hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /home/genome/SCOP/1.73/Scop1.73.bin
Sequence file:            /home/genome/FASTA/gib_20636.fasta
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: AAL62997.1
Accession:      [none]
Description:    paer1 AAL62997.1 GIB00076CH01 "RNA binding protein (fmu, PCNA P120 homolog), pr.."

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
0049442  S-adenosyl-L-methionine-dependent methyltran   131.7      2e-39   1
0047465  S-adenosyl-L-methionine-dependent methyltran   126.9    6.5e-38   1
0051944  S-adenosyl-L-methionine-dependent methyltran   115.1    1.2e-35   1
0051823  S-adenosyl-L-methionine-dependent methyltran    84.9    2.5e-26   1
0051930  S-adenosyl-L-methionine-dependent methyltran    71.7    1.9e-21   1
0050745  S-adenosyl-L-methionine-dependent methyltran    54.9    1.8e-17   1
0051810  PUA domain-like                                 54.3      3e-15   1
0051261  S-adenosyl-L-methionine-dependent methyltran    50.3    3.9e-15   1
0039128  PUA domain-like                                 57.5    6.9e-15   1
0043106  PUA domain-like                                 53.2    4.2e-14   1
0052541  PUA domain-like                                 50.3    1.1e-13   1
0046568  S-adenosyl-L-methionine-dependent methyltran    43.3    2.3e-13   1
0042644  PUA domain-like                                 48.4    2.8e-13   1
0049532  S-adenosyl-L-methionine-dependent methyltran    33.8    1.3e-11   1
0048490  S-adenosyl-L-methionine-dependent methyltran    36.6    9.3e-11   1
0052338  PUA domain-like                                 38.1    1.9e-10   1
0052649  S-adenosyl-L-methionine-dependent methyltran    34.6    3.5e-10   1
0047923  S-adenosyl-L-methionine-dependent methyltran    34.9    4.1e-10   1
0037982  S-adenosyl-L-methionine-dependent methyltran    35.3    6.7e-10   1
0044550  S-adenosyl-L-methionine-dependent methyltran    34.9    1.5e-09   1
0047945  S-adenosyl-L-methionine-dependent methyltran    30.5    1.9e-09   1
0040829  S-adenosyl-L-methionine-dependent methyltran    34.1    3.7e-09   1
0049549  PUA domain-like                                 29.6    4.9e-09   1
0041580  S-adenosyl-L-methionine-dependent methyltran    29.8    4.9e-09   1
0049122  S-adenosyl-L-methionine-dependent methyltran    29.2    5.3e-09   1
0052749  S-adenosyl-L-methionine-dependent methyltran    30.6    8.7e-09   1
0046744  S-adenosyl-L-methionine-dependent methyltran    29.7    1.2e-08   1
0050519  S-adenosyl-L-methionine-dependent methyltran    30.7    1.6e-08   1
0046354  S-adenosyl-L-methionine-dependent methyltran    29.4    1.8e-08   1
0048805  S-adenosyl-L-methionine-dependent methyltran    28.5    2.2e-08   1
0051884  S-adenosyl-L-methionine-dependent methyltran    30.4    2.4e-08   1
0052618  S-adenosyl-L-methionine-dependent methyltran    24.5    3.5e-08   1
0048438  S-adenosyl-L-methionine-dependent methyltran    27.8    6.2e-08   1
0053110  S-adenosyl-L-methionine-dependent methyltran    27.4    6.6e-08   1
0053107  S-adenosyl-L-methionine-dependent methyltran    24.2      1e-07   1
0051449  S-adenosyl-L-methionine-dependent methyltran    26.8      1e-07   1
0049474  S-adenosyl-L-methionine-dependent methyltran    25.5    1.2e-07   1
0051103  S-adenosyl-L-methionine-dependent methyltran    27.1    1.5e-07   1
0050693  S-adenosyl-L-methionine-dependent methyltran    26.8      2e-07   1
0050154  S-adenosyl-L-methionine-dependent methyltran    26.9    2.4e-07   1
0046931  S-adenosyl-L-methionine-dependent methyltran    26.8    2.6e-07   1
0042682  S-adenosyl-L-methionine-dependent methyltran    24.4    2.9e-07   1
0050234  S-adenosyl-L-methionine-dependent methyltran    23.3    4.9e-07   1
0049915  S-adenosyl-L-methionine-dependent methyltran    24.4      5e-07   1
0052693  S-adenosyl-L-methionine-dependent methyltran    26.4    5.3e-07   1
0051885  S-adenosyl-L-methionine-dependent methyltran    24.2    8.1e-07   1
0049671  S-adenosyl-L-methionine-dependent methyltran    22.2    1.8e-06   1
0047386  S-adenosyl-L-methionine-dependent methyltran    21.5    1.8e-06   1
0050988  S-adenosyl-L-methionine-dependent methyltran    21.7    1.9e-06   1
0051143  S-adenosyl-L-methionine-dependent methyltran    23.0    2.9e-06   1
0050749  S-adenosyl-L-methionine-dependent methyltran    22.2    5.5e-06   1
0053087  S-adenosyl-L-methionine-dependent methyltran    25.5    7.2e-06   1
0052807  S-adenosyl-L-methionine-dependent methyltran    20.1    7.9e-06   1
0046696  S-adenosyl-L-methionine-dependent methyltran    20.1    8.1e-06   1
0047329  S-adenosyl-L-methionine-dependent methyltran    19.6      1e-05   1
0049074  S-adenosyl-L-methionine-dependent methyltran    19.9    1.1e-05   1
0043085  S-adenosyl-L-methionine-dependent methyltran    20.6    1.3e-05   1
0044689  S-adenosyl-L-methionine-dependent methyltran    20.9    1.5e-05   1
0050919  S-adenosyl-L-methionine-dependent methyltran    20.5    1.6e-05   1
0047471  S-adenosyl-L-methionine-dependent methyltran    19.0    1.6e-05   1
0047580  S-adenosyl-L-methionine-dependent methyltran    20.6    1.6e-05   1
0051657  S-adenosyl-L-methionine-dependent methyltran    20.1    2.4e-05   1
0051840  S-adenosyl-L-methionine-dependent methyltran    19.4    2.4e-05   1
0052182  S-adenosyl-L-methionine-dependent methyltran    19.7    4.2e-05   1
0047919  S-adenosyl-L-methionine-dependent methyltran    17.7    4.5e-05   1
0041326  S-adenosyl-L-methionine-dependent methyltran    19.7    4.7e-05   1
0036610  S-adenosyl-L-methionine-dependent methyltran    19.5    6.3e-05   1
