# hmmscan :: search sequence(s) against a profile HMM database
# HMMER 3.0b2 (June 2009); http://hmmer.org/
# Copyright (C) 2009 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query sequence file:             /home/niguts/usr08/shisakam/FASTA/gib_20651.fasta
# target HMM database:             /home/niguts/usr08/shisakam/PFAM/ver24.0/Pfam-A.hmm
# sequence search space set to:    100000
# set reporting thresholds to:     GA cutoffs
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       AAL64528.1  [L=106]
Description: paer1 AAL64528.1 GIB00076CH01 "ribosomal protein S10"
Scores for complete sequence (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Model    Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    1.3e-27   98.1   0.0    1.4e-27   97.9   0.0    1.0  1  PF00338  Ribosomal protein S10p/S20e
  ------ inclusion threshold ------
        1.4   11.7   0.0        2.1   11.2   0.0    1.2  1  PF00298  Ribosomal protein L11, RNA binding domain
        1.7    9.2   0.0        2.1    8.9   0.0    1.1  1  PF02399  Origin of replication binding protein
        3.3    9.8   0.0        4.3    9.4   0.0    1.2  1  PF09476  Pilus biogenesis CpaD protein (pilus_cpaD)
        4.9    9.4   0.0        8.9    8.6   0.0    1.4  1  PF03020  LEM domain
        7.9    9.2   0.0         13    8.5   0.0    1.3  1  PF01985  CRS1 / YhbY (CRM) domain
         16    7.5   0.0         23    7.0   0.0    1.3  1  PF03808  Glycosyl transferase WecB/TagA/CpsF family
         17    6.4   0.0         18    6.3   0.0    1.1  1  PF01264  Chorismate synthase
         25    7.3   0.0         42    6.5   0.0    1.3  1  PF07544  RNA polymerase II transcription mediator complex su
         27    6.1   0.2         54    5.1   0.1    1.5  1  PF01972  Serine dehydrogenase proteinase
         36    7.0   0.1         85    5.8   0.0    1.5  1  PF08546  Ketopantoate reductase PanE/ApbA C terminal
         46    6.6   0.0         76    5.9   0.0    1.3  1  PF00258  Flavodoxin
         52    6.4   0.0         89    5.6   0.0    1.3  1  PF08769  Sporulation initiation factor Spo0A C terminal
         55    6.4   0.0      1e+02    5.6   0.0    1.4  1  PF01706  FliG C-terminal domain
         60    5.5   0.0         89    4.9   0.0    1.2  1  PF09475  Dot/Icm secretion system protein (dot_icm_IcmQ)
         66    5.9   0.0    1.7e+02    4.6   0.0    1.8  1  PF04760  Translation initiation factor IF-2, N-terminal regi
         86    5.9   0.0    1.4e+02    5.2   0.0    1.3  1  PF11020  Protein of unknown function (DUF2610)
      1e+02    5.4   0.0    1.6e+02    4.7   0.0    1.3  1  PF07498  Rho termination factor, N-terminal domain
    1.3e+02    4.9   0.1    1.7e+02    4.5   0.0    1.2  1  PF10767  Protein of unknown function (DUF2593)
    1.4e+02    4.0   0.0    1.9e+02    3.6   0.0    1.2  1  PF09359  VTC domain
    1.4e+02    3.9   0.0    1.9e+02    3.5   0.0    1.1  1  PF11867  Domain of unknown function (DUF3387)
      2e+02    4.3   0.1    4.1e+02    3.2   0.0    1.5  1  PF02944  BESS motif
      2e+02    4.0   0.0      3e+02    3.5   0.0    1.2  1  PF01633  Choline/ethanolamine kinase
    2.1e+02    5.2   0.0    5.6e+02    3.9   0.0    1.7  1  PF10522  RII binding domain
    2.2e+02    3.5   0.0    2.6e+02    3.3   0.0    1.1  1  PF01075  Glycosyltransferase family 9 (heptosyltransferase)
    2.3e+02    4.7   0.0    3.5e+02    4.1   0.0    1.3  1  PF00586  AIR synthase related protein, N-terminal domain
    2.5e+02    4.0   0.0    3.8e+02    3.4   0.0    1.3  1  PF09754  PAC2 family
    2.5e+02    3.8   0.1    4.1e+02    3.1   0.1    1.3  1  PF02022  Integrase Zinc binding domain
    4.8e+02    3.6   0.0    1.1e+03    2.5   0.0    1.5  1  PF07621  Protein of unknown function (DUF1582)
    5.5e+02    2.0   0.0    7.9e+02    1.5   0.0    1.1  1  PF00331  Glycosyl hydrolase family 10
    7.4e+02    1.5   0.4      1e+03    1.0   0.0    1.3  1  PF05802  Enterobacterial EspB protein
    9.3e+02    2.6   1.0    3.8e+03    0.6   0.3    2.0  1  PF12332  Bacterial methyl-accepting chemotaxis protein N ter
    2.2e+03    2.2   0.2    3.8e+03    1.5   0.1    1.3  1  PF08249  Mastoparan protein
    2.5e+03    1.9   3.1      7e+02    3.6   0.1    1.7  1  PF08256  Aurein-like antibiotic peptide


