGLCYNLLKCSAIYKRPDRKAHVDP--ALCVGCGICAEVCPFNA 373
           Q+D +KC GC  C       AI+      AH  P   LC+ CG C   CP  A
Sbjct: 29  QIDESKCIGCDSCQQYCPTGAIF-GDTGDAHKIPHEELCINCGQCLTHCPVGA 80


>NUOI_WOLPM RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 169

 Score = 37.4 bits (85), Expect = 2e-04
 Identities = 28/103 (27%), Positives = 39/103 (37%), Gaps = 9/103 (8%)

Query: 280 VEIIKKAVEIVKSGRPAVVVSRRPCALIGVRKARRAGIQLPKYQVDVNKCTGCGLCYNLL 339
           VE+IK  V  +K      V  R P     +    R    L +Y     +C  C LC  + 
Sbjct: 21  VELIKGFVITLKYMFKPKVTLRYPMEKGPLSPRFRGEHALRRYPNGEERCIACKLCEVIC 80

Query: 340 KCSAIY---------KRPDRKAHVDPALCVGCGICAEVCPFNA 373
              AI           R   +  +D   C+ CG+C E CP +A
Sbjct: 81  PAQAIVIEAEEREDGSRRTTRYDIDMIKCIYCGLCQEACPVDA 123


>NUOI_RICPR RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 159

 Score = 37.4 bits (85), Expect = 2e-04
 Identities = 18/64 (28%), Positives = 27/64 (42%), Gaps = 9/64 (14%)

Query: 319 LPKYQVDVNKCTGCGLCYNLLKCSAIYKRPDRKAH---------VDPALCVGCGICAEVC 369
           L +Y+    +C  C LC  +    AI    D +           +D   C+ CG+C E C
Sbjct: 50  LRRYENGEERCIACKLCEAICPAQAIVIESDERDDGSRRTTRYDIDMTKCIYCGLCQEAC 109

Query: 370 PFNA 373
           P +A
Sbjct: 110 PVDA 113


>NUOI_RICFE RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 159

 Score = 37.4 bits (85), Expect = 2e-04
 Identities = 18/64 (28%), Positives = 27/64 (42%), Gaps = 9/64 (14%)

Query: 319 LPKYQVDVNKCTGCGLCYNLLKCSAIYKRPDRKAH---------VDPALCVGCGICAEVC 369
           L +Y+    +C  C LC  +    AI    D +           +D   C+ CG+C E C
Sbjct: 50  LRRYENGEERCIACKLCEAICPAQAIVIEADERDDGSRRTTRYDIDMTKCIYCGLCQEAC 109

Query: 370 PFNA 373
           P +A
Sbjct: 110 PVDA 113


>NUOI2_GEOMG RecName: Full=NADH-quinone oxidoreductase subunit I 2; 
                  EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I 2;
          Length = 131

 Score = 37.4 bits (85), Expect = 2e-04
 Identities = 22/75 (29%), Positives = 32/75 (42%), Gaps = 9/75 (12%)

Query: 316 GIQLPKYQVDVNKCTGCGLCYNLL--KCSAIYKRPDRKAH-------VDPALCVGCGICA 366
           G+   K      KC  C LC  +   KC  +    D++ +       +D   C+ CG C 
Sbjct: 38  GLHALKVSHSKAKCVCCYLCPTVCPAKCITVEAGEDQEHNKYAERYEIDMLRCIFCGYCV 97

Query: 367 EVCPFNAFKPEGKRE 381
           E CP +A K  G+ E
Sbjct: 98  EACPVDALKMTGEFE 112


>NIFJ_ENTAG RecName: Full=Pyruvate-flavodoxin oxidoreductase;       
            EC=1.2.7.-;
          Length = 1173

 Score = 37.4 bits (85), Expect = 2e-04
 Identities = 31/106 (29%), Positives = 41/106 (38%), Gaps = 30/106 (28%)

Query: 313 RRAGIQLPKYQVDVNKCTGCGLCYNLLKCSAIY------------------KRPDR---- 350
           R   I +P +Q D  KCT C  C  +   +AI                   KR       
Sbjct: 676 RGVAINVPVWQTD--KCTQCNQCAFICPHAAIRPVLISEEERQNAPAGFSAKRASGTEDA 733

Query: 351 --KAHVDPALCVGCGICAEVCPFN----AFKPEGKREAWLELWRQA 390
             +  V P  C GCG CA+VCP      + +P   +E  +ELW  A
Sbjct: 734 WYRLAVSPLDCSGCGNCADVCPVKGKALSMQPLESQEHEIELWEYA 779


>NDUS8_CAEEL RecName: Full=Probable NADH dehydrogenase [ubiquinone]
           iron-sulfur protein 8, mitochondrial;       
           EC=1.6.5.3;         EC=1.6.99.3;
          Length = 212

 Score = 37.4 bits (85), Expect = 2e-04
 Identities = 20/64 (31%), Positives = 28/64 (43%), Gaps = 9/64 (14%)

Query: 319 LPKYQVDVNKCTGCGLCYNLLKCSAIY----KRPD-----RKAHVDPALCVGCGICAEVC 369
           L +Y     +C  C LC  +    AI      RPD      +  +D   C+ CG+C E C
Sbjct: 103 LRRYPSGEERCIACKLCEAICPAQAITIEAETRPDGSRRTTRYDIDMTKCIYCGLCQEAC 162

Query: 370 PFNA 373
           P +A
Sbjct: 163 PVDA 166


>FER9_METJA RecName: Full=Uncharacterized ferredoxin MJ0265;
          Length = 166

 Score = 37.4 bits (85), Expect = 2e-04
 Identities = 17/45 (37%), Positives = 25/45 (55%), Gaps = 1/45 (2%)

Query: 335 CYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCPFNAFKPEGK 379
           C  +   SAI +  D   +++  +C+GCG+CA  CPF A   E K
Sbjct: 54  CKEVCPVSAI-EHKDGYVYLNEDVCIGCGLCALACPFGAILMEDK 97


>FER3_ANASP RecName: Full=Ferredoxin-3;AltName: Full=Ferredoxin III;
                   Short=FdIII;
          Length = 97

 Score = 37.4 bits (85), Expect = 2e-04
 Identities = 24/75 (32%), Positives = 32/75 (42%), Gaps = 20/75 (26%)

Query: 320 PKY--QVDVNKCTGCGLC-----YNLLKCSAI-----------YKRPDRKAHV--DPALC 359
           PK+   +D +KC GCG C     Y +L   A+                RK  V   P  C
Sbjct: 16  PKFAESIDKDKCIGCGRCIKVCGYPVLDLKALNXXXXXXXXXXXXXXXRKVMVVAHPENC 75

Query: 360 VGCGICAEVCPFNAF 374
           +GC  CA +CP N +
Sbjct: 76  IGCQACARICPKNCY 90


>ASRC_SALTY RecName: Full=Anaerobic sulfite reductase subunit C;    
               EC=1.8.1.-;
          Length = 337

 Score = 37.4 bits (85), Expect = 2e-04
 Identities = 19/64 (29%), Positives = 33/64 (51%), Gaps = 8/64 (12%)

Query: 317 IQLPKYQVDVNKCTGCGLC-----YNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCPF 371
           I + K +   ++C GCG C     ++ + C A+    + KA  + + C+GCG C   CP 
Sbjct: 168 IGVAKMRFTADRCIGCGACVKACSHHAVGCLAL---KNGKAVKEESACIGCGECVLACPT 224

Query: 372 NAFK 375
            A++
Sbjct: 225 LAWQ 228


>ASRC_SALTI RecName: Full=Anaerobic sulfite reductase subunit C;    
               EC=1.8.1.-;
          Length = 337

 Score = 37.4 bits (85), Expect = 2e-04
 Identities = 19/64 (29%), Positives = 33/64 (51%), Gaps = 8/64 (12%)

Query: 317 IQLPKYQVDVNKCTGCGLC-----YNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCPF 371
           I + K +   ++C GCG C     ++ + C A+    + KA  + + C+GCG C   CP 
Sbjct: 168 IGVAKMRFTADRCIGCGACVKACSHHAVGCLAL---KNGKAVKEESACIGCGECVLACPT 224

Query: 372 NAFK 375
            A++
Sbjct: 225 LAWQ 228


>Y208_METJA RecName: Full=Uncharacterized protein MJ0208;
          Length = 246

 Score = 37.0 bits (84), Expect = 3e-04
 Identities = 25/68 (36%), Positives = 33/68 (48%), Gaps = 4/68 (5%)

Query: 314 RAGIQLPK--YQVDVNKCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCPF 371
           +AGI   K  Y +D           N+    AI KR D    +  + C+GCG C +VCP+
Sbjct: 142 KAGIVTTKLPYAIDXXXXXXXXXXINVCPNGAIVKR-DNFVEILLSKCLGCGNCKKVCPY 200

Query: 372 NAFKPEGK 379
           NA   EGK
Sbjct: 201 NAI-IEGK 207


>RNFB_SHISS RecName: Full=Electron transport complex protein rnfB;
          Length = 192

 Score = 37.0 bits (84), Expect = 3e-04
 Identities = 16/47 (34%), Positives = 19/47 (40%)

Query: 324 VDVNKCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCP 370
           +D N C GC  C       AI         V   LC GC +C + CP
Sbjct: 112 IDENNCIGCTKCIQACPVDAIVGATRAMHTVMSDLCTGCNLCVDPCP 158


>RNFB_SHIDS RecName: Full=Electron transport complex protein rnfB;
          Length = 192

 Score = 37.0 bits (84), Expect = 3e-04
 Identities = 16/47 (34%), Positives = 19/47 (40%)

Query: 324 VDVNKCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCP 370
           +D N C GC  C       AI         V   LC GC +C + CP
Sbjct: 112 IDENNCIGCTKCIQACPVDAIVGATRAMHTVMSDLCTGCNLCVDPCP 158


>RNFB_SHIB3 RecName: Full=Electron transport complex protein rnfB;
          Length = 192

 Score = 37.0 bits (84), Expect = 3e-04
 Identities = 16/47 (34%), Positives = 19/47 (40%)

Query: 324 VDVNKCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCP 370
           +D N C GC  C       AI         V   LC GC +C + CP
Sbjct: 112 IDENNCIGCTKCIQACPVDAIVGATRAMHTVMSDLCTGCNLCVDPCP 158


>RNFB_SALTY RecName: Full=Electron transport complex protein rnfB;
          Length = 192

 Score = 37.0 bits (84), Expect = 3e-04
 Identities = 16/47 (34%), Positives = 19/47 (40%)

Query: 324 VDVNKCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCP 370
           +D N C GC  C       AI         V   LC GC +C + CP
Sbjct: 112 IDENNCIGCTKCIQACPVDAIVGATRAMHTVMSDLCTGCNLCVDPCP 158


>RNFB_SALTI RecName: Full=Electron transport complex protein rnfB;
          Length = 192

 Score = 37.0 bits (84), Expect = 3e-04
 Identities = 16/47 (34%), Positives = 19/47 (40%)

Query: 324 VDVNKCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCP 370
           +D N C GC  C       AI         V   LC GC +C + CP
Sbjct: 112 IDENNCIGCTKCIQACPVDAIVGATRAMHTVMSDLCTGCNLCVDPCP 158


>RNFB_SALSV RecName: Full=Electron transport complex protein rnfB;
          Length = 192

 Score = 37.0 bits (84), Expect = 3e-04
 Identities = 16/47 (34%), Positives = 19/47 (40%)

Query: 324 VDVNKCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCP 370
           +D N C GC  C       AI         V   LC GC +C + CP
Sbjct: 112 IDENNCIGCTKCIQACPVDAIVGATRAMHTVMSDLCTGCNLCVDPCP 158


>RNFB_SALPK RecName: Full=Electron transport complex protein rnfB;
          Length = 192

 Score = 37.0 bits (84), Expect = 3e-04
 Identities = 16/47 (34%), Positives = 19/47 (40%)

Query: 324 VDVNKCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCP 370
           +D N C GC  C       AI         V   LC GC +C + CP
Sbjct: 112 IDENNCIGCTKCIQACPVDAIVGATRAMHTVMSDLCTGCNLCVDPCP 158