0041444  S-adenosyl-L-methionine-dependent methyltran    18.2    7.3e-05   1
0045109  S-adenosyl-L-methionine-dependent methyltran    19.1     0.0001   1
0049885  S-adenosyl-L-methionine-dependent methyltran    16.2    0.00016   1
0048524  S-adenosyl-L-methionine-dependent methyltran    18.5    0.00025   1
0051617  S-adenosyl-L-methionine-dependent methyltran    16.1    0.00028   1
0050762  S-adenosyl-L-methionine-dependent methyltran    14.0    0.00032   1
0052739  S-adenosyl-L-methionine-dependent methyltran    15.5    0.00036   1
0041593  S-adenosyl-L-methionine-dependent methyltran    13.6    0.00061   1
0052510  S-adenosyl-L-methionine-dependent methyltran    15.0    0.00065   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
0047465    1/1       6   375 ..     1   313 []   126.9  6.5e-38
0049442    1/1       8   374 ..     1   284 []   131.7    2e-39
0051930    1/1       8   371 ..     1   317 []    71.7  1.9e-21
0050745    1/1       9   358 ..     1   318 []    54.9  1.8e-17
0051823    1/1       9   378 ..     1   324 []    84.9  2.5e-26
0051261    1/1      28   373 ..     1   250 []    50.3  3.9e-15
0051944    1/1      36   375 ..     1   293 []   115.1  1.2e-35
0039128    1/1      87   162 ..     1    77 []    57.5  6.9e-15
0042644    1/1      87   172 ..     1    85 []    48.4  2.8e-13
0051810    1/1      87   161 ..     1    85 []    54.3    3e-15
0043106    1/1      88   161 ..     1    81 []    53.2  4.2e-14
0052338    1/1      88   169 ..     1    93 []    38.1  1.9e-10
0052541    1/1      88   161 ..     1    84 []    50.3  1.1e-13
0049549    1/1      89   160 ..     1    76 []    29.6  4.9e-09
0051884    1/1     116   337 ..     1   324 []    30.4  2.4e-08
0047329    1/1     124   275 ..     1   178 [.    19.6    1e-05
0047580    1/1     140   362 ..     1   215 []    20.6  1.6e-05
0052182    1/1     140   285 ..     1   214 []    19.7  4.2e-05
0037982    1/1     141   371 ..     1   227 []    35.3  6.7e-10
0041593    1/1     141   274 ..     1   328 []    13.6  0.00061
0044689    1/1     142   323 ..     1   224 []    20.9  1.5e-05
0050919    1/1     142   310 ..     1   152 [.    20.5  1.6e-05
0049885    1/1     144   375 ..     1   254 []    16.2  0.00016
0051840    1/1     144   255 ..     1   121 [.    19.4  2.4e-05
0036610    1/1     148   323 ..     1   194 []    19.5  6.3e-05
0046354    1/1     150   344 ..     1   213 []    29.4  1.8e-08
0050749    1/1     151   298 ..     1   161 [.    22.2  5.5e-06
0041326    1/1     152   344 ..     1   197 []    19.7  4.7e-05
0050693    1/1     154   288 ..     1   171 []    26.8    2e-07
0051657    1/1     154   275 ..     1   131 [.    20.1  2.4e-05
0048524    1/1     157   329 ..     1   249 []    18.5  0.00025
0046744    1/1     162   374 ..     1   230 []    29.7  1.2e-08
0053107    1/1     162   345 ..     1   183 []    24.2    1e-07
0053110    1/1     163   340 ..     1   309 []    27.4  6.6e-08
0052739    1/1     165   324 ..     1   183 []    15.5  0.00036
0049532    1/1     166   357 ..     1   274 []    33.8  1.3e-11
0052693    1/1     167   324 ..     1   182 []    26.4  5.3e-07
0045109    1/1     168   340 ..     1   245 []    19.1   0.0001
0050154    1/1     168   288 ..     1   127 [.    26.9  2.4e-07
0052618    1/1     169   310 ..     1   232 [.    24.5  3.5e-08
0047923    1/1     170   371 ..     1   186 []    34.9  4.1e-10
0047386    1/1     171   288 ..     1   133 [.    21.5  1.8e-06
0049671    1/1     171   339 ..     1   285 []    22.2  1.8e-06
0051449    1/1     171   326 ..     1   204 []    26.8    1e-07
0052649    1/1     171   299 ..     1   133 [.    34.6  3.5e-10
0049122    1/1     172   375 ..     1   289 []    29.2  5.3e-09
0051103    1/1     172   373 ..     1   254 []    27.1  1.5e-07
0052807    1/1     172   288 ..     1   128 [.    20.1  7.9e-06
0048490    1/1     173   373 ..     1   266 []    36.6  9.3e-11
0042682    1/1     176   325 ..     1   235 []    24.4  2.9e-07
0049474    1/1     176   374 ..     1   227 []    25.5  1.2e-07
0040829    1/1     177   375 ..     1   193 []    34.1  3.7e-09
0053087    1/1     178   310 ..     1   133 [.    25.5  7.2e-06
0048438    1/1     181   363 ..     1   209 []    27.8  6.2e-08
0049074    1/1     181   343 ..     1   256 []    19.9  1.1e-05
0051143    1/1     181   375 ..     1   234 []    23.0  2.9e-06
0051617    1/1     181   274 ..     1    95 [.    16.1  0.00028
0047919    1/1     183   288 ..     1   139 [.    17.7  4.5e-05
0052510    1/1     183   337 ..     1   152 []    15.0  0.00065
0050762    1/1     184   288 ..     1   131 [.    14.0  0.00032
0046931    1/1     185   343 ..     1   328 []    26.8  2.6e-07
0050234    1/1     185   339 ..     1   231 []    23.3  4.9e-07
0046568    1/1     195   365 ..     1   180 []    43.3  2.3e-13
0046696    1/1     196   378 ..     1   321 []    20.1  8.1e-06
0047471    1/1     196   327 ..     1   274 []    19.0  1.6e-05
0049915    1/1     196   375 ..     1   312 []    24.4    5e-07
0050988    1/1     196   288 ..     1   181 [.    21.7  1.9e-06
0051885    1/1     196   322 ..     1   312 []    24.2  8.1e-07
0047945    1/1     200   333 ..     1   261 []    30.5  1.9e-09
0041444    1/1     201   373 ..    38   245 .]    18.2  7.3e-05
0043085    1/1     201   338 ..    85   223 .]    20.6  1.3e-05
0044550    1/1     201   334 ..   217   358 .]    34.9  1.5e-09
0048805    1/1     201   372 ..    77   226 .]    28.5  2.2e-08
0050519    1/1     201   275 ..    23    95 ..    30.7  1.6e-08
0052749    1/1     201   354 ..   112   260 .]    30.6  8.7e-09
0041580    1/1     208   339 ..   122   271 .]    29.8  4.9e-09