Domain and alignment annotation for each model:
>> PF00338  Ribosomal protein S10p/S20e
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   97.9   0.0   4.9e-31   1.4e-27       1      96 [.       9     104 ..       9     105 .. 0.98

  Alignments for each domain:
  == domain 1    score: 97.9 bits;  conditional E-value: 4.9e-31
                 EEEEEE---HHHHHHHHHHHHHHHHT----EE-EEEECEEEEEEEE-----S-.SSS-EEEEEEEEEEEEEESS--HHHHHHCCHS------EEEEE CS
     PF00338   1 iriklkSydhkllekavkqiieaakrlglkvsgpiplPtkrkrvtvlrsphvd.kksreqfeirthkrlidipdateetvdallkirlpegVeveik 96 
                 +ri+l +++++ +e+++++i+++ak++g++v+gpiplPt+r++vtv+r p ++  ++ +++e+r+ krlidi +a+e++++ l+ ir+p+ V++e++
  AAL64528.1   9 VRIRLYGTNPADVEQVAREIVDLAKKMGVQVRGPIPLPTRRLIVTVRRAPSGQgYHTFDHWEMRISKRLIDI-EASERVLRRLMTIRVPDTVKIELQ 104
                 69**********************************************************************.*********************986 PP

>> PF00298  Ribosomal protein L11, RNA binding domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   11.2   0.0   0.00071       2.1      47      69 .]      17      39 ..       9      39 .. 0.89

  Alignments for each domain:
  == domain 1    score: 11.2 bits;  conditional E-value: 0.00071
                SS-SHHHHHHTT---TTT----E CS
     PF00298 47 naldleaavksiiGtArsmGikV 69
                n  d+e++ ++i+  A+ mG++V
  AAL64528.1 17 NPADVEQVAREIVDLAKKMGVQV 39
                7789*****************98 PP

>> PF02399  Origin of replication binding protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.9   0.0    0.0007       2.1       7      62 ..       8      63 ..       2      68 .. 0.88

  Alignments for each domain:
  == domain 1    score: 8.9 bits;  conditional E-value: 0.0007
     PF02399  7 sLarelyGedLievvaknrpgvtverQsdgpvtfpsplasrarrvlvvRApmGSGK 62
                ++   lyG++ ++v +  r  v + +  + +v+ p pl +r+  v+v RAp G G 
  AAL64528.1  8 KVRIRLYGTNPADVEQVAREIVDLAKKMGVQVRGPIPLPTRRLIVTVRRAPSGQGY 63
                55668********998889999****************99999**********996 PP

>> PF09476  Pilus biogenesis CpaD protein (pilus_cpaD)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    9.4   0.0    0.0015       4.3      72     110 ..       4      40 ..       1      46 [. 0.84