>RNFB_SALPC RecName: Full=Electron transport complex protein rnfB;
          Length = 192

 Score = 37.0 bits (84), Expect = 3e-04
 Identities = 16/47 (34%), Positives = 19/47 (40%)

Query: 324 VDVNKCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCP 370
           +D N C GC  C       AI         V   LC GC +C + CP
Sbjct: 112 IDENNCIGCTKCIQACPVDAIVGATRAMHTVMSDLCTGCNLCVDPCP 158


>RNFB_SALPB RecName: Full=Electron transport complex protein rnfB;
          Length = 192

 Score = 37.0 bits (84), Expect = 3e-04
 Identities = 16/47 (34%), Positives = 19/47 (40%)

Query: 324 VDVNKCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCP 370
           +D N C GC  C       AI         V   LC GC +C + CP
Sbjct: 112 IDENNCIGCTKCIQACPVDAIVGATRAMHTVMSDLCTGCNLCVDPCP 158


>RNFB_SALPA RecName: Full=Electron transport complex protein rnfB;
          Length = 192

 Score = 37.0 bits (84), Expect = 3e-04
 Identities = 16/47 (34%), Positives = 19/47 (40%)

Query: 324 VDVNKCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCP 370
           +D N C GC  C       AI         V   LC GC +C + CP
Sbjct: 112 IDENNCIGCTKCIQACPVDAIVGATRAMHTVMSDLCTGCNLCVDPCP 158


>RNFB_SALNS RecName: Full=Electron transport complex protein rnfB;
          Length = 192

 Score = 37.0 bits (84), Expect = 3e-04
 Identities = 16/47 (34%), Positives = 19/47 (40%)

Query: 324 VDVNKCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCP 370
           +D N C GC  C       AI         V   LC GC +C + CP
Sbjct: 112 IDENNCIGCTKCIQACPVDAIVGATRAMHTVMSDLCTGCNLCVDPCP 158


>RNFB_SALHS RecName: Full=Electron transport complex protein rnfB;
          Length = 192

 Score = 37.0 bits (84), Expect = 3e-04
 Identities = 16/47 (34%), Positives = 19/47 (40%)

Query: 324 VDVNKCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCP 370
           +D N C GC  C       AI         V   LC GC +C + CP
Sbjct: 112 IDENNCIGCTKCIQACPVDAIVGATRAMHTVMSDLCTGCNLCVDPCP 158


>RNFB_SALG2 RecName: Full=Electron transport complex protein rnfB;
          Length = 192

 Score = 37.0 bits (84), Expect = 3e-04
 Identities = 16/47 (34%), Positives = 19/47 (40%)

Query: 324 VDVNKCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCP 370
           +D N C GC  C       AI         V   LC GC +C + CP
Sbjct: 112 IDENNCIGCTKCIQACPVDAIVGATRAMHTVMSDLCTGCNLCVDPCP 158


>RNFB_SALEP RecName: Full=Electron transport complex protein rnfB;
          Length = 192

 Score = 37.0 bits (84), Expect = 3e-04
 Identities = 16/47 (34%), Positives = 19/47 (40%)

Query: 324 VDVNKCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCP 370
           +D N C GC  C       AI         V   LC GC +C + CP
Sbjct: 112 IDENNCIGCTKCIQACPVDAIVGATRAMHTVMSDLCTGCNLCVDPCP 158


>RNFB_SALDC RecName: Full=Electron transport complex protein rnfB;
          Length = 192

 Score = 37.0 bits (84), Expect = 3e-04
 Identities = 16/47 (34%), Positives = 19/47 (40%)

Query: 324 VDVNKCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCP 370
           +D N C GC  C       AI         V   LC GC +C + CP
Sbjct: 112 IDENNCIGCTKCIQACPVDAIVGATRAMHTVMSDLCTGCNLCVDPCP 158


>RNFB_SALCH RecName: Full=Electron transport complex protein rnfB;
          Length = 192

 Score = 37.0 bits (84), Expect = 3e-04
 Identities = 16/47 (34%), Positives = 19/47 (40%)

Query: 324 VDVNKCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCP 370
           +D N C GC  C       AI         V   LC GC +C + CP
Sbjct: 112 IDENNCIGCTKCIQACPVDAIVGATRAMHTVMSDLCTGCNLCVDPCP 158


>RNFB_SALA4 RecName: Full=Electron transport complex protein rnfB;
          Length = 192

 Score = 37.0 bits (84), Expect = 3e-04
 Identities = 16/47 (34%), Positives = 19/47 (40%)

Query: 324 VDVNKCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCP 370
           +D N C GC  C       AI         V   LC GC +C + CP
Sbjct: 112 IDENNCIGCTKCIQACPVDAIVGATRAMHTVMSDLCTGCNLCVDPCP 158


>RNFB_RHOCA RecName: Full=Electron transport complex protein
           rnfB;AltName: Full=Nitrogen fixation protein rnfB;
          Length = 187

 Score = 37.0 bits (84), Expect = 3e-04
 Identities = 20/59 (33%), Positives = 25/59 (42%), Gaps = 1/59 (1%)

Query: 329 CTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCPFNAFKPEGKREAWLELW 387
           CTGC  C+      AI     +   V    C+GC  C EVCP  A     K +  L+ W
Sbjct: 112 CTGCQKCFKRCPTDAIVGGAKQIHTVVMDACIGCDACIEVCPTEAIVSRVKPKT-LKTW 169


>RNFB_ESCF3 RecName: Full=Electron transport complex protein rnfB;
          Length = 192

 Score = 37.0 bits (84), Expect = 3e-04
 Identities = 16/47 (34%), Positives = 19/47 (40%)

Query: 324 VDVNKCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCP 370
           +D N C GC  C       AI         V   LC GC +C + CP
Sbjct: 112 IDENNCIGCTKCIQACPVDAIVGATRAMHTVMSDLCTGCNLCVDPCP 158


>RNFB_ECOUT RecName: Full=Electron transport complex protein rnfB;
          Length = 192

 Score = 37.0 bits (84), Expect = 3e-04
 Identities = 16/47 (34%), Positives = 19/47 (40%)

Query: 324 VDVNKCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCP 370
           +D N C GC  C       AI         V   LC GC +C + CP
Sbjct: 112 IDENNCIGCTKCIQACPVDAIVGATRAMHTVMSDLCTGCNLCVDPCP 158


>RNFB_ECOSM RecName: Full=Electron transport complex protein rnfB;
          Length = 192

 Score = 37.0 bits (84), Expect = 3e-04
 Identities = 16/47 (34%), Positives = 19/47 (40%)

Query: 324 VDVNKCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCP 370
           +D N C GC  C       AI         V   LC GC +C + CP
Sbjct: 112 IDENNCIGCTKCIQACPVDAIVGATRAMHTVMSDLCTGCNLCVDPCP 158


>RNFB_ECOSE RecName: Full=Electron transport complex protein rnfB;
          Length = 192

 Score = 37.0 bits (84), Expect = 3e-04
 Identities = 16/47 (34%), Positives = 19/47 (40%)

Query: 324 VDVNKCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCP 370
           +D N C GC  C       AI         V   LC GC +C + CP
Sbjct: 112 IDENNCIGCTKCIQACPVDAIVGATRAMHTVMSDLCTGCNLCVDPCP 158


>RNFB_ECOLU RecName: Full=Electron transport complex protein rnfB;
          Length = 192

 Score = 37.0 bits (84), Expect = 3e-04
 Identities = 16/47 (34%), Positives = 19/47 (40%)

Query: 324 VDVNKCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCP 370
           +D N C GC  C       AI         V   LC GC +C + CP
Sbjct: 112 IDENNCIGCTKCIQACPVDAIVGATRAMHTVMSDLCTGCNLCVDPCP 158


>RNFB_ECOLI RecName: Full=Electron transport complex protein rnfB;
          Length = 192

 Score = 37.0 bits (84), Expect = 3e-04
 Identities = 16/47 (34%), Positives = 19/47 (40%)

Query: 324 VDVNKCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCP 370
           +D N C GC  C       AI         V   LC GC +C + CP
Sbjct: 112 IDENNCIGCTKCIQACPVDAIVGATRAMHTVMSDLCTGCNLCVDPCP 158


>RNFB_ECOLC RecName: Full=Electron transport complex protein rnfB;
          Length = 192

 Score = 37.0 bits (84), Expect = 3e-04
 Identities = 16/47 (34%), Positives = 19/47 (40%)

Query: 324 VDVNKCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCP 370
           +D N C GC  C       AI         V   LC GC +C + CP
Sbjct: 112 IDENNCIGCTKCIQACPVDAIVGATRAMHTVMSDLCTGCNLCVDPCP 158


>RNFB_ECOL6 RecName: Full=Electron transport complex protein rnfB;
          Length = 192

 Score = 37.0 bits (84), Expect = 3e-04
 Identities = 16/47 (34%), Positives = 19/47 (40%)

Query: 324 VDVNKCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCP 370
           +D N C GC  C       AI         V   LC GC +C + CP
Sbjct: 112 IDENNCIGCTKCIQACPVDAIVGATRAMHTVMSDLCTGCNLCVDPCP 158


>RNFB_ECOL5 RecName: Full=Electron transport complex protein rnfB;
          Length = 192

 Score = 37.0 bits (84), Expect = 3e-04
 Identities = 16/47 (34%), Positives = 19/47 (40%)

Query: 324 VDVNKCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCP 370
           +D N C GC  C       AI         V   LC GC +C + CP
Sbjct: 112 IDENNCIGCTKCIQACPVDAIVGATRAMHTVMSDLCTGCNLCVDPCP 158


>RNFB_ECOK1 RecName: Full=Electron transport complex protein rnfB;
          Length = 192

 Score = 37.0 bits (84), Expect = 3e-04
 Identities = 16/47 (34%), Positives = 19/47 (40%)

Query: 324 VDVNKCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCP 370
           +D N C GC  C       AI         V   LC GC +C + CP
Sbjct: 112 IDENNCIGCTKCIQACPVDAIVGATRAMHTVMSDLCTGCNLCVDPCP 158


>RNFB_ECOHS RecName: Full=Electron transport complex protein rnfB;
          Length = 192

 Score = 37.0 bits (84), Expect = 3e-04
 Identities = 16/47 (34%), Positives = 19/47 (40%)

Query: 324 VDVNKCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCP 370
           +D N C GC  C       AI         V   LC GC +C + CP
Sbjct: 112 IDENNCIGCTKCIQACPVDAIVGATRAMHTVMSDLCTGCNLCVDPCP 158


>RNFB_ECODH RecName: Full=Electron transport complex protein rnfB;
          Length = 192

 Score = 37.0 bits (84), Expect = 3e-04
 Identities = 16/47 (34%), Positives = 19/47 (40%)

Query: 324 VDVNKCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCP 370
           +D N C GC  C       AI         V   LC GC +C + CP
Sbjct: 112 IDENNCIGCTKCIQACPVDAIVGATRAMHTVMSDLCTGCNLCVDPCP 158


>RNFB_ECOBW RecName: Full=Electron transport complex protein rnfB;
          Length = 192

 Score = 37.0 bits (84), Expect = 3e-04
 Identities = 16/47 (34%), Positives = 19/47 (40%)

Query: 324 VDVNKCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCP 370
           +D N C GC  C       AI         V   LC GC +C + CP
Sbjct: 112 IDENNCIGCTKCIQACPVDAIVGATRAMHTVMSDLCTGCNLCVDPCP 158


>RNFB_ECO8A RecName: Full=Electron transport complex protein rnfB;
          Length = 192

 Score = 37.0 bits (84), Expect = 3e-04
 Identities = 16/47 (34%), Positives = 19/47 (40%)

Query: 324 VDVNKCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCP 370
           +D N C GC  C       AI         V   LC GC +C + CP
Sbjct: 112 IDENNCIGCTKCIQACPVDAIVGATRAMHTVMSDLCTGCNLCVDPCP 158


>RNFB_ECO81 RecName: Full=Electron transport complex protein rnfB;
          Length = 192

 Score = 37.0 bits (84), Expect = 3e-04
 Identities = 16/47 (34%), Positives = 19/47 (40%)