Alignments of top-scoring domains:
0047465: domain 1 of 1, from 6 to 375: score 126.9, E = 6.5e-38
                   *->leddllplliryslpdwlvellldllge.eleallealllplpl.dl
                                   ++d+l++++l+ l ++e++ l++++ +p+p++++
  AAL62997.1     6    -----------IEIDDLLYKHFLEFLSDaEIDSLFRSITTPPPRyYI 41   

                   rvntlkisleellellekl...............................
                   rvntlkis++el+++l+++  +++ +++++++  + ++   ++ ++++++
  AAL62997.1    42 RVNTLKISPRELVKRLNSRglavyrdeyiddalwvpvegpfkiptakkvv 91   

                   ..................................................
                   ++++++++ ++  ++ ++ ++++++ +++ ++++++ ++  +++  ++++
  AAL62997.1    92 vvdkkaaesvmlgadlyapaviktdrvnigdevnivsdngrvvalgvavm 141  

                   ..gvvleaydllgdpleyllglre.fyslplfkdglvltqdavsellvel
                   + ++ l a++ l   +e  l +++++++lp + +gl+++q   + l+ ++
  AAL62997.1   142 dsDEALKARRGLYIKVEKSLYRTPkLRNLPEYAEGLFYSQSLPAILVGHI 191  

                   ldpkpgdrVLDlGcGsGglalalaklvgpagrvvavDispealelarena
                   ++       +Dl +++Gg++++la++ g   rv+avD+s++ +e +r  a
  AAL62997.1   192 ARRITQTDAVDLNSAPGGKTTHLAQM-G--IRVIAVDRSAQKIEKLRSEA 238  

                   krlgl.dnveviqgDaldl..pledgkfDlilsdpPysglgtirrdpdik
                   +rlgl+  ++++++D + l+ ++++ k  + l+dpP+++ g+   +p+i+
  AAL62997.1   239 ARLGLdVFIDILLHDSRYLdrDFPKIKAGVALVDPPCTDIGV---RPKIY 285  

                   prlalsgglellelqrelleealrlLkpgGrlvystcsllpeeneavvaa
                   ++ +  ++  l+++q ++l+ al++     +++ystc+l+++ene v+++
  AAL62997.1   286 HKVTFEAAKTLARYQIQFLKTALKIAP---YVIYSTCTLTYIENEGVIEK 332  

                   flkelgfelvplelllpgllrlaglelvlylegglrllPhlhgtdgfFva
                   + +e  +    +e  +pg+ +          + ++r+lPh+h+t gfF+a
  AAL62997.1   333 AGAE--IVDAGIEIGAPGWGC----------RECRRFLPHVHNTPGFFIA 370  

                   vlrkllpgllidrliqllg.eelealleallealp.lllrvntlkisldell
                      +++ll+++++++l+++e++ l++++ +++p +++rvntlkis++el+
  AAL62997.1     8    IDDLLYKHFLEFLSdAEIDSLFRSITTPPPrYYIRVNTLKISPRELV 54   

                   elleglgie.........................................
                   ++l ++g+ ++ +++++++  + ++   ++ ++++++++++++++ ++  
  AAL62997.1    55 KRLNSRGLAvyrdeyiddalwvpvegpfkiptakkvvvvdkkaaesvmlg 104  

                   ............................................lrllpl
                   ++ ++ ++++++ +++ ++++++ ++  +++  +++++ +++ ++r+  +
  AAL62997.1   105 adlyapaviktdrvnigdevnivsdngrvvalgvavmdsdealkARRGLY 154  

                   lplayilgerlefallpgfktglfltqrevsellaelldlkpgerVLDlg
                   + +   l  + +++ lp + +glf++q   + l+ ++++       +Dl 
  AAL62997.1   155 IKVEKSLYRTPKLRNLPEYAEGLFYSQSLPAILVGHIARRITQTDAVDLN 204  

                   cGtGgltlalaklvgaagvvavDispealelarenaelngl..nvefivg
                   +++Gg+t++la++  + +v+avD+s++ +e +r  a+++gl++ ++++++
  AAL62997.1   205 SAPGGKTTHLAQM--GIRVIAVDRSAQKIEKLRSEAARLGLdvFIDILLH 252  

                   DalellkllpdgkfDlillDPPysgsgtlrrvpdieprlalkglldllel
                   D + l++++p+ k+ + l+DPP+++ g+   +p+i ++ + ++  +l++ 
  AAL62997.1   253 DSRYLDRDFPKIKAGVALVDPPCTDIGV---RPKIYHKVTFEAAKTLARY 299  

                   qrrllelalrlLkpgGrlvystcsllpeeneavveaflekgpg..lelvd
                   q ++l+ al++     +++ystc+l+++ene v+e++ ++  ++ +e+  
  AAL62997.1   300 QIQFLKTALKIAP---YVIYSTCTLTYIENEGVIEKAGAEIVDagIEIGA 346  

                   llvllpgglrllPhldgtdgfFiavlrkvllslfaerlvealkllkklllkglvnayrlvlgegdllrglavdry
                                                                    +
  AAL62997.1     8    ----------------------------------------------I 8    

                   pdwlvvlllsalgeeelealleallellp..dlrvnllkisreeklllrr
                   +d l++++l+ l + e++ l++++  ++p + +rvn+lkis++e +++ +
  AAL62997.1     9 DDLLYKHFLEFLSDAEIDSLFRSITTPPPryYIRVNTLKISPRELVKRLN 58   

                   eeilpllpetlleeflglrfk.............................
                     +l + +++++ + l ++++   ++ ++++++++++++++ ++  ++ +
  AAL62997.1    59 SRGLAVYRDEYIDDALWVPVEgpfkiptakkvvvvdkkaaesvmlgadly 108  

                   ..................................................
                   + ++++++ +++ ++++++ ++  +++  +++++ +++ ++    +++++
  AAL62997.1   109 apaviktdrvnigdevnivsdngrvvalgvavmdsdealkarrglyikve 158  