  Alignments for each domain:
  == domain 1    score: 9.4 bits;  conditional E-value: 0.0015
     PF09476  72 rgagalvievpsgssnaraaealaaevrallaaaGvpaa 110
                 ++++++ i       n + +e++a+e+ +l++++Gv+++
  AAL64528.1   4 ASRRKVRIRLYG--TNPADVEQVAREIVDLAKKMGVQVR 40 
                 567778888877..58999*****************987 PP

>> PF03020  LEM domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.6   0.0     0.003       8.9      16      32 ..      33      50 ..      20      51 .. 0.90

  Alignments for each domain:
  == domain 1    score: 8.6 bits;  conditional E-value: 0.003
                CCTT---.------CHHH CS
     PF03020 16 rkyGisp.GPitgtTRkL 32
                +k G+ + GPi   TR+L
  AAL64528.1 33 KKMGVQVrGPIPLPTRRL 50
                899**************9 PP

>> PF01985  CRS1 / YhbY (CRM) domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.5   0.0    0.0043        13      39      77 ..       3      41 ..       1      44 [. 0.90

  Alignments for each domain:
  == domain 1    score: 8.5 bits;  conditional E-value: 0.0043
     PF01985 39 lekheLvKvkvkrnsreerkevaeeLaektgaelvqvig 77
                l ++  v++++ ++++ ++++va+e+ ++ +   vqv+g
  AAL64528.1  3 LASRRKVRIRLYGTNPADVEQVAREIVDLAKKMGVQVRG 41
                6677889**********************9999999998 PP

>> PF03808  Glycosyl transferase WecB/TagA/CpsF family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.0   0.0    0.0077        23      42      72 ..       2      32 ..       1      46 [. 0.83

  Alignments for each domain:
  == domain 1    score: 7.0 bits;  conditional E-value: 0.0077
     PF03808 42 eaaaekglrvfllGakeevlekaaerlkary 72
                + a+++++r+ l+G++++ +e++a+++ +  
  AAL64528.1  2 SLASRRKVRIRLYGTNPADVEQVAREIVDLA 32
                6789999*****************9986654 PP

>> PF01264  Chorismate synthase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.3   0.0    0.0062        18     204     236 ..      52      84 ..      12      87 .. 0.86

  Alignments for each domain:
  == domain 1    score: 6.3 bits;  conditional E-value: 0.0062
                 EEEBS--------SGG-----HHHHHHTSTTB- CS
     PF01264 204 vvaegvpaglGepvfdkLdaklakalmsinAvk 236
                 v+++  p g G ++fd+ + +++k l+ i+A  
  AAL64528.1  52 VTVRRAPSGQGYHTFDHWEMRISKRLIDIEASE 84 
                 78999*************************975 PP

>> PF07544  RNA polymerase II transcription mediator complex subunit 9
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.5   0.0     0.014        42      39      62 ..      67      90 ..      64      94 .. 0.91

  Alignments for each domain:
  == domain 1    score: 6.5 bits;  conditional E-value: 0.014
     PF07544 39 eEqedileekesqleeKrdllrkL 62
                + +e ++ ++   +e+++++lr+L
  AAL64528.1 67 DHWEMRISKRLIDIEASERVLRRL 90
                78*********************9 PP

>> PF01972  Serine dehydrogenase proteinase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.1   0.1     0.018        54      71      96 ..      76     103 ..      69     106 .] 0.74

  Alignments for each domain:
  == domain 1    score: 5.1 bits;  conditional E-value: 0.018
     PF01972  71 kfitiedseevlrairl..tpkdkpidl 96 
                 ++i+ie se+vlr + +   p+   i+l
  AAL64528.1  76 RLIDIEASERVLRRLMTirVPDTVKIEL 103
                 79**********9764311466666655 PP

>> PF08546  Ketopantoate reductase PanE/ApbA C terminal
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.8   0.0     0.029        85      91     111 ..      19      39 ..      14      57 .. 0.72

  Alignments for each domain:
  == domain 1    score: 5.8 bits;  conditional E-value: 0.029
     PF08546  91 tEidyinGyvvklakklgvet 111
                  +++    ++v+lakk+gv++
  AAL64528.1  19 ADVEQVAREIVDLAKKMGVQV 39 
                 566667777777777777764 PP