Query: 324 VDVNKCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCP 370
           +D N C GC  C       AI         V   LC GC +C + CP
Sbjct: 112 IDENNCIGCTKCIQACPVDAIVGATRAMHTVMSDLCTGCNLCVDPCP 158


>RNFB_ECO7I RecName: Full=Electron transport complex protein rnfB;
          Length = 192

 Score = 37.0 bits (84), Expect = 3e-04
 Identities = 16/47 (34%), Positives = 19/47 (40%)

Query: 324 VDVNKCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCP 370
           +D N C GC  C       AI         V   LC GC +C + CP
Sbjct: 112 IDENNCIGCTKCIQACPVDAIVGATRAMHTVMSDLCTGCNLCVDPCP 158


>RNFB_ECO5E RecName: Full=Electron transport complex protein rnfB;
          Length = 192

 Score = 37.0 bits (84), Expect = 3e-04
 Identities = 16/47 (34%), Positives = 19/47 (40%)

Query: 324 VDVNKCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCP 370
           +D N C GC  C       AI         V   LC GC +C + CP
Sbjct: 112 IDENNCIGCTKCIQACPVDAIVGATRAMHTVMSDLCTGCNLCVDPCP 158


>RNFB_ECO57 RecName: Full=Electron transport complex protein rnfB;
          Length = 192

 Score = 37.0 bits (84), Expect = 3e-04
 Identities = 16/47 (34%), Positives = 19/47 (40%)

Query: 324 VDVNKCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCP 370
           +D N C GC  C       AI         V   LC GC +C + CP
Sbjct: 112 IDENNCIGCTKCIQACPVDAIVGATRAMHTVMSDLCTGCNLCVDPCP 158


>RNFB_ECO55 RecName: Full=Electron transport complex protein rnfB;
          Length = 192

 Score = 37.0 bits (84), Expect = 3e-04
 Identities = 16/47 (34%), Positives = 19/47 (40%)

Query: 324 VDVNKCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCP 370
           +D N C GC  C       AI         V   LC GC +C + CP
Sbjct: 112 IDENNCIGCTKCIQACPVDAIVGATRAMHTVMSDLCTGCNLCVDPCP 158


>RNFB_ECO45 RecName: Full=Electron transport complex protein rnfB;
          Length = 192

 Score = 37.0 bits (84), Expect = 3e-04
 Identities = 16/47 (34%), Positives = 19/47 (40%)

Query: 324 VDVNKCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCP 370
           +D N C GC  C       AI         V   LC GC +C + CP
Sbjct: 112 IDENNCIGCTKCIQACPVDAIVGATRAMHTVMSDLCTGCNLCVDPCP 158


>RNFB_ECO27 RecName: Full=Electron transport complex protein rnfB;
          Length = 192

 Score = 37.0 bits (84), Expect = 3e-04
 Identities = 16/47 (34%), Positives = 19/47 (40%)

Query: 324 VDVNKCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCP 370
           +D N C GC  C       AI         V   LC GC +C + CP
Sbjct: 112 IDENNCIGCTKCIQACPVDAIVGATRAMHTVMSDLCTGCNLCVDPCP 158


>RNFB_ECO24 RecName: Full=Electron transport complex protein rnfB;
          Length = 192

 Score = 37.0 bits (84), Expect = 3e-04
 Identities = 16/47 (34%), Positives = 19/47 (40%)

Query: 324 VDVNKCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCP 370
           +D N C GC  C       AI         V   LC GC +C + CP
Sbjct: 112 IDENNCIGCTKCIQACPVDAIVGATRAMHTVMSDLCTGCNLCVDPCP 158


>RNFB_CITK8 RecName: Full=Electron transport complex protein rnfB;
          Length = 192

 Score = 37.0 bits (84), Expect = 3e-04
 Identities = 16/47 (34%), Positives = 19/47 (40%)

Query: 324 VDVNKCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCP 370
           +D N C GC  C       AI         V   LC GC +C + CP
Sbjct: 112 IDENNCIGCTKCIQACPVDAIVGATRAMHTVMSDLCTGCNLCVDPCP 158


>RNFB_BUCAT RecName: Full=Electron transport complex protein rnfB;
          Length = 167

 Score = 37.0 bits (84), Expect = 3e-04
 Identities = 20/62 (32%), Positives = 27/62 (43%), Gaps = 2/62 (3%)

Query: 324 VDVNKCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCPFNAFKPEGKREAW 383
           ++ + C GC  C +     AI   P+    V    C GC IC   CP N    E K+E +
Sbjct: 108 INESNCVGCSKCASFCPVDAIVGAPNFIHTVLQEFCTGCNICLLHCPTNCI--EIKKETY 165

Query: 384 LE 385
            E
Sbjct: 166 EE 167


>RNFB_BUCAI RecName: Full=Electron transport complex protein rnfB;
          Length = 167

 Score = 37.0 bits (84), Expect = 3e-04
 Identities = 20/62 (32%), Positives = 27/62 (43%), Gaps = 2/62 (3%)

Query: 324 VDVNKCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCPFNAFKPEGKREAW 383
           ++ + C GC  C +     AI   P+    V    C GC IC   CP N    E K+E +
Sbjct: 108 INESNCVGCSKCASFCPVDAIVGAPNFIHTVLQEFCTGCNICLLHCPTNCI--EIKKETY 165

Query: 384 LE 385
            E
Sbjct: 166 EE 167


>RNFB_BUCA5 RecName: Full=Electron transport complex protein rnfB;
          Length = 167

 Score = 37.0 bits (84), Expect = 3e-04
 Identities = 20/62 (32%), Positives = 27/62 (43%), Gaps = 2/62 (3%)

Query: 324 VDVNKCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCPFNAFKPEGKREAW 383
           ++ + C GC  C +     AI   P+    V    C GC IC   CP N    E K+E +
Sbjct: 108 INESNCVGCSKCASFCPVDAIVGAPNFIHTVLQEFCTGCNICLLHCPTNCI--EIKKETY 165

Query: 384 LE 385
            E
Sbjct: 166 EE 167


>PORD_METTH RecName: Full=Pyruvate synthase subunit porD;AltName:
           Full=Pyruvate oxidoreductase delta chain;       
           Short=POR;AltName: Full=Pyruvic-ferredoxin
           oxidoreductase subunit delta;
          Length = 81

 Score = 37.0 bits (84), Expect = 3e-04
 Identities = 15/32 (46%), Positives = 20/32 (62%)

Query: 349 DRKAHVDPALCVGCGICAEVCPFNAFKPEGKR 380
           +R+  +D   C GCGICAE CP  A K E ++
Sbjct: 50  NREHEIDYDYCKGCGICAEKCPVKAIKMEREK 81


>PORD_METJA RecName: Full=Pyruvate synthase subunit porD;AltName:
           Full=Pyruvate oxidoreductase delta chain;       
           Short=POR;AltName: Full=Pyruvic-ferredoxin
           oxidoreductase subunit delta;
          Length = 86

 Score = 37.0 bits (84), Expect = 3e-04
 Identities = 18/50 (36%), Positives = 22/50 (44%)

Query: 324 VDVNKCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCPFNA 373
           +D  KC  C  CY      AI +  +    +D   C GC IC   CP NA
Sbjct: 29  LDNEKCVKCENCYIFCPEGAIQEDENGNFKIDYDYCKGCLICMNECPVNA 78


>NUOI_THEFY RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 183

 Score = 37.0 bits (84), Expect = 3e-04
 Identities = 21/71 (29%), Positives = 29/71 (40%), Gaps = 15/71 (21%)

Query: 318 QLPKYQVDVNKCTGCGLCYNLLKCSAIY---------------KRPDRKAHVDPALCVGC 362
           QL ++   + KC GC LC       AIY               +R  R   ++   C+ C
Sbjct: 43  QLNRWPDGLEKCIGCELCAWACPADAIYVEAGDNTEEERYSPGERYGRVYQINYLRCILC 102

Query: 363 GICAEVCPFNA 373
           G+C E CP  A
Sbjct: 103 GLCVEACPTRA 113


>NUOI_RICTY RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 159

 Score = 37.0 bits (84), Expect = 3e-04
 Identities = 18/64 (28%), Positives = 27/64 (42%), Gaps = 9/64 (14%)

Query: 319 LPKYQVDVNKCTGCGLCYNLLKCSAIYKRPDRKAH---------VDPALCVGCGICAEVC 369
           L +Y+    +C  C LC  +    AI    D +           +D   C+ CG+C E C
Sbjct: 50  LRRYENGEERCIACKLCEAVCPAQAIVIESDERDDGSRRTTRYDIDMTKCIYCGLCQEAC 109

Query: 370 PFNA 373
           P +A
Sbjct: 110 PVDA 113


>NUOI_HELHP RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 212

 Score = 37.0 bits (84), Expect = 3e-04
 Identities = 17/52 (32%), Positives = 25/52 (48%), Gaps = 9/52 (17%)

Query: 328 KCTGCGLCYNLLKCSAIYKRPDR---------KAHVDPALCVGCGICAEVCP 370
           +C GCGLC  +   + I    D+            ++   C+ CG+CAEVCP
Sbjct: 84  RCIGCGLCEKICTSNCIRIITDKGEDGRKKILNYSINFGRCIYCGLCAEVCP 135


>NUOI_FRASN RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 211

 Score = 37.0 bits (84), Expect = 3e-04
 Identities = 21/71 (29%), Positives = 29/71 (40%), Gaps = 15/71 (21%)

Query: 318 QLPKYQVDVNKCTGCGLCYNLLKCSAIY---------------KRPDRKAHVDPALCVGC 362
           QL ++   + KC GC LC       AIY               +R  R   ++   C+ C
Sbjct: 42  QLNRHPDGLEKCVGCELCAWACPADAIYVEGADNTDEQRFSPGERYGRVYQINYLRCILC 101

Query: 363 GICAEVCPFNA 373
           G+C E CP  A
Sbjct: 102 GLCIEACPTRA 112


>NUOI_FRASC RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 217

 Score = 37.0 bits (84), Expect = 3e-04
 Identities = 21/71 (29%), Positives = 29/71 (40%), Gaps = 15/71 (21%)

Query: 318 QLPKYQVDVNKCTGCGLCYNLLKCSAIY---------------KRPDRKAHVDPALCVGC 362
           QL ++   + KC GC LC       AIY               +R  R   ++   C+ C
Sbjct: 42  QLNRHPDGLEKCVGCELCAWACPADAIYVEGADNTEAERYSPGERYGRVYQINYLRCILC 101

Query: 363 GICAEVCPFNA 373
           G+C E CP  A
Sbjct: 102 GLCIEACPTRA 112


>NQO9_THET8 RecName: Full=NADH-quinone oxidoreductase subunit 9;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit 9;AltName: Full=NDH-1 subunit 9;
          Length = 182

 Score = 37.0 bits (84), Expect = 3e-04
 Identities = 20/70 (28%), Positives = 26/70 (37%), Gaps = 15/70 (21%)

Query: 319 LPKYQVDVNKCTGCGLCYNLLKCSAIYKRPDRKAHVDPAL---------------CVGCG 363
           L ++   + KC GC LC       AIY  P      +P                 C+ CG
Sbjct: 43  LTRHPNGLEKCIGCSLCAAACPAYAIYVEPAENDPENPVSAGERYAKVYEINMLRCIFCG 102

Query: 364 ICAEVCPFNA 373
           +C E CP  A
Sbjct: 103 LCEEACPTGA 112


>NQO9_THET2 RecName: Full=NADH-quinone oxidoreductase subunit 9;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit 9;AltName: Full=NDH-1 subunit 9;
          Length = 182

 Score = 37.0 bits (84), Expect = 3e-04
 Identities = 20/70 (28%), Positives = 26/70 (37%), Gaps = 15/70 (21%)

Query: 319 LPKYQVDVNKCTGCGLCYNLLKCSAIYKRPDRKAHVDPAL---------------CVGCG 363
           L ++   + KC GC LC       AIY  P      +P                 C+ CG
Sbjct: 43  LTRHPNGLEKCIGCSLCAAACPAYAIYVEPAENDPENPVSAGERYAKVYEINMLRCIFCG 102