                   ........vdpgvffqtglfptqelllelllell..kpgkrvLDlGcGtG
                   +  + + ++   + + +glf+ q l + l+ +++        +Dl +++G
  AAL62997.1   159 kslyrtpkLRNLPEYAEGLFYSQSLPAILVGHIArrITQTDAVDLNSAPG 208  

                   glalalaklgakkvtgvDispealelarenaklngleddnvefiqgDaed
                   g++ +la++g  +v++vD s++ +e +r  a+++gl+   ++++ +D + 
  AAL62997.1   209 GKTTHLAQMGI-RVIAVDRSAQKIEKLRSEAARLGLD-VFIDILLHDSRY 256  

                   llkelpfedgkfDlivsDPPysglgt......sgvlehlp.dleklleea
                   l +  +f++ k  + ++DPP+   g+  +++++ ++e+++++ +  ++ +
  AAL62997.1   257 LDR--DFPKIKAGVALVDPPCTDIGVrpkiyhKVTFEAAKtLARYQIQFL 304  

                   arlLkpGGrlvlstpsitlaedefeevirellekagfelveiilpdedfp
                   + +Lk   ++++st++ t+ e+e       ++ekag e+v++       p
  AAL62997.1   305 KTALKIAPYVIYSTCTLTYIENE------GVIEKAGAEIVDAGIEIG-AP 347  

                   g......tphvesvalldgfflalllvlllllllalnkalkllrdllrklglpayrlvlgegdllrglavd
                                                                     
  AAL62997.1     -    ----------------------------------------------- -    

                   rygdwlvvlllselgleelealleallellppidlrvnklkisreel...
                     +d l+ ++l+ l+++e++ l++++   +p +++rvn+lkis +el++ 
  AAL62997.1     9 --DDLLYKHFLEFLSDAEIDSLFRSITTPPPRYYIRVNTLKISPRELvkr 56   

                   ..................................................
                    +    +++ +++++++  + ++   ++ ++++++++++++++ ++  ++
  AAL62997.1    57 lnsrglavyrdeyiddalwvpvegpfkiptakkvvvvdkkaaesvmlgad 106  

                   ..................................................
                    ++ ++++++ +++ ++++++ ++  +++  +++++ +++ ++    +++
  AAL62997.1   107 lyapaviktdrvnigdevnivsdngrvvalgvavmdsdealkarrglyik 156  

                   ...gepvelllgelpeelyvqflglkfkvdpgvffrpgtellvelllell
                   ++++ +    l +lpe+ +++f++  +                + l+ ++
  AAL62997.1   157 vekSLYRTPKLRNLPEYAEGLFYSQSLP---------------AILVGHI 191  

                   dlk.pgkrvLDlGcGtGglalalarpgakvtgvDispealelarenakln
                   + ++     +Dl + +Gg++ +la+ g +v++vD s++ +e +r  a+++
  AAL62997.1   192 ARRiTQTDAVDLNSAPGGKTTHLAQMGIRVIAVDRSAQKIEKLRSEAARL 241  

                   gldn.vefiqgDaeeflpelpfedgkfDlivsDPPysgksesgvlehlpd
                   gld  ++++ +D + + +++p  + k  + ++DPP++    +gv + + +
  AAL62997.1   242 GLDVfIDILLHDSRYLDRDFP--KIKAGVALVDPPCTD---IGVRPKIYH 286  

                   .............leklleeaarlLkpGGrlvlstcsplplendlleevl
                   +++ +++++ + ++ ++l+ a+++     ++++stc+ ++ en+      
  AAL62997.1   287 kvtfeaaktlaryQIQFLKTALKIAP---YVIYSTCTLTYIENE------ 327  

                   ealleagfevelvelvdlpldfpgtphveevallkllvlgkaidcallaerlnkalellkdllkklevlrlilregdglpglavdrygd
                                                                   +d
  AAL62997.1     9    ---------------------------------------------DD 10   

                   wlvvlllealgeeeleelleallellp..elrvnllkisredlleellde
                    l + +le l ++e++ l++ +  ++p +++rvn+lkis+++l+++l ++
  AAL62997.1    11 LLYKHFLEFLSDAEIDSLFRSITTPPPryYIRVNTLKISPRELVKRLNSR 60   

                   lielllger.........................................
                   +  ++++e+++++  + ++   ++ ++++++++++++++ ++  ++ ++ 
  AAL62997.1    61 GLAVYRDEYiddalwvpvegpfkiptakkvvvvdkkaaesvmlgadlyap 110  

                   ...........................................dllgely
                   ++++++ +++ ++++++ ++  +++  +++++ +++ ++    ++ +e  
  AAL62997.1   111 aviktdrvnigdevnivsdngrvvalgvavmdsdealkarrglYIKVEKS 160  

                   englrflvdpdgfgtglfptqellaelllelld..pgkrvLDlGcGtGgl
                   ++  + l +++++  glf+ q l a l+ ++++ +     +Dl +++Gg 
  AAL62997.1   161 LYRTPKLRNLPEYAEGLFYSQSLPAILVGHIARriTQTDAVDLNSAPGGK 210  

                   alalaklgagrvtgvDispealelarenaalngldnrvefivgDaedllk
                   + +la++g  rv++vD s++ +e +r  aa++gld  ++++  D + l++
  AAL62997.1   211 TTHLAQMGI-RVIAVDRSAQKIEKLRSEAARLGLDVFIDILLHDSRYLDR 259  

                   ellkpdgsfDlivsDPPysgsgd..........sgvlehledleelleea
                   ++  p+ ++ + ++DPP++  g+  +++++++   +  +++ + ++l+ a
  AAL62997.1   260 DF--PKIKAGVALVDPPCTDIGVrpkiyhkvtfEAAKTLARYQIQFLKTA 307  

                   arlLkpGGrlvlvtcsplpeenefleevlealleagfeveliel.vdllg
                   +++     +++++tc+ +        e +  +++ag e++   ++++ +g
  AAL62997.1   308 LKIAP---YVIYSTCTLTYI------ENEGVIEKAGAEIVDAGIeIGAPG 348  

                   id.fpqtrhleevalldgff...lrvedaeellealnrklpltlrvntlkisreeilkhy.dlagkvydlfyivpr.
                       +      ++++++rvntlkis++e++k+++ +  +vy+  yi +  
  AAL62997.1    28    LFRSITTPPPRYYIRVNTLKISPRELVKRLnSRGLAVYRDEYIDDAl 74   