>> PF00258  Flavodoxin
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.9   0.0     0.026        76       2      26 ..      13      37 ..      13      41 .. 0.87

  Alignments for each domain:
  == domain 1    score: 5.9 bits;  conditional E-value: 0.026
                EEE-----HHHHHHHHHHHHHHHCC CS
     PF00258  2 lYgSetGnteklAkalaeglgehgf 26
                lYg++   +e++A+++ + +++ g 
  AAL64528.1 13 LYGTNPADVEQVAREIVDLAKKMGV 37
                79******************98664 PP

>> PF08769  Sporulation initiation factor Spo0A C terminal
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.6   0.0      0.03        89      48      72 ..      12      36 ..       9      40 .. 0.89

  Alignments for each domain:
  == domain 1    score: 5.6 bits;  conditional E-value: 0.03
     PF08769 48 kkyettpsrvEraIRhaievaltkg 72
                + y t p  vE+  R+ +++a + g
  AAL64528.1 12 RLYGTNPADVEQVAREIVDLAKKMG 36
                679*****************98766 PP

>> PF01706  FliG C-terminal domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.6   0.0     0.034     1e+02      83     101 ..      17      35 ..       3      43 .. 0.89

  Alignments for each domain:
  == domain 1    score: 5.6 bits;  conditional E-value: 0.034
     PF01706  83 klsdveaaqkeivatvrel 101
                 +++dve+  +eiv++++++
  AAL64528.1  17 NPADVEQVAREIVDLAKKM 35 
                 789**************98 PP

>> PF09475  Dot/Icm secretion system protein (dot_icm_IcmQ)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.9   0.0      0.03        89      62      92 ..       5      35 ..       2      43 .. 0.91

  Alignments for each domain:
  == domain 1    score: 4.9 bits;  conditional E-value: 0.03
     PF09475 62 gqqevfisLYsseGsnlqsWerilanLprqm 92
                 +++v i LY ++  ++++ +r + +L ++m
  AAL64528.1  5 SRRKVRIRLYGTNPADVEQVAREIVDLAKKM 35
                578999*********************9998 PP

>> PF04760  Translation initiation factor IF-2, N-terminal region
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.6   0.0     0.056   1.7e+02       8      17 ..      30      39 ..      20      41 .. 0.86

  Alignments for each domain:
  == domain 1    score: 4.6 bits;  conditional E-value: 0.056
     PF04760  8 eLAkelgvks 17
                +LAk++gv +
  AAL64528.1 30 DLAKKMGVQV 39
                8999999975 PP

>> PF11020  Protein of unknown function (DUF2610)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.2   0.0     0.048   1.4e+02      44      68 ..      15      39 ..       9      43 .. 0.91

  Alignments for each domain:
  == domain 1    score: 5.2 bits;  conditional E-value: 0.048
     PF11020 44 GtiPekvkdsleklkelakkngvsl 68
                Gt P++v +  +++++lakk gv +
  AAL64528.1 15 GTNPADVEQVAREIVDLAKKMGVQV 39
                788******************9976 PP

>> PF07498  Rho termination factor, N-terminal domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.7   0.0     0.055   1.6e+02       7      19 ..      25      37 ..      22      41 .. 0.87

  Alignments for each domain:
  == domain 1    score: 4.7 bits;  conditional E-value: 0.055
     PF07498  7 leeLreiAkelgi 19
                ++e +++Ak++g+
  AAL64528.1 25 AREIVDLAKKMGV 37
                5799********9 PP

>> PF10767  Protein of unknown function (DUF2593)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.5   0.0     0.059   1.7e+02     105     130 ..      78     103 ..      72     106 .] 0.85

  Alignments for each domain:
  == domain 1    score: 4.5 bits;  conditional E-value: 0.059
     PF10767 105 ieGeskaeilhslllqklpdllvlal 130
                 i+ e+++ +l++l+  ++pd + + l
  AAL64528.1  78 IDIEASERVLRRLMTIRVPDTVKIEL 103
                 55678899************998877 PP