Query: 364 ICAEVCPFNA 373
           +C E CP  A
Sbjct: 103 LCEEACPTGA 112


>FER7_METJA RecName: Full=Uncharacterized ferredoxin MJ0722;
          Length = 77

 Score = 37.0 bits (84), Expect = 3e-04
 Identities = 19/53 (35%), Positives = 22/53 (41%), Gaps = 3/53 (5%)

Query: 324 VDVNKCTGCGLCYNLLKCSAIYKRPDRKAH---VDPALCVGCGICAEVCPFNA 373
           VD  KC GCG CY++     +    D        D   C  C  CA  CP NA
Sbjct: 7   VDREKCIGCGRCYDVCPKGPLIWTKDENGKYYAYDVEYCHNCKFCAGRCPTNA 59


>FER1_CAUCR RecName: Full=Ferredoxin-1;AltName: Full=Ferredoxin I;  
                 Short=FdI;
          Length = 113

 Score = 37.0 bits (84), Expect = 3e-04
 Identities = 14/36 (38%), Positives = 23/36 (63%), Gaps = 3/36 (8%)

Query: 354 VDPALCVGCGICAEVCPFNAFKPEGKREA---WLEL 386
           ++P  C+ CG+C   CP +A KP+ + EA   WL++
Sbjct: 35  INPDECIDCGVCEPECPVDAIKPDTEDEADGKWLKI 70


>FDHL_STAAW RecName: Full=Putative formate dehydrogenase MW2229;    
               EC=1.2.1.2;
          Length = 984

 Score = 37.0 bits (84), Expect = 3e-04
 Identities = 20/67 (29%), Positives = 28/67 (41%), Gaps = 13/67 (19%)

Query: 320 PKYQVDVNKCTGCGLCYNLLKCSAIYKRP-------------DRKAHVDPALCVGCGICA 366
           P Y+ D N+C  CG C    +   + +               D    ++ + CV CG CA
Sbjct: 138 PFYRYDPNQCILCGRCVEACQDIEVNETIRIDWDREHPRVIWDNDVPINESSCVSCGQCA 197

Query: 367 EVCPFNA 373
            VCP NA
Sbjct: 198 TVCPCNA 204


>FDHL_STAAS RecName: Full=Putative formate dehydrogenase SAS2201;   
                EC=1.2.1.2;
          Length = 984

 Score = 37.0 bits (84), Expect = 3e-04
 Identities = 20/67 (29%), Positives = 28/67 (41%), Gaps = 13/67 (19%)

Query: 320 PKYQVDVNKCTGCGLCYNLLKCSAIYKRP-------------DRKAHVDPALCVGCGICA 366
           P Y+ D N+C  CG C    +   + +               D    ++ + CV CG CA
Sbjct: 138 PFYRYDPNQCILCGRCVEACQDIEVNETIRIDWDREHPRVIWDNDVPINESSCVSCGQCA 197

Query: 367 EVCPFNA 373
            VCP NA
Sbjct: 198 TVCPCNA 204


>FDHL_STAAR RecName: Full=Putative formate dehydrogenase SAR2393;   
                EC=1.2.1.2;
          Length = 984

 Score = 37.0 bits (84), Expect = 3e-04
 Identities = 21/67 (31%), Positives = 29/67 (43%), Gaps = 13/67 (19%)

Query: 320 PKYQVDVNKCTGCGLCYNL---------LKCSAIYKRP----DRKAHVDPALCVGCGICA 366
           P Y+ D N+C  CG C            ++     + P    D    ++ + CV CG CA
Sbjct: 138 PFYRYDPNQCILCGRCVEACQDIELNETIRIDWDREHPRVIWDNDVPINESSCVSCGQCA 197

Query: 367 EVCPFNA 373
            VCP NA
Sbjct: 198 TVCPCNA 204


>FDHL_STAAN RecName: Full=Putative formate dehydrogenase SA2102;    
               EC=1.2.1.2;
          Length = 984

 Score = 37.0 bits (84), Expect = 3e-04
 Identities = 20/67 (29%), Positives = 28/67 (41%), Gaps = 13/67 (19%)

Query: 320 PKYQVDVNKCTGCGLCYNLLKCSAIYKRP-------------DRKAHVDPALCVGCGICA 366
           P Y+ D N+C  CG C    +   + +               D    ++ + CV CG CA
Sbjct: 138 PFYRYDPNQCILCGRCVEACQDIEVNETIRIDWDREHPRVIWDNDVPINESSCVSCGQCA 197

Query: 367 EVCPFNA 373
            VCP NA
Sbjct: 198 TVCPCNA 204


>FDHL_STAAM RecName: Full=Putative formate dehydrogenase SAV2309;   
                EC=1.2.1.2;
          Length = 984

 Score = 37.0 bits (84), Expect = 3e-04
 Identities = 20/67 (29%), Positives = 28/67 (41%), Gaps = 13/67 (19%)

Query: 320 PKYQVDVNKCTGCGLCYNLLKCSAIYKRP-------------DRKAHVDPALCVGCGICA 366
           P Y+ D N+C  CG C    +   + +               D    ++ + CV CG CA
Sbjct: 138 PFYRYDPNQCILCGRCVEACQDIEVNETIRIDWDREHPRVIWDNDVPINESSCVSCGQCA 197

Query: 367 EVCPFNA 373
            VCP NA
Sbjct: 198 TVCPCNA 204


>FDHL_STAAC RecName: Full=Putative formate dehydrogenase SACOL2301; 
                  EC=1.2.1.2;
          Length = 984

 Score = 37.0 bits (84), Expect = 3e-04
 Identities = 20/67 (29%), Positives = 28/67 (41%), Gaps = 13/67 (19%)

Query: 320 PKYQVDVNKCTGCGLCYNLLKCSAIYKRP-------------DRKAHVDPALCVGCGICA 366
           P Y+ D N+C  CG C    +   + +               D    ++ + CV CG CA
Sbjct: 138 PFYRYDPNQCILCGRCVEACQDIEVNETIRIDWDREHPRVIWDNDVPINESSCVSCGQCA 197

Query: 367 EVCPFNA 373
            VCP NA
Sbjct: 198 TVCPCNA 204


>FDHL_STAAB RecName: Full=Putative formate dehydrogenase SAB2186c;  
                 EC=1.2.1.2;
          Length = 984

 Score = 37.0 bits (84), Expect = 3e-04
 Identities = 20/67 (29%), Positives = 28/67 (41%), Gaps = 13/67 (19%)

Query: 320 PKYQVDVNKCTGCGLCYNLLKCSAIYKRP-------------DRKAHVDPALCVGCGICA 366
           P Y+ D N+C  CG C    +   + +               D    ++ + CV CG CA
Sbjct: 138 PFYRYDPNQCILCGRCVEACQDIEVNETIRIDWDREHPRVIWDNDVPINESSCVSCGQCA 197

Query: 367 EVCPFNA 373
            VCP NA
Sbjct: 198 TVCPCNA 204


>FDHL_STAA8 RecName: Full=Putative formate dehydrogenase
           SAOUHSC_02582;         EC=1.2.1.2;
          Length = 984

 Score = 37.0 bits (84), Expect = 3e-04
 Identities = 20/67 (29%), Positives = 28/67 (41%), Gaps = 13/67 (19%)

Query: 320 PKYQVDVNKCTGCGLCYNLLKCSAIYKRP-------------DRKAHVDPALCVGCGICA 366
           P Y+ D N+C  CG C    +   + +               D    ++ + CV CG CA
Sbjct: 138 PFYRYDPNQCILCGRCVEACQDIEVNETIRIDWDREHPRVIWDNDVPINESSCVSCGQCA 197

Query: 367 EVCPFNA 373
            VCP NA
Sbjct: 198 TVCPCNA 204


>FDHL_STAA3 RecName: Full=Putative formate dehydrogenase
           SAUSA300_2258;         EC=1.2.1.2;
          Length = 984

 Score = 37.0 bits (84), Expect = 3e-04
 Identities = 20/67 (29%), Positives = 28/67 (41%), Gaps = 13/67 (19%)

Query: 320 PKYQVDVNKCTGCGLCYNLLKCSAIYKRP-------------DRKAHVDPALCVGCGICA 366
           P Y+ D N+C  CG C    +   + +               D    ++ + CV CG CA
Sbjct: 138 PFYRYDPNQCILCGRCVEACQDIEVNETIRIDWDREHPRVIWDNDVPINESSCVSCGQCA 197

Query: 367 EVCPFNA 373
            VCP NA
Sbjct: 198 TVCPCNA 204


>RNFB_SALAR RecName: Full=Electron transport complex protein rnfB;
          Length = 192

 Score = 36.6 bits (83), Expect = 4e-04
 Identities = 16/47 (34%), Positives = 19/47 (40%)

Query: 324 VDVNKCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCP 370
           +D N C GC  C       AI         V   LC GC +C + CP
Sbjct: 112 IDENHCIGCTKCIQACPVDAIVGATRAMHTVMSDLCTGCNLCVDPCP 158


>PPD_STRHY RecName: Full=Phosphonopyruvate decarboxylase;       
           EC=4.1.1.82;
          Length = 401

 Score = 36.6 bits (83), Expect = 4e-04
 Identities = 26/84 (30%), Positives = 42/84 (50%), Gaps = 2/84 (2%)

Query: 183 LITHMGSSVGLGAGIALATGQFVVATVGDSTFYHAVLPQLVDIATRSVPILI-VVMDNAY 241
           ++  MGS+  +G G+AL T + VV   GD +     L  L  +A  +   L+ +++DN  
Sbjct: 237 MVGAMGSAATVGLGVALHTPRPVVVVDGDGSALMR-LGSLATVAAHAPGNLVHLILDNGV 295

Query: 242 TAMTGGQPSPSRAIPAERITEAFG 265
              TGGQ + S A+    +  A G
Sbjct: 296 HDSTGGQRTLSSAVDLPAVAAACG 319


>ODPA_RHIME RecName: Full=Pyruvate dehydrogenase E1 component
           subunit alpha;         EC=1.2.4.1;
          Length = 348

 Score = 36.6 bits (83), Expect = 4e-04
 Identities = 28/119 (23%), Positives = 57/119 (47%), Gaps = 7/119 (5%)

Query: 187 MGSSVGLGAGIALAT-----GQFVVATVGDSTFYHAVLPQLVDIATR-SVPILIVVMDNA 240
           +G+ V LG G+A A          +A  GD       + +  ++A    +P++ +V +N 
Sbjct: 144 VGAQVSLGTGLAFANRYRGNDNVSLAYFGDGAANQGQVYESFNMAALWKLPVIYIVENNR 203

Query: 241 YTAMTGGQPSPSRAIPAERITEAFGISTFVIDPIDVKKSVEIIKKAVEIVKSGRPAVVV 299
           Y   T    + ++   ++R   +FGI  + +D +DV+       +AVE  +SG+  +++
Sbjct: 204 YAMGTSVSRASAQTDFSQR-GASFGIPGYQVDGMDVRAVKAAADEAVEHCRSGKGPIIL 261


>NUOI_WOLTR RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 160

 Score = 36.6 bits (83), Expect = 4e-04
 Identities = 25/103 (24%), Positives = 39/103 (37%), Gaps = 9/103 (8%)

Query: 280 VEIIKKAVEIVKSGRPAVVVSRRPCALIGVRKARRAGIQLPKYQVDVNKCTGCGLCYNLL 339
           VE+IK  +  ++      V  + P     +    R    L +Y     +C  C LC  + 
Sbjct: 12  VELIKGFIITLRYAFKPKVTLKYPMEKGPLSPRFRGEHALRRYSNGEERCIACKLCEVIC 71

Query: 340 KCSAIY---------KRPDRKAHVDPALCVGCGICAEVCPFNA 373
              AI           R   +  +D   C+ CG+C E CP +A
Sbjct: 72  PAQAIVIEAEEREDGSRRTTRYDIDMTKCIYCGLCQEACPVDA 114


>NUOI_SACEN RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 188

 Score = 36.6 bits (83), Expect = 4e-04
 Identities = 20/68 (29%), Positives = 29/68 (42%), Gaps = 15/68 (22%)