                   ..................................................
                    + ++   ++ ++++++++++++++ ++  ++ ++ ++++++ +++ +++
  AAL62997.1    75 wvpvegpfkiptakkvvvvdkkaaesvmlgadlyapaviktdrvnigdev 124  

                   ...........................gefllldptledsv.....lifk
                   +++ ++  +++  +++++ +++ ++  g+++  + +l   ++  + + + 
  AAL62997.1   125 nivsdngrvvalgvavmdsdealkarrGLYIKVEKSLYRTPklrnlPEYA 174  

                   rgteilqpadlalilellglkpgdrvLDiGcGsGgltlalarlvgpegrv
                   +g++++q   + l+ + ++       +D+ +++Gg+t++la++ g   rv
  AAL62997.1   175 EGLFYSQSLPAILVGHIARRITQTDAVDLNSAPGGKTTHLAQM-G--IRV 221  

                   tavDiseealelarenlerlglddnveviqgDaed...plpdgsfDaivs
                   +avD+s++ +e++r  ++rlgld  +++++ D +  + ++p+ ++ + ++
  AAL62997.1   222 IAVDRSAQKIEKLRSEAARLGLDVFIDILLHDSRYldrDFPKIKAGVALV 271  

                   dlpdpw........................elleelarlLkpGGrlvlst
                   d+p+ ++ +  +++++++ +++++ + +++++l+ ++++       v+++
  AAL62997.1   272 DPPCTDigvrpkiyhkvtfeaaktlaryqiQFLKTALKI----APYVIYS 317  

                   ptieqleellelleeaGfevveveellpryartletwlrplprrlghdgf
                    +  ++ e + ++e+aG e+v+     + +++ +++++r+lp+ +++ gf
  AAL62997.1   318 TCTLTYIENEGVIEKAGAEIVDAGIEIGAPGWGCRECRRFLPHVHNTPGF 367  

                   flaflrkwefylayslprwlvinllkllgeellealleallellplvlrvn..........
                      +   ++++n+lk+ + el+++l  + l ++++ +  ++  + ++   
  AAL62997.1    36    PPRYYIRVNTLKISPRELVKRLNSRGLAVYRDEYIDDalwvpvegpf 82   

                   ..................................................
                   ++ ++++++++++++++ ++  ++ ++ ++++++ +++ ++++++ ++  
  AAL62997.1    83 kiptakkvvvvdkkaaesvmlgadlyapaviktdrvnigdevnivsdngr 132  

                   .......ellaelgielerdelgppllyllggvefadlplyktgvfitqd
                   +++  ++ +   +  ++ r++++++   l++++++++lp+y +g+f++q+
  AAL62997.1   133 vvalgvaVMDSDEALKARRGLYIKVEKSLYRTPKLRNLPEYAEGLFYSQS 182  

                   easallaelldlkpgdrVLDlgaGsGgltlalaelvgpggrvvavDispe
                     + l+ ++++       +Dl +++Gg+t++la+    g rv+avD+s++
  AAL62997.1   183 LPAILVGHIARRITQTDAVDLNSAPGGKTTHLAQ---MGIRVIAVDRSAQ 229  

                   alelarenaerlgl.dnveviqgDaldlplldllggkfDvillDpPysgs
                    +e +r  a+rlgl+  ++++++D + l++  +++ k+ v l+DpP+++ 
  AAL62997.1   230 KIEKLRSEAARLGLdVFIDILLHDSRYLDRD-FPKIKAGVALVDPPCTDI 278  

                   gtlrrdpdvrwelslalkgladllalqrelleealrLkpgGrlvystcsl
                   g+   +p+++++ + +    ++l++ q ++l+ al+ +p  +++ystc+l
  AAL62997.1   279 GV---RPKIYHKVTFEA--AKTLARYQIQFLKTALKIAP--YVIYSTCTL 321  

                   lpeeneavvaaalerlpdlfelvdlrlllpdlpirllltlegglrllPhl
                   +++ene+v+++a +++ d          ++     ++++++ ++r+lPh+
  AAL62997.1   322 TYIENEGVIEKAGAEIVD----------AGIEIGAPGWGCRECRRFLPHV 361  

                   hgtdgfFvallrklplkrVvvddgaveailnGadlfapgvldadggiragdeVvvvtedge
                       +k+Vvvd+ a+e ++ Gadl+ap v++ d ++++gdeV +v+ +g+
  AAL62997.1    87    AKKVVVVDKKAAESVMLGADLYAPAVIKTD-RVNIGDEVNIVSDNGR 132  

                   llavGrallsgeellelkkgiavkvrrvlgllgrvvvddgaveallnGasLlapgvvsvdgdfkkgdvVavvsedge
                       +++vvvd+ a+e ++ Ga+L+ap v++ d ++  gd+V +vs +g+
  AAL62997.1    87    AKKVVVVDKKAAESVMLGADLYAPAVIKTD-RVNIGDEVNIVSDNGR 132  

                   liAvGlalmsseellkikggkaveilhvlgd..elwhrddplgrvvvddgavkavlkGasllapgvvsvdgdiekgdvVavvdekge
                       +++vvvd+ a++ v+ Ga+l+ap v++ d +++ gd+V +v+ +g+
  AAL62997.1    87    AKKVVVVDKKAAESVMLGADLYAPAVIKTD-RVNIGDEVNIVSDNGR 132  

                   llAvGlalmsseeilkikkgvaveilhvlgdrlwylrllgrvvvddgaveailnGasllapgilsvdgfkkgdvvlvvsekgeli
                      ++ vvvd+ a+e ++ Ga+l+ap +++ d ++ gd+v +vs +g+++
  AAL62997.1    88    KKVVVVDKKAAESVMLGADLYAPAVIKTDRVNIGDEVNIVSDNGRVV 134  

                   AvGlallsseellllkggiaveivlllgdlylellgrlvvddgAvkallggasLlapGvvsvegdfekgdvvavvdeggel
                      ++++vvd+ A++ ++ ga+L+ap v++ + +++ gd v +v+ +g+ 
  AAL62997.1    88    KKVVVVDKKAAESVMLGADLYAPAVIKTD-RVNIGDEVNIVSDNGR- 132  

                   lvAvGlalysseellkilglkskgiavilghllgdelwhrdnlvlllgrvvvddgavkallsGasllapGvvsvdgdfergdvVavvdedgel
                      +++vvvd+ a++ ++ Ga+l+ap v++ d +++ gd+V +v+ +g++
  AAL62997.1    88    KKVVVVDKKAAESVMLGADLYAPAVIKTD-RVNIGDEVNIVSDNGRV 133  

                   lAvGlalysseeilkikggvaveilhvlgdllwellikkvvvkdgaekallyGnnllkaGilrisediekgdgvvvlslkdepl
                      k vvv+++a ++++ G++l+++ +++ +  ++ gd v ++s +++++
  AAL62997.1    89    KVVVVDKKAAESVMLGADLYAPAVIKTDR-VNIGDEVNIVSDNGRVV 134  