>> PF09359  VTC domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.6   0.0     0.064   1.9e+02      73      90 ..       5      22 ..       2      35 .. 0.80

  Alignments for each domain:
  == domain 1    score: 3.6 bits;  conditional E-value: 0.064
                T--EEEEEE---GGG-.- CS
     PF09359 73 gaekiRlRwygkndnedk 90
                +++k+R+R yg n  + +
  AAL64528.1  5 SRRKVRIRLYGTNPADVE 22
                799********9988733 PP

>> PF11867  Domain of unknown function (DUF3387)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.5   0.0     0.063   1.9e+02     207     231 ..      11      35 ..       2      40 .. 0.83

  Alignments for each domain:
  == domain 1    score: 3.5 bits;  conditional E-value: 0.063
     PF11867 207 lekYhnraittaevieeLiklakei 231
                 ++ Y  +  ++++v +e+++lak++
  AAL64528.1  11 IRLYGTNPADVEQVAREIVDLAKKM 35 
                 7788899999999999999999998 PP

>> PF02944  BESS motif
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.2   0.0      0.14   4.1e+02      18      30 ..       1      13 [.       1      15 [. 0.88

  Alignments for each domain:
  == domain 1    score: 3.2 bits;  conditional E-value: 0.14
     PF02944 18 LsprqklkfKiei 30
                +s   ++k++i+ 
  AAL64528.1  1 MSLASRRKVRIRL 13
                89999******96 PP

>> PF01633  Choline/ethanolamine kinase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.5   0.0       0.1     3e+02       2      26 ..       6      30 ..       5      39 .. 0.87

  Alignments for each domain:
  == domain 1    score: 3.5 bits;  conditional E-value: 0.1
                -SEEEEEEE-S-.--HHHHHHHHHH CS
     PF01633  2 pekvllRiygkgteelidretEsvv 26
                ++kv +R+yg +  +++++ +E+v 
  AAL64528.1  6 RRKVRIRLYGTNPADVEQVAREIVD 30
                6899**********9*999999875 PP

>> PF10522  RII binding domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.9   0.0      0.19   5.6e+02       2      12 ..      21      31 ..      20      35 .. 0.87

  Alignments for each domain:
  == domain 1    score: 3.9 bits;  conditional E-value: 0.19
     PF10522  2 leevAarlVsn 12
                +e+vA+ +V++
  AAL64528.1 21 VEQVAREIVDL 31
                79*******87 PP

>> PF01075  Glycosyltransferase family 9 (heptosyltransferase)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.3   0.0     0.089   2.6e+02     133     171 ..       4      42 ..       1      54 [. 0.82

  Alignments for each domain:
  == domain 1    score: 3.3 bits;  conditional E-value: 0.089
                 HHH---EEEE---GGGS--TTGGGS-HHHHTTEEE---- CS
     PF01075 133 lqergiqvvllggaedreeeiakrlaaglreksvnllgk 171
                 +++r ++++l g ++++ e+ a+++++ +++  v++ g+
  AAL64528.1   4 ASRRKVRIRLYGTNPADVEQVAREIVDLAKKMGVQVRGP 42 
                 567889**********99999999999988777776665 PP

>> PF00586  AIR synthase related protein, N-terminal domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.1   0.0      0.12   3.5e+02      68      91 ..      16      39 ..       8      41 .. 0.87

  Alignments for each domain:
  == domain 1    score: 4.1 bits;  conditional E-value: 0.12
                SBHHHHHHHH---HHHHHHCT-EE CS
     PF00586 68 ldpeeleeiveGladacnefgvpl 91
                ++p+++e++++ + d ++++gv++
  AAL64528.1 16 TNPADVEQVAREIVDLAKKMGVQV 39
                67899*****************98 PP

>> PF09754  PAC2 family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.4   0.0      0.13   3.8e+02      82     100 ..      20      38 ..      10      39 .. 0.86