Query: 318 QLPKYQVDVNKCTGCGLCYNLLKCSAIYKR-----------PDRKAHVDPAL----CVGC 362
           QL ++   + KC GC LC       AI+             P  +  +D  +    C+GC
Sbjct: 42  QLNRHPDGLEKCVGCELCAWACPADAIFVEGGTNTEDERYSPGERYGMDYQINYLRCIGC 101

Query: 363 GICAEVCP 370
           G+C E CP
Sbjct: 102 GLCIEACP 109


>NUOI_PROAC RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 198

 Score = 36.6 bits (83), Expect = 4e-04
 Identities = 21/71 (29%), Positives = 29/71 (40%), Gaps = 15/71 (21%)

Query: 318 QLPKYQVDVNKCTGCGLCYNLLKCSAIY---------------KRPDRKAHVDPALCVGC 362
           QL ++   + KC GC LC       AIY               +R  R   ++   C+ C
Sbjct: 41  QLNRWPDGLEKCVGCELCAWACPADAIYVEGADNTDEERYSPGERYGRVYEINYLRCILC 100

Query: 363 GICAEVCPFNA 373
           G+C E CP  A
Sbjct: 101 GMCIEACPTRA 111


>NUOI_ORITI RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 161

 Score = 36.6 bits (83), Expect = 4e-04
 Identities = 19/64 (29%), Positives = 26/64 (40%), Gaps = 9/64 (14%)

Query: 319 LPKYQVDVNKCTGCGLCYNLLKCSAIY---------KRPDRKAHVDPALCVGCGICAEVC 369
           L +Y     +C  C LC  +    AI           R   K  +D   C+ CG+C E C
Sbjct: 52  LRRYPDGEERCIACKLCEAICPAQAITIEAKEQPNGSRRTTKYDIDMTKCIYCGLCQEAC 111

Query: 370 PFNA 373
           P +A
Sbjct: 112 PVDA 115


>NUOI_ORITB RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 161

 Score = 36.6 bits (83), Expect = 4e-04
 Identities = 19/64 (29%), Positives = 26/64 (40%), Gaps = 9/64 (14%)

Query: 319 LPKYQVDVNKCTGCGLCYNLLKCSAIY---------KRPDRKAHVDPALCVGCGICAEVC 369
           L +Y     +C  C LC  +    AI           R   K  +D   C+ CG+C E C
Sbjct: 52  LRRYPDGEERCIACKLCEAICPAQAITIEAKEQPNGSRRTTKYDIDMTKCIYCGLCQEAC 111

Query: 370 PFNA 373
           P +A
Sbjct: 112 PVDA 115


>NUOI_CAMJR RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 213

 Score = 36.6 bits (83), Expect = 4e-04
 Identities = 26/93 (27%), Positives = 41/93 (44%), Gaps = 12/93 (12%)

Query: 288 EIVKSGRPAVVVSRRPCALIGVRKARRAGIQLPKYQVDVN-KCTGCGLCY-----NLLKC 341
           E++K    A +  + P   + +    RA  +L ++    N +C GCGLC      N ++ 
Sbjct: 43  ELLKRNNSATI--KYPFEKVKLDNRYRAVHRLMRFIESENERCIGCGLCEKICISNCIRM 100

Query: 342 SAIYKRPDRKA----HVDPALCVGCGICAEVCP 370
                   RK      ++   C+ CG CAEVCP
Sbjct: 101 ETSLDENGRKKVGNYSINLGRCIYCGFCAEVCP 133


>NUOI_CAMJJ RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 213

 Score = 36.6 bits (83), Expect = 4e-04
 Identities = 26/93 (27%), Positives = 41/93 (44%), Gaps = 12/93 (12%)

Query: 288 EIVKSGRPAVVVSRRPCALIGVRKARRAGIQLPKYQVDVN-KCTGCGLCY-----NLLKC 341
           E++K    A +  + P   + +    RA  +L ++    N +C GCGLC      N ++ 
Sbjct: 43  ELLKRNNSATI--KYPFEKVKLDNRYRAVHRLMRFIESENERCIGCGLCEKICISNCIRM 100

Query: 342 SAIYKRPDRKA----HVDPALCVGCGICAEVCP 370
                   RK      ++   C+ CG CAEVCP
Sbjct: 101 ETSLDENGRKKVENYSINLGRCIYCGFCAEVCP 133


>NUOI_CAMJE RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 213

 Score = 36.6 bits (83), Expect = 4e-04
 Identities = 26/93 (27%), Positives = 41/93 (44%), Gaps = 12/93 (12%)

Query: 288 EIVKSGRPAVVVSRRPCALIGVRKARRAGIQLPKYQVDVN-KCTGCGLCY-----NLLKC 341
           E++K    A +  + P   + +    RA  +L ++    N +C GCGLC      N ++ 
Sbjct: 43  ELLKRNNSATI--KYPFEKVKLDNRYRAVHRLMRFIESENERCIGCGLCEKICISNCIRM 100

Query: 342 SAIYKRPDRKA----HVDPALCVGCGICAEVCP 370
                   RK      ++   C+ CG CAEVCP
Sbjct: 101 ETSLDENGRKKVENYSINLGRCIYCGFCAEVCP 133


>NUOI_CAMJD RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 213

 Score = 36.6 bits (83), Expect = 4e-04
 Identities = 26/93 (27%), Positives = 41/93 (44%), Gaps = 12/93 (12%)

Query: 288 EIVKSGRPAVVVSRRPCALIGVRKARRAGIQLPKYQVDVN-KCTGCGLCY-----NLLKC 341
           E++K    A +  + P   + +    RA  +L ++    N +C GCGLC      N ++ 
Sbjct: 43  ELLKRNNSATI--KYPFEKVKLDNRYRAVHRLMRFIESENERCIGCGLCEKICISNCIRM 100

Query: 342 SAIYKRPDRKA----HVDPALCVGCGICAEVCP 370
                   RK      ++   C+ CG CAEVCP
Sbjct: 101 ETSLDENGRKKVGNYSINLGRCIYCGFCAEVCP 133


>NUOI_CAMJ8 RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 213

 Score = 36.6 bits (83), Expect = 4e-04
 Identities = 26/93 (27%), Positives = 41/93 (44%), Gaps = 12/93 (12%)

Query: 288 EIVKSGRPAVVVSRRPCALIGVRKARRAGIQLPKYQVDVN-KCTGCGLCY-----NLLKC 341
           E++K    A +  + P   + +    RA  +L ++    N +C GCGLC      N ++ 
Sbjct: 43  ELLKRNNSATI--KYPFEKVKLDNRYRAVHRLMRFIESENERCIGCGLCEKICISNCIRM 100

Query: 342 SAIYKRPDRKA----HVDPALCVGCGICAEVCP 370
                   RK      ++   C+ CG CAEVCP
Sbjct: 101 ETSLDENGRKKVGNYSINLGRCIYCGFCAEVCP 133


>NUOI2_STRCO RecName: Full=NADH-quinone oxidoreductase subunit I 2; 
                  EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I 2;
          Length = 197

 Score = 36.6 bits (83), Expect = 4e-04
 Identities = 14/20 (70%), Positives = 17/20 (85%)

Query: 354 VDPALCVGCGICAEVCPFNA 373
           +D ALC+ CGIC EVCPF+A
Sbjct: 95  IDFALCMYCGICIEVCPFDA 114


>ILVB_PORUM RecName: Full=Acetolactate synthase large subunit;      
             Short=AHAS;         EC=2.2.1.6;AltName:
           Full=Acetohydroxy-acid synthase large subunit;
          Length = 590

 Score = 36.6 bits (83), Expect = 4e-04
 Identities = 34/109 (31%), Positives = 51/109 (46%), Gaps = 23/109 (21%)

Query: 186 HMGSSVGLGA---GIALATG-------QFVVATVGDSTFYHAVLPQLVDIATRSVPILIV 235
           H  SS GLG    G+  A G       + V+   GDS+F    + +L  IA   +PI IV
Sbjct: 420 HWISSAGLGTMGYGLPAAIGAQVAHPNELVICVSGDSSF-QMNMQELGTIAQYKLPIKIV 478

Query: 236 VMDNAYTAMT--------GGQPSPSR----AIPAERITEAFGISTFVID 272
           +++N +  M         G + S SR    A   +++ EAFGI  F ++
Sbjct: 479 IINNRWQGMVRQWQQAFYGERYSHSRMTEGAPNFQKLAEAFGIKAFTVN 527


>ILVB_PORPU RecName: Full=Acetolactate synthase large subunit;      
             Short=AHAS;         EC=2.2.1.6;AltName:
           Full=Acetohydroxy-acid synthase large subunit;
          Length = 590

 Score = 36.6 bits (83), Expect = 4e-04
 Identities = 34/109 (31%), Positives = 51/109 (46%), Gaps = 23/109 (21%)

Query: 186 HMGSSVGLGA---GIALATG-------QFVVATVGDSTFYHAVLPQLVDIATRSVPILIV 235
           H  SS GLG    G+  A G       + V+   GDS+F    + +L  IA   +PI IV
Sbjct: 420 HWISSAGLGTMGYGLPAAIGAQVAHPNELVICVSGDSSF-QMNMQELGTIAQYKLPIKIV 478

Query: 236 VMDNAYTAMT--------GGQPSPSR----AIPAERITEAFGISTFVID 272
           +++N +  M         G + S SR    A   +++ EAFGI  F ++
Sbjct: 479 IINNRWQGMVRQWQQAFYGERYSHSRMTEGAPNFQKLAEAFGIKAFTVN 527


>HYCF_ECOLI RecName: Full=Formate hydrogenlyase subunit 6;       
           Short=FHL subunit 6;AltName: Full=Hydrogenase-3
           component F;
          Length = 180

 Score = 36.6 bits (83), Expect = 4e-04
 Identities = 29/107 (27%), Positives = 44/107 (41%), Gaps = 15/107 (14%)

Query: 288 EIVKSGRPAVVVSRRPCALIGVRKARRAGIQLPKYQVDVNKCTGCGLCYNLLKCSAIYKR 347
           +++K+G      S  P   I V K  R      K + +  +C GC  C N    +A+   
Sbjct: 7   KVIKTG---TATSSYPLEPIAVDKNFRG-----KPEQNPQQCIGCAACVNACPSNALTVE 58

Query: 348 PDRKA-----HVDPALCVGCGICAEVCPFNAFKPEGKREAWLELWRQ 389
            D          +   C+ CG C EVCP  A K   + E  L +W++
Sbjct: 59  TDLATGELAWEFNLGHCIFCGRCEEVCPTAAIKLSQEYE--LAVWKK 103


>HMEA_ARCFU RecName: Full=Hdr-like menaquinol oxidoreductase
           iron-sulfur subunit 1;         Short=Hme subunit
           A;Flags: Precursor;
          Length = 269

 Score = 36.6 bits (83), Expect = 4e-04
 Identities = 14/39 (35%), Positives = 19/39 (48%)

Query: 335 CYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCPFNA 373
           C  +    A +KRPD    +D   C+GC  C   CP+ A
Sbjct: 126 CVQVCLTKASFKRPDGIVEIDMHRCIGCRYCMIACPYGA 164


>FER_CLOPE RecName: Full=Ferredoxin;
          Length = 56

 Score = 36.6 bits (83), Expect = 4e-04
 Identities = 17/48 (35%), Positives = 23/48 (47%), Gaps = 1/48 (2%)

Query: 326 VNKCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCPFNA 373
           ++ C  CG C       AI  + D +  +D   C+ CG CA VCP  A
Sbjct: 6   LDTCVSCGACAAECPVDAI-SQGDTQFVIDADTCIDCGNCANVCPVGA 52


>FER_CLOPA RecName: Full=Ferredoxin;
          Length = 56

 Score = 36.6 bits (83), Expect = 4e-04
 Identities = 17/47 (36%), Positives = 23/47 (48%), Gaps = 1/47 (2%)

Query: 327 NKCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCPFNA 373
           + C  CG C +    +AI  + D    +D   C+ CG CA VCP  A
Sbjct: 7   DSCVSCGACASECPVNAI-SQGDSIFVIDADTCIDCGNCANVCPVGA 52


>YCXI_PORPU RecName: Full=Uncharacterized protein in rpl9-rpl11
           intergenic region;AltName: Full=ORF75;
          Length = 75