                   GfGlaalsteelrkldpglvvvirqaDvGdlikegdlvllllsrgnlllvllkllneggvlntrygvlkhddligk
                      d +  gd v ++ ++g+++++ + ++++++ l  r+g +        
  AAL62997.1   116    DRVNIGDEVNIVSDNGRVVALGVAVMDSDEALKARRGLY-------- 154  

                   lygsfldsskgysvallrpapedltll.lkrgtqivqpkdialilelldl
                        + ++k++      ++p +++l+++ +g +++q   + l+ ++++ 
  AAL62997.1   155 -----IKVEKSL-----YRTPKLRNLPeYAEGLFYSQSLPAILVGHIARR 194  

                   kpGdrVLDiGtGsGgltlllarlvgpkGrVigvdiseemlelarenlkrl
                         +D+ + +Gg+t +la++ g   rVi+vd+s++ +e++r +++rl
  AAL62997.1   195 ITQTDAVDLNSAPGGKTTHLAQM-GI--RVIAVDRSAQKIEKLRSEAARL 241  

                   gldlhleklgyaldnvefilgdaeellkllpdgsfDavfldlpd......
                   gld            ++++l d + l+ ++p+ ++ ++++d+p++++ + 
  AAL62997.1   242 GLD----------VFIDILLHDSRYLDRDFPKIKAGVALVDPPCtdigvr 281  

                   ...............peealeellrvLkpGGrlvifvptieqverllefl
                    +++++++ +++++ ++  ++ l+ +Lk   +++++++t           
  AAL62997.1   282 pkiyhkvtfeaaktlARYQIQFLKTALKIAPYVIYSTCT----------- 320  

                   reagfpfgeievvelllrewevrfeiagdsasllylerfirldevlldlg
                         +++ie   ++++    +                           
  AAL62997.1   321 ------LTYIENEGVIEKAGAEI--------------------------- 337  

                   eagfrggliavlqltlllgevallllklvlrpetemvghtgyLtfarkl<
                                                                     
  AAL62997.1     - -------------------------------------------------  -    

                   -*
                     
  AAL62997.1     -    -    

0047329: domain 1 of 1, from 124 to 275: score 19.6, E = 1e-05
                   *->vkllkegdrvllelgrplmllellregglldtrlgiepledllgvpr
                      v+++ ++ rv++ +   +   e+l+++  l  ++       l++ p 
  AAL62997.1   124    VNIVSDNGRVVALGVAVMDSDEALKARRGLYIKV----EKSLYRTPK 166  

                   glfldlavgylvlilrpltedlveafgrgtqitqpavaalllellglkpG
                    + l+++++ l++                   +q   a l+ + ++    
  AAL62997.1   167 LRNLPEYAEGLFY-------------------SQSLPAILVGHIARRITQ 197  

                   arVLDlGcGtGaltlalaravgpggrvvavDispealelarenlaragla
                      +Dl + +G+ t +la+++    rv+avD+s++ +e +r  +ar+gl+
  AAL62997.1   198 TDAVDLNSAPGGKTTHLAQMG---IRVIAVDRSAQKIEKLRSEAARLGLD 244  

                   lpdnvevvvgDaedlp..lpdgsfDavvsdlpdmedleearkklvelllrnngilnlrvldalervprehfvpsllgyla
                       +d+ ea+k    l+++                      +  l +  
  AAL62997.1   140    VMDSDEALKARRGLYIKV---------------------EKSLYRTP 165  

                   fldlplafgegvlisqpellalllelldlkpgdrvLDiGcGtGylalala
                    l     + eg ++sq   + l+ ++++       +D+ + +G+ + +la
  AAL62997.1   166 KLRNLPEYAEGLFYSQSLPAILVGHIARRITQTDAVDLNSAPGGKTTHLA 215  

                   klvggrvtavdispealelarenaerlgl.dnvevilgdaeell..fedg
                   ++ g rv+avd+s++++e +r  a+rlgl+  ++++l d + l+ +f++ 
  AAL62997.1   216 QM-GIRVIAVDRSAQKIEKLRSEAARLGLdVFIDILLHDSRYLDrdFPKI 264  

                   sfDlvvsdapl......................phlleellrlLkpGGrl
                   ++ ++++d+p++++ +  +++++++ +++++ ++  ++ l+ +Lk   ++
  AAL62997.1   265 KAGVALVDPPCtdigvrpkiyhkvtfeaaktlaRYQIQFLKTALKIAPYV 314  

                   vlvvgtleg..........leellellkeagfevvevidpvgfvpltdgl
                   +++++tl  ++++ +++++ +e++++  e g     +++ ++f+p+++  
  AAL62997.1   315 IYSTCTLTYienegviekaGAEIVDAGIEIGAPGWGCRECRRFLPHVH-- 362  

                   elvditeeelleyvlrhs.fvpdpllllalrdealdvggglpilspekga
                       + ++e+l+++++ ++ v+  l++++      ++ +gl+ ++   + 
  AAL62997.1   140    VMDSDEALKARRGLYiKVEKSLYRTPKLRNLPEYAEGLFYSQSLPAI 186  

                   lllellrllpgkrvLdiGtGtGysalalaralppgarvvavdispealal
                   l+ +++r +     +d+ +  G+ + +la++   g rv+avd+s++ ++ 
  AAL62997.1   187 LVGHIARRITQTDAVDLNSAPGGKTTHLAQM---GIRVIAVDRSAQKIEK 233  

                   arenleaaGledrvtvilgdaedllpqllaplpdgkfDlifldaplehlp
                   +r  ++++Gl+  ++++l d + l +    ++p+ k  + ++d+p++ + 
  AAL62997.1   234 LRSEAARLGLDVFIDILLHDSRYLDR----DFPKIKAGVALVDPPCTDIG 279  

                   dllellealrlLkpGGvlvldnvllpgavddpealrellellredpglet
                      +++                                            
  AAL62997.1   280 VRPKIY-------------------------------------------- 285  