  Alignments for each domain:
  == domain 1    score: 3.4 bits;  conditional E-value: 0.13
                 GHHHHHHHHHHHHHH---- CS
     PF09754  82 rwrefaeeildlaeelgvs 100
                   +++a+ei+dla+++gv+
  AAL64528.1  20 DVEQVAREIVDLAKKMGVQ 38 
                 568999***********97 PP

>> PF02022  Integrase Zinc binding domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.1   0.1      0.14   4.1e+02      24      30 ..      23      29 ..      22      31 .. 0.88

  Alignments for each domain:
  == domain 1    score: 3.1 bits;  conditional E-value: 0.14
     PF02022 24 lvAkeIV 30
                +vA+eIV
  AAL64528.1 23 QVAREIV 29
                7*****9 PP

>> PF07621  Protein of unknown function (DUF1582)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.5   0.0      0.36   1.1e+03       6      14 ..      42      50 ..      41      54 .. 0.90

  Alignments for each domain:
  == domain 1    score: 2.5 bits;  conditional E-value: 0.36
     PF07621  6 PaflleaRl 14
                P +l+++Rl
  AAL64528.1 42 PIPLPTRRL 50
                779*****8 PP

>> PF00331  Glycosyl hydrolase family 10
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.5   0.0      0.27   7.9e+02      61      77 ..      25      41 ..      20      42 .. 0.92

  Alignments for each domain:
  == domain 1    score: 1.5 bits;  conditional E-value: 0.27
                HHHHHHHHHHTT-EEEE CS
     PF00331 61 adeivdfakengikvrg 77
                a eivd+ak+ g++vrg
  AAL64528.1 25 AREIVDLAKKMGVQVRG 41
                899*************9 PP

>> PF05802  Enterobacterial EspB protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.0   0.0      0.35     1e+03     294     314 ..      20      40 ..      10      41 .. 0.86

  Alignments for each domain:
  == domain 1    score: 1.0 bits;  conditional E-value: 0.35
     PF05802 294 dltaaardlldlqnrmGqsar 314
                 d+   ar++ dl  +mG  +r
  AAL64528.1  20 DVEQVAREIVDLAKKMGVQVR 40 
                 788899999999999998776 PP

>> PF12332  Bacterial methyl-accepting chemotaxis protein N terminal
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.6   0.3       1.3   3.8e+03       5      10 ..      73      78 ..      73      78 .. 0.94

  Alignments for each domain:
  == domain 1    score: 0.6 bits;  conditional E-value: 1.3
     PF12332  5 LkkKLi 10
                ++k+Li
  AAL64528.1 73 ISKRLI 78
                8****9 PP

>> PF08249  Mastoparan protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.5   0.1       1.3   3.8e+03       9      13 ..      31      35 ..      28      35 .. 0.90

  Alignments for each domain:
  == domain 1    score: 1.5 bits;  conditional E-value: 1.3
                CCCCC CS
     PF08249  9 lAKKi 13
                lAKK+
  AAL64528.1 31 LAKKM 35
                8***9 PP

>> PF08256  Aurein-like antibiotic peptide
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.6   0.1      0.24     7e+02       2       8 ..      28      34 ..      28      35 .. 0.93

  Alignments for each domain:
  == domain 1    score: 3.6 bits;  conditional E-value: 0.24
     PF08256  2 lfDiaKK 8 
                ++D aKK
  AAL64528.1 28 IVDLAKK 34
                89****9 PP



Internal pipeline statistics summary:
-------------------------------------
Query sequence(s):                         1  (106 residues)
Target model(s):                       11912  (2158902 nodes)
Passed MSV filter:                       310  (0.0260242); expected 238.2 (0.02)
Passed bias filter:                      298  (0.0250168); expected 238.2 (0.02)
Passed Vit filter:                        35  (0.00293821); expected 11.9 (0.001)
Passed Fwd filter:                        35  (0.00293821); expected 0.1 (1e-05)
Initial search space (Z):             100000  [as set by --Z on cmdline]
Domain search space  (domZ):              34  [number of targets reported over threshold]
# CPU time: 0.14u 0.04s 00:00:00.18 Elapsed: 00:00:00
# Mc/sec: 1634.60
//