 Score = 36.2 bits (82), Expect = 5e-04
 Identities = 17/55 (30%), Positives = 24/55 (43%), Gaps = 6/55 (10%)

Query: 322 YQVDVNKCTGCGLCYNLLKCSAIYKRPDRKA------HVDPALCVGCGICAEVCP 370
           + +   KC G   C N    S I+K   +         +D A C+ C IC +VCP
Sbjct: 3   HTIVTEKCIGVAECVNACPVSCIHKGEGKNTINKDWYWIDFAACIDCSICIQVCP 57


>RNFB_SHIFL RecName: Full=Electron transport complex protein rnfB;
          Length = 192

 Score = 36.2 bits (82), Expect = 5e-04
 Identities = 16/47 (34%), Positives = 19/47 (40%)

Query: 324 VDVNKCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCP 370
           +D N C GC  C       AI         V   LC GC +C + CP
Sbjct: 112 IDENNCIGCTKCIQACPVDAIVGATRVMHTVMSDLCTGCNLCVDPCP 158


>RNFB_SHIBS RecName: Full=Electron transport complex protein rnfB;
          Length = 192

 Score = 36.2 bits (82), Expect = 5e-04
 Identities = 16/47 (34%), Positives = 19/47 (40%)

Query: 324 VDVNKCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCP 370
           +D N C GC  C       AI         V   LC GC +C + CP
Sbjct: 112 IDENNCIGCTKCIQACPVDAIVGATRVMHTVMSDLCTGCNLCVDPCP 158


>PHSB_SALTY RecName: Full=Thiosulfate reductase electron transport
           protein phsB;
          Length = 192

 Score = 36.2 bits (82), Expect = 5e-04
 Identities = 18/68 (26%), Positives = 29/68 (42%), Gaps = 2/68 (2%)

Query: 307 IGVRKARRAGIQLPKYQVDVNKCTGC--GLCYNLLKCSAIYKRPDRKAHVDPALCVGCGI 364
           + +R   +A   L  +Q     C  C    C ++    A Y+  +    VD + C+GC  
Sbjct: 42  VQIRAPEQASNALTHFQFVRVSCQHCENAPCVSVCPTGASYRDENGIVQVDKSRCIGCDY 101

Query: 365 CAEVCPFN 372
           C   CPF+
Sbjct: 102 CVAACPFH 109


>PHSB_SALTI RecName: Full=Thiosulfate reductase electron transport
           protein phsB;
          Length = 192

 Score = 36.2 bits (82), Expect = 5e-04
 Identities = 18/68 (26%), Positives = 29/68 (42%), Gaps = 2/68 (2%)

Query: 307 IGVRKARRAGIQLPKYQVDVNKCTGC--GLCYNLLKCSAIYKRPDRKAHVDPALCVGCGI 364
           + +R   +A   L  +Q     C  C    C ++    A Y+  +    VD + C+GC  
Sbjct: 42  VQIRAPEQASNALTHFQFVRVSCQHCENAPCVSVCPTGASYRDENGIVQVDKSRCIGCDY 101

Query: 365 CAEVCPFN 372
           C   CPF+
Sbjct: 102 CVAACPFH 109


>NUOI_CARHZ RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 140

 Score = 36.2 bits (82), Expect = 5e-04
 Identities = 19/55 (34%), Positives = 26/55 (47%), Gaps = 9/55 (16%)

Query: 328 KCTGCGLCYN-----LLKCSAIY----KRPDRKAHVDPALCVGCGICAEVCPFNA 373
           KC  CGLC       ++K  +I     KR      ++   C+ CG+C E CP NA
Sbjct: 50  KCIACGLCQQACPNKVIKVGSIKDENNKRKLASYEMEMKYCLFCGLCVEACPTNA 104


>NUOI_ANAPZ RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 164

 Score = 36.2 bits (82), Expect = 5e-04
 Identities = 17/64 (26%), Positives = 27/64 (42%), Gaps = 9/64 (14%)

Query: 319 LPKYQVDVNKCTGCGLCYNLLKCSAIYKRPDRKAH---------VDPALCVGCGICAEVC 369
           L +Y+    +C  C LC  +    AI    + ++          +D   C+ CG C E C
Sbjct: 55  LRRYESGEERCIACKLCEAICPAQAITIEAEERSDGSRRTTRYDIDMTKCIYCGFCQEAC 114

Query: 370 PFNA 373
           P +A
Sbjct: 115 PVDA 118


>FERA_METJA RecName: Full=Uncharacterized ferredoxin MJ0533;
          Length = 56

 Score = 36.2 bits (82), Expect = 5e-04
 Identities = 18/55 (32%), Positives = 26/55 (47%), Gaps = 1/55 (1%)

Query: 323 QVDVNKCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCPFNAFKPE 377
           ++D  KC  CG C  + +  AI    +    +D   C  C +C  VCP NA + E
Sbjct: 3   KIDYKKCGYCGACVGVCEKLAI-NLIEHIIVIDEKKCNNCKLCTIVCPLNALEGE 56


>FDXN_RHOCA RecName: Full=Ferredoxin-1;AltName: Full=Ferredoxin I;  
                 Short=FdI;
          Length = 65

 Score = 36.2 bits (82), Expect = 5e-04
 Identities = 13/24 (54%), Positives = 15/24 (62%)

Query: 354 VDPALCVGCGICAEVCPFNAFKPE 377
           +DP LC  CG C  VCP NA  P+
Sbjct: 5   IDPELCTSCGDCEPVCPTNAIAPK 28


>AB1E_ARATH RecName: Full=ABC transporter E family member 1;        
           Short=ABC transporter ABCE.1;       
           Short=AtABCE1;AltName: Full=RNase L inhibitor-like
           protein 1;
          Length = 603

 Score = 36.2 bits (82), Expect = 5e-04
 Identities = 12/26 (46%), Positives = 17/26 (65%)

Query: 350 RKAHVDPALCVGCGICAEVCPFNAFK 375
           + A +   LC+GCGIC + CPF A +
Sbjct: 46  KSAFISEELCIGCGICVKKCPFEAIQ 71


>VHCB_METVO RecName: Full=Polyferredoxin protein vhcB;
          Length = 157

 Score = 35.8 bits (81), Expect = 6e-04
 Identities = 25/90 (27%), Positives = 34/90 (37%), Gaps = 18/90 (20%)

Query: 303 PCALI----GVRKARRAGIQLPKYQV-----DVNKCTGCGLCYNLLKCSAIY-------- 345
           PCA+      +      G++LP         +   C  CG C +     A+         
Sbjct: 37  PCAIKCPNDAIMVVNPKGLELPSRAKTERANEFKMCDLCGTCVSACPTEALQMGKIVHNE 96

Query: 346 KRPDRKAHVDPALCVGCGICAEVCPFNAFK 375
           K  DR     P+LC  CG C E+CP N  K
Sbjct: 97  KEYDR-IEFTPSLCDSCGACVEICPQNVLK 125


>RPOD_ARCFU RecName: Full=DNA-directed RNA polymerase subunit D;    
               EC=2.7.7.6;
          Length = 264

 Score = 35.8 bits (81), Expect = 6e-04
 Identities = 19/55 (34%), Positives = 25/55 (45%), Gaps = 1/55 (1%)

Query: 319 LPKYQVDVNKCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCPFNA 373
           +P+  V+ N C GCG C      +   K  D+    +   C  CG C EVC  NA
Sbjct: 164 IPEIVVNEN-CNGCGDCIEACPRNVFEKDGDKVRVKNVMACSMCGECVEVCEMNA 217


>RNFB_PECCP RecName: Full=Electron transport complex protein rnfB;
          Length = 192

 Score = 35.8 bits (81), Expect = 6e-04
 Identities = 20/59 (33%), Positives = 23/59 (38%), Gaps = 3/59 (5%)

Query: 315 AGIQLPKYQV---DVNKCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCP 370
           A +Q P  QV   D + C GC  C       AI         V   LC GC +C   CP
Sbjct: 100 ADVQAPARQVAWIDESNCIGCTKCIQACPVDAIIGSTKAVHTVVSDLCTGCDLCVAPCP 158


>RNFB_MAGSM RecName: Full=Electron transport complex protein rnfB;
          Length = 181

 Score = 35.8 bits (81), Expect = 6e-04
 Identities = 24/86 (27%), Positives = 34/86 (39%), Gaps = 2/86 (2%)

Query: 285 KAVEIVKSGRPAVVVSRRPCALIGVRKARRAGIQLPKYQVDVNKCTGCGLCYNLLKCSAI 344
           +A+ +   G  AV+ S    A++GV  A           +D   C GC  C  +    AI
Sbjct: 68  EAINLCTPGGKAVMESI--AAMLGVSPAAMDDEGPKVAYIDEEACIGCTACIKVCPVDAI 125

Query: 345 YKRPDRKAHVDPALCVGCGICAEVCP 370
                +   V  A C  C +C E CP
Sbjct: 126 VGANKQSHTVIVAECTSCQLCLEPCP 151


>RNFB_HAEDU RecName: Full=Electron transport complex protein rnfB;
          Length = 207

 Score = 35.8 bits (81), Expect = 6e-04
 Identities = 25/89 (28%), Positives = 35/89 (39%), Gaps = 6/89 (6%)

Query: 290 VKSGRPAVVVSRRPCALIGVRKARRAGIQLPKYQVDV---NKCTGCGLCYNLLKCSAIYK 346
           V  G+P VV   +   L+GV         +P+ +V +   + C GC  C       AI  
Sbjct: 77  VPGGQPLVV---KIAELMGVDVPSMDNTAVPEVKVALIHEDMCIGCTKCIQACPVDAIIG 133

Query: 347 RPDRKAHVDPALCVGCGICAEVCPFNAFK 375
                  V   LC GC +C   CP N  +
Sbjct: 134 TNKAMHTVVADLCTGCELCVAPCPTNCIE 162


>RLI1_YEAST RecName: Full=Translation initiation factor
           RLI1;AltName: Full=RNase L inhibitor;AltName:
           Full=ATP-binding cassette sub-family E member RLI1;
          Length = 608

 Score = 35.8 bits (81), Expect = 6e-04
 Identities = 12/24 (50%), Positives = 17/24 (70%)

Query: 352 AHVDPALCVGCGICAEVCPFNAFK 375
           A +   LC+GCGIC + CPF+A +
Sbjct: 48  AFISEILCIGCGICVKKCPFDAIQ 71


>NUOI_EHRCR RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 169

 Score = 35.8 bits (81), Expect = 6e-04
 Identities = 19/64 (29%), Positives = 26/64 (40%), Gaps = 9/64 (14%)

Query: 319 LPKYQVDVNKCTGCGLCYNLLKCSAIY---------KRPDRKAHVDPALCVGCGICAEVC 369
           L KY+    +C  C LC  +    AI           R   +  +D   C+ CG C E C
Sbjct: 60  LRKYKNGEERCIACKLCEAICPAQAITIEAQERDDGSRRTVRYDIDMTKCIYCGFCQEAC 119

Query: 370 PFNA 373
           P +A
Sbjct: 120 PVDA 123


>NUOI_EHRCJ RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 167

 Score = 35.8 bits (81), Expect = 6e-04
 Identities = 19/64 (29%), Positives = 26/64 (40%), Gaps = 9/64 (14%)

Query: 319 LPKYQVDVNKCTGCGLCYNLLKCSAIY---------KRPDRKAHVDPALCVGCGICAEVC 369
           L KY+    +C  C LC  +    AI           R   +  +D   C+ CG C E C
Sbjct: 58  LRKYKNGEERCIACKLCEAICPAQAITIEAQERDDGSRRTVRYDIDMTKCIYCGFCQEAC 117

Query: 370 PFNA 373
           P +A
Sbjct: 118 PVDA 121


>NUOI_CAUCR RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 163

 Score = 35.8 bits (81), Expect = 6e-04
 Identities = 18/64 (28%), Positives = 26/64 (40%), Gaps = 9/64 (14%)

Query: 319 LPKYQVDVNKCTGCGLCYNLLKCSAIY---------KRPDRKAHVDPALCVGCGICAEVC 369
           L +Y     +C  C LC  +    AI           R   +  +D   C+ CG+C E C
Sbjct: 54  LRRYPSGEERCIACKLCEAICPAQAITIEAEPREDGSRRTTRYDIDMVKCIYCGLCQEAC 113