                   vilplgdgltlarkkglkmelveklkedgvivvedvldafrlvsknlflgervygegvvkpqdeg
                      m+  e lk  +    +   + +r+   +    ++ y eg++++q   
  AAL62997.1   141    MDSDEALKARRGLYIKVEKSLYRTPKLR---NLPEYAEGLFYSQSLP 184  

                   atiwaphrsrlaaklaeilelldlkpGdrVLDlGcGtGgltlhlaklvgp
                   a               ++ + ++       +Dl +++Gg+t+hla+++  
  AAL62997.1   185 A--------------ILVGHIARRITQTDAVDLNSAPGGKTTHLAQMG-I 219  

                   eGkvvgvDispemlelarenleklg...nvefilgDaeelpkyllpdgsf
                     +v++vD+s++ +e++r  +++lg ++ + ++l D + l++  +p  ++
  AAL62997.1   220 --RVIAVDRSAQKIEKLRSEAARLGldvFIDILLHDSRYLDRD-FPKIKA 266  

                   Dvilsdaplsh..................lpdealeealrvLkpGGrlvi
                    v+l+d+p+  + +  +++++++ +++++l++  ++ ++ +Lk   ++++
  AAL62997.1   267 GVALVDPPCTDigvrpkiyhkvtfeaaktLARYQIQFLKTALKIAPYVIY 316  

                   sdfsrsidspeeneevf........eellklgfegfkileplellprshe
                   s+++    +  ene v++++ ++++++  ++g +g+  +e ++ lp+ h+
  AAL62997.1   317 STCTL---TYIENEGVIekagaeivDAGIEIGAPGWGCRECRRFLPHVHN 363  

                   tygvgvrkkmevelmkilvtdpeelglvsklnekrlkaleeilsviqnvneellea
                                                                     
  AAL62997.1     -    ----------------------------------------------- -    

                   ilavlrrvllpsngkdfaeiaalydlyndsyesfyqlnagqallld.egm
                                 ++ + ++a+++ly  + +s+y+  +  +l+  +eg 
  AAL62997.1   141 -------------MDSDEALKARRGLYIKVEKSLYRTPKLRNLPEYaEGL 177  

                   lipraltemlldlvysltvpdarklnhyisfsdevygetspelvaelldl
                   +++++l  +l                                 v  ++++
  AAL62997.1   178 FYSQSLPAIL---------------------------------VGHIARR 194  

                   ldlkpgdvvlDiGcGtGglalalAkltgakhvyGieiseealelakenak
                   +  +     +D+ + +Gg + +lA++  + +v++++ s   +e  +  a+
  AAL62997.1   195 ITQT---DAVDLNSAPGGKTTHLAQM--GIRVIAVDRSAQKIEKLRSEAA 239  

                   enkkrlklfglgidnvefiqgdaeel..plpdlgekfDvivsnpplhipd
                   ++       gl+   +++++ d + l+ ++p+   k+ v++++pp     
  AAL62997.1   240 RL-------GLD-VFIDILLHDSRYLdrDFPK--IKAGVALVDPP----- 274  

                   leevlkeilrvLkpGGrivildpivplrfplnsrrledlfdilevkklef
                                                                     
  AAL62997.1     - -------------------------------------------------- -    

                   legsvswtgpegvfylstiprtlardllelagfvMveklirkhyildeevleaflkvprelfvpeplyslayfdglealkf
                       +++ ++++  l+ +v++ + ++p+   +pe+   l+y+  l a++ 
  AAL62997.1   142    DSDEALKARRGLYIKVEKSLYRTPKLRNLPEYAEGLFYSQSLPAILV 188  

                   lgqnflsapellalllelldlkpgkrVLDiGcGtGyltlllaklggkvtg
                   ++  + +++ +                +D+ + +G+ t +la++g +v++
  AAL62997.1   189 GHIARRITQTD---------------AVDLNSAPGGKTTHLAQMGIRVIA 223  

                   vDiseemlelarenlkeng...nvefivgDaeel..pfpdesfDlivsna
                   vD+s+  +e++r  ++++g ++ +++++ D + l+ +fp  +  ++++++
  AAL62997.1   224 VDRSAQKIEKLRSEAARLGldvFIDILLHDSRYLdrDFPKIKAGVALVDP 273  

                   plhhl......................leellrlLkpgGrlvlvdgnpeg
                   p+  + +  +++++++ +++++ + ++++ l+ +Lk   ++++++++ ++
  AAL62997.1   274 PCTDIgvrpkiyhkvtfeaaktlaryqIQFLKTALKIAPYVIYSTCTLTY 323  

                   elldkllkllllllkeelfevdfvpltdrfysleeleelleeaGfevvev
                                                                     
  AAL62997.1     - -------------------------------------------------- -    

                   eelrklleleedvrslfldyaelydgdnll..leelgdgvmraqeralmal
                      +  e  +  r l+ ++ ++++  + l +l+e+ +g+++ q  ++ ++
  AAL62997.1   142    DSDEALKARRGLYIKVEKSLYRTPKLrnLPEYAEGLFYSQSLPAILV 188  

                   lallglrpggrVLDvGcGtGglalalaeagpeevtgvDispemlerarer
                    + ++       +D+ + +Gg +++la++g  +v++vD s++ +e++r  
  AAL62997.1   189 GHIARRITQTDAVDLNSAPGGKTTHLAQMG-IRVIAVDRSAQKIEKLRSE 237  

                   aaelg..pnvrvlvgdaeellpplpdgsfDavlsDppgs...........
                   aa+lg +  +++l++d + l +++p  +  + l+Dpp++++ +  +++++
  AAL62997.1   238 AARLGldVFIDILLHDSRYLDRDFPKIKAGVALVDPPCTdigvrpkiyhk 287  