Query: 370 PFNA 373
           P +A
Sbjct: 114 PVDA 117


>NUOI_CAMHC RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 200

 Score = 35.8 bits (81), Expect = 6e-04
 Identities = 18/52 (34%), Positives = 27/52 (51%), Gaps = 9/52 (17%)

Query: 328 KCTGCGLCY-----NLLKCSAIYKRPDRKAHVDPAL----CVGCGICAEVCP 370
           +C GCGLC      N ++         RK  ++ ++    CV CG+CA+VCP
Sbjct: 81  RCIGCGLCEKICVSNCIRMETTLGDDGRKKVLNYSINFGRCVYCGLCADVCP 132


>NDUS8_TOBAC RecName: Full=NADH dehydrogenase [ubiquinone]
           iron-sulfur protein 8, mitochondrial;       
           EC=1.6.5.3;         EC=1.6.99.3;
          Length = 230

 Score = 35.8 bits (81), Expect = 6e-04
 Identities = 18/64 (28%), Positives = 25/64 (39%), Gaps = 9/64 (14%)

Query: 319 LPKYQVDVNKCTGCGLCYNLLKCSAIY---------KRPDRKAHVDPALCVGCGICAEVC 369
           L +Y     +C  C LC  +    AI           R   +  +D   C+ CG C E C
Sbjct: 121 LRRYPTGEERCIACKLCEAICPAQAITIEAEAREDGSRRTTRYDIDMTKCIYCGFCQEAC 180

Query: 370 PFNA 373
           P +A
Sbjct: 181 PVDA 184


>NDUS8_SOLTU RecName: Full=NADH dehydrogenase [ubiquinone]
           iron-sulfur protein 8, mitochondrial;       
           EC=1.6.5.3;         EC=1.6.99.3;
          Length = 229

 Score = 35.8 bits (81), Expect = 6e-04
 Identities = 18/64 (28%), Positives = 25/64 (39%), Gaps = 9/64 (14%)

Query: 319 LPKYQVDVNKCTGCGLCYNLLKCSAIY---------KRPDRKAHVDPALCVGCGICAEVC 369
           L +Y     +C  C LC  +    AI           R   +  +D   C+ CG C E C
Sbjct: 120 LRRYATGEERCIACKLCEAICPAQAITIEAEEREDGSRRTTRYDIDMTKCIYCGFCQEAC 179

Query: 370 PFNA 373
           P +A
Sbjct: 180 PVDA 183


>FRHG_METJA RecName: Full=Coenzyme F420 hydrogenase subunit gamma;  
                 EC=1.12.98.1;AltName:
           Full=8-hydroxy-5-deazaflavin-reducing hydrogenase
           subunit gamma;
          Length = 230

 Score = 35.8 bits (81), Expect = 6e-04
 Identities = 20/69 (28%), Positives = 32/69 (46%), Gaps = 1/69 (1%)

Query: 302 RPCALIGVRKARRAGIQLPKYQVDVNKCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVG 361
           +P A +  + +   G  +    V+ + C GCG C       AI +  D + +V   LC+ 
Sbjct: 151 QPYAELAEKGSEACGCDVIYKVVNKSLCMGCGTCAAACPTRAI-EMLDGRPNVLKELCIK 209

Query: 362 CGICAEVCP 370
           CG C+  CP
Sbjct: 210 CGACSVQCP 218


>FPRB_MYCTU RecName: Full=Probable ferredoxin/ferredoxin--NADP
           reductase;         Short=FNR;         EC=1.18.1.2;
          Length = 575

 Score = 35.8 bits (81), Expect = 6e-04
 Identities = 17/60 (28%), Positives = 22/60 (36%), Gaps = 7/60 (11%)

Query: 324 VDVNKCTGCGLCYNLLKCSAIYKRPDRKA-------HVDPALCVGCGICAEVCPFNAFKP 376
           V    C     C      + I+  PD          ++DP  CV CG C   CP +A  P
Sbjct: 4   VITQSCCNDASCVFACPVNCIHPTPDEPGFATSEMLYIDPVACVDCGACVTACPVSAIAP 63


>FPRB_MYCBO RecName: Full=Probable ferredoxin/ferredoxin--NADP
           reductase;         Short=FNR;         EC=1.18.1.2;
          Length = 575

 Score = 35.8 bits (81), Expect = 6e-04
 Identities = 17/60 (28%), Positives = 22/60 (36%), Gaps = 7/60 (11%)

Query: 324 VDVNKCTGCGLCYNLLKCSAIYKRPDRKA-------HVDPALCVGCGICAEVCPFNAFKP 376
           V    C     C      + I+  PD          ++DP  CV CG C   CP +A  P
Sbjct: 4   VITQSCCNDASCVFACPVNCIHPTPDEPGFATSEMLYIDPVACVDCGACVTACPVSAIAP 63


>FDHL_STAHJ RecName: Full=Putative formate dehydrogenase SH0748;    
               EC=1.2.1.2;
          Length = 984

 Score = 35.8 bits (81), Expect = 6e-04
 Identities = 21/67 (31%), Positives = 29/67 (43%), Gaps = 13/67 (19%)

Query: 320 PKYQVDVNKCTGCGLCYNLLK-------CSAIYKRP------DRKAHVDPALCVGCGICA 366
           P Y+ D ++C  CG C    +        S  + R       D    ++ + CV CG CA
Sbjct: 138 PFYRYDPDQCILCGRCVEACQDIEVNETISIDWNREHPRVIWDNDVPINESSCVSCGQCA 197

Query: 367 EVCPFNA 373
            VCP NA
Sbjct: 198 TVCPCNA 204


>YNFG_ECOLI RecName: Full=Probable anaerobic dimethyl sulfoxide
           reductase chain ynfG;AltName: Full=DMSO reductase
           iron-sulfur subunit ynfG;
          Length = 205

 Score = 35.4 bits (80), Expect = 8e-04
 Identities = 16/47 (34%), Positives = 22/47 (46%), Gaps = 2/47 (4%)

Query: 329 CTGCG--LCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCPFNA 373
           C  C    C  +    A++KR D    VD  +C+GC  C   CP+ A
Sbjct: 67  CNHCDDPACTKVCPSGAMHKREDGFVVVDEDVCIGCRYCHMACPYGA 113


>YNFG_ECOL6 RecName: Full=Probable anaerobic dimethyl sulfoxide
           reductase chain ynfG;AltName: Full=DMSO reductase
           iron-sulfur subunit ynfG;
          Length = 205

 Score = 35.4 bits (80), Expect = 8e-04
 Identities = 16/47 (34%), Positives = 22/47 (46%), Gaps = 2/47 (4%)

Query: 329 CTGCG--LCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCPFNA 373
           C  C    C  +    A++KR D    VD  +C+GC  C   CP+ A
Sbjct: 67  CNHCDDPACTKVCPSGAMHKREDGFVVVDEDVCIGCRYCHMACPYGA 113


>Y726_METJA RecName: Full=Uncharacterized protein MJ0726;
          Length = 216

 Score = 35.4 bits (80), Expect = 8e-04
 Identities = 17/41 (41%), Positives = 21/41 (51%), Gaps = 2/41 (4%)

Query: 329 CTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVC 369
           CTGCG C  + KC A     D K  V+ + C+ CG C   C
Sbjct: 169 CTGCGTC--VAKCPANALTIDEKPKVNISKCIKCGTCFFNC 207


>RNFB_TOLAT RecName: Full=Electron transport complex protein rnfB;
          Length = 185

 Score = 35.4 bits (80), Expect = 8e-04
 Identities = 15/49 (30%), Positives = 20/49 (40%)

Query: 327 NKCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCPFNAFK 375
           N C GC  C       AI   P     +  + C GC +C + CP N  +
Sbjct: 113 NLCIGCTKCIQACPVDAIIGAPKLMHTILRSECTGCDLCVDPCPTNCIE 161


>RNFB_PASMU RecName: Full=Electron transport complex protein rnfB;
          Length = 198

 Score = 35.4 bits (80), Expect = 8e-04
 Identities = 15/47 (31%), Positives = 19/47 (40%)

Query: 324 VDVNKCTGCGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCP 370
           +D + C GC  C       AI         + P LC GC +C   CP
Sbjct: 110 IDEDMCIGCTKCIQACPVDAIIGTNKAMHTIIPDLCTGCELCVPPCP 156


>NUOI_RICM5 RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 159

 Score = 35.4 bits (80), Expect = 8e-04
 Identities = 17/64 (26%), Positives = 26/64 (40%), Gaps = 9/64 (14%)

Query: 319 LPKYQVDVNKCTGCGLCYNLLKCSAIYKRPDRKAH---------VDPALCVGCGICAEVC 369
           L +Y+    +C  C LC  +    AI    D +           +D   C+ CG+C   C
Sbjct: 50  LRRYENGEERCIACKLCEAICPAQAIVIEADEREDGSRRTTRYDIDMTKCIYCGLCQAAC 109

Query: 370 PFNA 373
           P +A
Sbjct: 110 PVDA 113


>NUOI_RALEH RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 163

 Score = 35.4 bits (80), Expect = 8e-04
 Identities = 19/64 (29%), Positives = 26/64 (40%), Gaps = 9/64 (14%)

Query: 319 LPKYQVDVNKCTGCGLCYNLLKCSAIYKRPDRKAH---------VDPALCVGCGICAEVC 369
           L +Y     +C  C LC  +    AI    D +A          +D   C+ CG C E C
Sbjct: 54  LRRYPNGEERCIACKLCEAVCPALAITIESDARADGXXXXXXYDIDLTKCIFCGFCEEAC 113

Query: 370 PFNA 373
           P +A
Sbjct: 114 PVDA 117


>NUOI_NOCSJ RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 196

 Score = 35.4 bits (80), Expect = 8e-04
 Identities = 21/75 (28%), Positives = 29/75 (38%), Gaps = 19/75 (25%)

Query: 318 QLPKYQVDVNKCTGCGLCYNLLKCSAIY-------------------KRPDRKAHVDPAL 358
           QL ++   + KC GC LC       AIY                   +R  R   ++   
Sbjct: 53  QLNRWPDGLEKCVGCELCAWACPADAIYVEGASNSDDPDGGERFSPGERYGRVYQINYLR 112

Query: 359 CVGCGICAEVCPFNA 373
           C+ CG+C E CP  A
Sbjct: 113 CILCGLCIEACPTRA 127


>NUOI_CUPTR RecName: Full=NADH-quinone oxidoreductase subunit I;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I;AltName: Full=NDH-1 subunit I;
          Length = 163

 Score = 35.4 bits (80), Expect = 8e-04
 Identities = 19/64 (29%), Positives = 26/64 (40%), Gaps = 9/64 (14%)

Query: 319 LPKYQVDVNKCTGCGLCYNLLKCSAIYKRPDRKAH---------VDPALCVGCGICAEVC 369
           L +Y     +C  C LC  +    AI    D +A          +D   C+ CG C E C
Sbjct: 54  LRRYPNGEERCIACKLCEAVCPALAITIESDARADGXXXXXXYDIDLTKCIFCGFCEEAC 113

Query: 370 PFNA 373
           P +A
Sbjct: 114 PVDA 117


>NUOI2_SYNFM RecName: Full=NADH-quinone oxidoreductase subunit I 2; 
                  EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I 2;
          Length = 178

 Score = 35.4 bits (80), Expect = 8e-04
 Identities = 22/71 (30%), Positives = 33/71 (46%), Gaps = 9/71 (12%)

Query: 314 RAGIQLPKYQVDVNKCTGCGLCYNLLKCSAIY----KRPDRKAH-----VDPALCVGCGI 364
           RA I L +      +C  C LC  +   S I     +R D + H     ++ A C+ CG+
Sbjct: 43  RAVIVLTRDPDGGERCVACYLCSAVCPVSCISMQAAEREDGRRHAAWFRINFARCIYCGL 102

Query: 365 CAEVCPFNAFK 375
           C E CP +A +
Sbjct: 103 CEEACPTSAIQ 113


>NUOI2_STRAW RecName: Full=NADH-quinone oxidoreductase subunit I 2; 
                  EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I 2;
          Length = 216

 Score = 35.4 bits (80), Expect = 8e-04
 Identities = 13/20 (65%), Positives = 17/20 (85%)

Query: 354 VDPALCVGCGICAEVCPFNA 373
           +D +LC+ CGIC EVCPF+A
Sbjct: 95  IDFSLCMYCGICIEVCPFDA 114


>NUOI1_SYNFM RecName: Full=NADH-quinone oxidoreductase subunit I 1; 
                  EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit I 1;
          Length = 149

 Score = 35.4 bits (80), Expect = 8e-04
 Identities = 27/89 (30%), Positives = 37/89 (41%), Gaps = 14/89 (15%)

Query: 294 RPAVVVSRRPCALIGVRKARRAGIQLPKY-QVDVNKCTGCGLCYNLLKCSAIYKRPDRKA 352
           RP V V + P  ++ +  A R  I+L  +     +KC  CG C  +   + I K    KA
Sbjct: 27  RPVVTV-QYPREVVTLSPAFRGHIELKSFADTGTHKCIACGTCERMCPSNVI-KVQGTKA 84

Query: 353 H-----------VDPALCVGCGICAEVCP 370
                       +D   C  CGIC E CP
Sbjct: 85  QPKGAKVATHYVIDFTRCSLCGICVESCP 113


>NDUS8_PONAB RecName: Full=NADH dehydrogenase [ubiquinone]
           iron-sulfur protein 8, mitochondrial;       
           EC=1.6.5.3;         EC=1.6.99.3;
          Length = 210

 Score = 35.4 bits (80), Expect = 8e-04
 Identities = 18/64 (28%), Positives = 26/64 (40%), Gaps = 9/64 (14%)

Query: 319 LPKYQVDVNKCTGCGLCYNLLKCSAIYKRPDRKAH---------VDPALCVGCGICAEVC 369
           L +Y     +C  C LC  +    AI    + +A          +D   C+ CG C E C
Sbjct: 101 LRRYPSGEERCIACKLCEAICPAQAITIEAEPRADGSRRTTRYDIDMTKCIYCGFCQEAC 160

Query: 370 PFNA 373
           P +A
Sbjct: 161 PVDA 164


>NDUS8_PANTR RecName: Full=NADH dehydrogenase [ubiquinone]
           iron-sulfur protein 8, mitochondrial;       
           EC=1.6.5.3;         EC=1.6.99.3;
          Length = 210

 Score = 35.4 bits (80), Expect = 8e-04
 Identities = 18/64 (28%), Positives = 26/64 (40%), Gaps = 9/64 (14%)

Query: 319 LPKYQVDVNKCTGCGLCYNLLKCSAIYKRPDRKAH---------VDPALCVGCGICAEVC 369
           L +Y     +C  C LC  +    AI    + +A          +D   C+ CG C E C
Sbjct: 101 LRRYPSGEERCIACKLCEAICPAQAITIEAEPRADGSRRTTRYDIDMTKCIYCGFCQEAC 160

Query: 370 PFNA 373
           P +A
Sbjct: 161 PVDA 164


>NDUS8_MOUSE RecName: Full=NADH dehydrogenase [ubiquinone]
           iron-sulfur protein 8, mitochondrial;       
           EC=1.6.5.3;         EC=1.6.99.3;
          Length = 212

 Score = 35.4 bits (80), Expect = 8e-04
 Identities = 18/64 (28%), Positives = 26/64 (40%), Gaps = 9/64 (14%)

Query: 319 LPKYQVDVNKCTGCGLCYNLLKCSAIYKRPDRKAH---------VDPALCVGCGICAEVC 369
           L +Y     +C  C LC  +    AI    + +A          +D   C+ CG C E C
Sbjct: 103 LRRYPSGEERCIACKLCEAICPAQAITIEAEPRADGSRRTTRYDIDMTKCIYCGFCQEAC 162

Query: 370 PFNA 373
           P +A
Sbjct: 163 PVDA 166


>NDUS8_HUMAN RecName: Full=NADH dehydrogenase [ubiquinone]
           iron-sulfur protein 8, mitochondrial;       
           EC=1.6.5.3;         EC=1.6.99.3;
          Length = 210

 Score = 35.4 bits (80), Expect = 8e-04
 Identities = 18/64 (28%), Positives = 26/64 (40%), Gaps = 9/64 (14%)

Query: 319 LPKYQVDVNKCTGCGLCYNLLKCSAIYKRPDRKAH---------VDPALCVGCGICAEVC 369
           L +Y     +C  C LC  +    AI    + +A          +D   C+ CG C E C
Sbjct: 101 LRRYPSGEERCIACKLCEAICPAQAITIEAEPRADGSRRTTRYDIDMTKCIYCGFCQEAC 160

Query: 370 PFNA 373
           P +A
Sbjct: 161 PVDA 164


>NDUS8_GORGO RecName: Full=NADH dehydrogenase [ubiquinone]
           iron-sulfur protein 8, mitochondrial;       
           EC=1.6.5.3;         EC=1.6.99.3;
          Length = 210

 Score = 35.4 bits (80), Expect = 8e-04
 Identities = 18/64 (28%), Positives = 26/64 (40%), Gaps = 9/64 (14%)

Query: 319 LPKYQVDVNKCTGCGLCYNLLKCSAIYKRPDRKAH---------VDPALCVGCGICAEVC 369
           L +Y     +C  C LC  +    AI    + +A          +D   C+ CG C E C
Sbjct: 101 LRRYPSGEERCIACKLCEAICPAQAITIEAEPRADGSRRTTRYDIDMTKCIYCGFCQEAC 160

Query: 370 PFNA 373
           P +A
Sbjct: 161 PVDA 164


>NDUS8_ARATH RecName: Full=NADH dehydrogenase [ubiquinone]
           iron-sulfur protein 8, mitochondrial;       
           EC=1.6.5.3;         EC=1.6.99.3;
          Length = 222

 Score = 35.4 bits (80), Expect = 8e-04
 Identities = 18/64 (28%), Positives = 25/64 (39%), Gaps = 9/64 (14%)

Query: 319 LPKYQVDVNKCTGCGLCYNLLKCSAIY---------KRPDRKAHVDPALCVGCGICAEVC 369
           L +Y     +C  C LC  +    AI           R   +  +D   C+ CG C E C
Sbjct: 113 LRRYPTGEERCIACKLCEAVCPAQAITIEAEEREDGSRRTTRYDIDMTKCIYCGFCQEAC 172

Query: 370 PFNA 373
           P +A
Sbjct: 173 PVDA 176


>NAPH_HAEIN RecName: Full=Ferredoxin-type protein napH homolog;
          Length = 287

 Score = 35.4 bits (80), Expect = 8e-04
 Identities = 18/57 (31%), Positives = 25/57 (43%), Gaps = 5/57 (8%)

Query: 324 VDVNKCTGCGLCYNLLKCSAIYKRP-----DRKAHVDPALCVGCGICAEVCPFNAFK 375
           +D  KC  C  CYN+   + + + P     D    V    C+ CG C +VC    FK
Sbjct: 221 IDRAKCDNCMDCYNVCPEAQVLRSPLHGKKDESLLVLSKDCISCGRCIDVCAEKVFK 277


>HDRA1_METKA RecName: Full=CoB--CoM heterodisulfide reductase
           iron-sulfur subunit A 1;         EC=1.8.98.1;
          Length = 669

 Score = 35.4 bits (80), Expect = 8e-04
 Identities = 15/27 (55%), Positives = 18/27 (66%), Gaps = 3/27 (11%)

Query: 344 IYKRPDRKAHVDPALCVGCGICAEVCP 370
           I K+P    +VD   C GCG+CAEVCP
Sbjct: 237 IEKKP---RYVDEDACTGCGVCAEVCP 260


>FWDG_METJA RecName: Full=Polyferredoxin protein fwdG;
          Length = 82

 Score = 35.4 bits (80), Expect = 8e-04
 Identities = 22/73 (30%), Positives = 28/73 (38%), Gaps = 21/73 (28%)

Query: 328 KCTGCGLCYNLLKCSAIYKRPDRKAHVDPA-------------------LCVGCGICAEV 368
           +C GCG C  ++ C    K P+      P                    LC GCG C E 
Sbjct: 12  RCHGCGNC--VVSCPVNAKHPETWGGKGPYSDDVVIRVENGVVTVVNQDLCGGCGACIEA 69

Query: 369 CPFNAFKPEGKRE 381
           CP NA +   KR+
Sbjct: 70  CPVNAIELVFKRK 82


>FPRB_MYCLE RecName: Full=Probable ferredoxin/ferredoxin--NADP
           reductase;         Short=FNR;         EC=1.18.1.2;
          Length = 555

 Score = 35.4 bits (80), Expect = 8e-04
 Identities = 16/52 (30%), Positives = 20/52 (38%), Gaps = 7/52 (13%)

Query: 329 CTGCGLCYNLLKCSAIYKRPDRKA-------HVDPALCVGCGICAEVCPFNA 373
           C   G C      + I+  PD          ++DP  CV CG C   CP  A
Sbjct: 9   CCNDGSCVFACPVNCIHPTPDEPGFATSEMLYIDPVACVDCGACVSACPVGA 60


>FER_THET8 RecName: Full=Ferredoxin;
          Length = 79

 Score = 35.4 bits (80), Expect = 8e-04
 Identities = 15/43 (34%), Positives = 20/43 (46%), Gaps = 1/43 (2%)

Query: 335 CYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCPFNAFKPE 377
           C  +     IY   D+  ++ P  C+ CG C   CP NA  PE
Sbjct: 17  CVEVCPVECIYDGGDQ-FYIHPEECIDCGACVPACPVNAIYPE 58


>FER4_METJA RecName: Full=Uncharacterized ferredoxin MJ0199;
          Length = 62

 Score = 35.4 bits (80), Expect = 8e-04
 Identities = 18/56 (32%), Positives = 23/56 (41%), Gaps = 2/56 (3%)

Query: 324 VDVNKCTG--CGLCYNLLKCSAIYKRPDRKAHVDPALCVGCGICAEVCPFNAFKPE 377
           +D + C G  C  C N           D+     P  C  CG+C +VCP  A K E
Sbjct: 5   IDYSLCKGAECAECVNNCPMEVFEIEGDKVVVARPDDCTYCGVCEDVCPTGAVKVE 60


>DPYD_DANRE RecName: Full=Dihydropyrimidine dehydrogenase [NADP+];  
                 Short=DHPDHase;         Short=DPD;       
           EC=1.3.1.2;AltName: Full=Dihydrouracil dehydrogenase;
          Length = 1022

 Score = 35.4 bits (80), Expect = 8e-04
 Identities = 19/50 (38%), Positives = 21/50 (42%), Gaps = 3/50 (6%)

Query: 324 VDVNKCTGCGLCYNLLKCS---AIYKRPDRKAHVDPALCVGCGICAEVCP 370
           VD   C  CG CY     S   AI   P+    V    C GC +C  VCP
Sbjct: 947 VDPEMCINCGKCYMTCNDSGYQAIKFDPETHLPVITDSCTGCTLCLSVCP 996


>AB2E_ARATH RecName: Full=ABC transporter E family member 2;        
           Short=ABC transporter ABCE.2;       
           Short=AtABCE2;AltName: Full=RNase L inhibitor-like
           protein 2;
          Length = 605

 Score = 35.4 bits (80), Expect = 8e-04
 Identities = 12/24 (50%), Positives = 16/24 (66%)

Query: 352 AHVDPALCVGCGICAEVCPFNAFK 375
           A +   LC+GCGIC + CPF A +
Sbjct: 48  AFISEELCIGCGICVKKCPFEAIQ 71


  Database: sws57.9x
    Posted date:  Nov 5, 2009 10:46 AM
  Number of letters in database: 179,409,320
  Number of sequences in database:  510,076
  
Lambda     K      H
   0.316    0.135    0.374 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 510076
Number of Hits to DB: 7,261,732,588
Number of extensions: 290869989
Number of successful extensions: 754240
Number of sequences better than 1.0e-03: 10447
Number of HSP's gapped: 741213
Number of HSP's successfully gapped: 12219
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.8 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.1 bits)