                   ..sevlhhvp.dleaflaeaarldarlllglllglslllleayldlvldeeelerllellerlaerypll
                                                        e+l++++  y ++
  AAL62997.1   144    ---------------------------------DEALKARRGLYIKV 157  

                   ksllselndrdweeaylkglrpfrgldflvipavldprpdgerlvldpgl
                   +  l++ ++     +y +gl +  +l+                       
  AAL62997.1   158 EKSLYRTPKLRNLPEYAEGLFYSQSLP----------------------- 184  

                   ffgtglhpttelllellakllkpgdrVLDlGcGtGtlaialaklgarvtg
                             + l+ ++a+        +Dl + +G+ + +la++g rv++
  AAL62997.1   185 ----------AILVGHIAR-RITQTDAVDLNSAPGGKTTHLAQMGIRVIA 223  

                   vDispealelArenaarngldn.vefvqgdaedlp....dgsfDlvvsnp
                   vD s++ +e +r  aar+gld  +++++ d + l+ +    ++ + +++p
  AAL62997.1   224 VDRSAQKIEKLRSEAARLGLDVfIDILLHDSRYLDrdfpKIKAGVALVDP 273  

                   pl..................ehlpd.llaeaarlLkpGGrlvlveinpe.
                   p++++ +  +++++++ +++  l ++ ++ ++ +Lk   ++++++++ ++
  AAL62997.1   274 PCtdigvrpkiyhkvtfeaaKTLARyQIQFLKTALKIAPYVIYSTCTLTy 323  

                   ........................................tleellelle
                   ++++ +++++ ++++++ +++ +      +      ++++t+  +++ l+
  AAL62997.1   324 ienegviekagaeivdagieigapgwgcrecrrflphvhnTPGFFIAVLR 373  

                   eaGfevveveeldgfpattlvkqvmlklikkqikeypqdklvripekaslyllvlealltglnllqrll
                      ++ lk  +++ +++ ++ + + +     +  + + +++ l ++   +
  AAL62997.1   144    DEALKARRGLYIKVEKSLYRTPKLRNLPEYAEGLFYSQSLPAILVGH 190  

                   aafllelldlfkgkrvLdiGaGtGllllalaellppgaevtgiDidpdal
                   +a  + ++d       +d+ + +G+ +++la+    g++v+++D++   +
  AAL62997.1   191 IARRITQTD------AVDLNSAPGGKTTHLAQM---GIRVIAVDRSAQKI 231  

                   evarknlkrlglpkrvrlvvgdalmserliklepekyillelkflglrfkvdpgvffptgldldtelllel
                        +r   +  ek ++ + k ++l+ +    +++++   l + l+ + 
  AAL62997.1   148    KARRGLYIKVEKSLYRTPKLRNLPEYAEGLFYSQS---LPAILVGHI 191  

                   ldlkkgkrvLDlGcGtGilaialakrgakvtgvDispealelakenakln
                   ++       +Dl +  G  + +la++g +v++vD s + +e ++  a+++
  AAL62997.1   192 ARRITQTDAVDLNSAPGGKTTHLAQMGIRVIAVDRSAQKIEKLRSEAARL 241  

                   gldnrkvefiqgdaed...plpdgkfDlivsnppyllgledlek......
                   gld   +++++ d +  + ++p+ k  + +++pp +  +++ +k++++++
  AAL62997.1   242 GLDVF-IDILLHDSRYldrDFPKIKAGVALVDPP-CTDIGVRPKiyhkvt 289  

                   ..........lleeaarlLkpgGilllstnprtlaeellelleeagfeve
                    +++++ + + ++ ++  Lk   ++++st++ t                 
  AAL62997.1   290 feaaktlaryQIQFLKTALKIAPYVIYSTCTLTY---------------- 323  

                   evkdldgfprtvhvenrenlvdnlaehydllnevleallkvprelflpevplrelayedeflp
                      r++l+ ++ +   +++++ +                           
  AAL62997.1   150    RRGLYIKVEKSLYRTPKLRN--------------------------- 169  

                   itlevgegllisqpetlalllellglkpgkrvLDiGcGtGylalalarlg
                     +e+ egl++sq   + l+ + ++       +D+ +++G+ + +la++g
  AAL62997.1   170 -LPEYAEGLFYSQSLPAILVGHIARRITQTDAVDLNSAPGGKTTHLAQMG 218  

                   gpdgrvvavDispealelarenaerlgl.dnvefilgdaedll..fedgs
                       rv+avD+s++ +e +r  a+rlgl+  ++++l d + l  +f+  +
  AAL62997.1   219 I---RVIAVDRSAQKIEKLRSEAARLGLdVFIDILLHDSRYLDrdFPKIK 265  

                   fDlvvsdapleh......................lleellrlLkpGGrlv
                   + ++++d+p+ ++ +  +++++++ +++++ + + ++ l+ +Lk   +++
  AAL62997.1   266 AGVALVDPPCTDigvrpkiyhkvtfeaaktlaryQIQFLKTALKIAPYVI 315  

                   lstilleg......leellelleeagfevvevelldvgfvpltdgleegeplriilgkleglklkldpgqa...fltprpvtellvdallelgl
                      +g ++++    ++  kl+  p  a+  f+ ++  + l+ +++     
  AAL62997.1   151    RGLYIKVEKSLYRTPKLRNLPEYAeglFYSQSLPAILVGHIA---RR 194  

                   lkgkrvlDlGaGtGalslalakrgakkvvavDidpealelarenaelngl
                   +     +Dl +  G+ + +la++g  +v+avD +++ +e +r  a+++gl
  AAL62997.1   195 ITQTDAVDLNSAPGGKTTHLAQMGI-RVIAVDRSAQKIEKLRSEAARLGL 243  

                   ..nveviqgdalelp....g.kfDlvvsNPPyiitskillklllklepel
                   ++ ++++  d + l+ +  ++k+ + + +PP+                  
  AAL62997.1   244 dvFIDILLHDSRYLDrdfpKiKAGVALVDPPC------------------ 275  

                   aldvledlldleelleaaarlLkprskrvpleyilgeadfyglpldvggafltprpitellleallelgll
                         ++ ++ +    + ++lp +  g f++ + ++ l+ + +     +
  AAL62997.1   152    GLYIKVEKSLYRTPKLRNLPEYAEGLFYSQSLPAILVGHIA---RRI 195  

                   kgkrvLDlGcGtGilaialaklGaakvtavDispealelarena.....g
                        +Dl + +G+ + +la++G  +v+avD s++ +e +r  a+    +
  AAL62997.1   196 TQTDAVDLNSAPGGKTTHLAQMGI-RVIAVDRSAQKIEKLRSEAarlglD 244  

                   .nvefivgdaeelp....g.kfDlivsNPPyvplsd.illlevldlepls
                   + ++++  d + l+ +  ++k+ +++++PP+ + ++  +++  + +e   
  AAL62997.1   245 vFIDILLHDSRYLDrdfpKiKAGVALVDPPCTDIGVrPKIYHKVTFEAAK 294  

                   allehlddleelleeaarlLkpgGrlvlstplptq......leellelle
                    l       +  ++ ++ +Lk   ++++st++ t+++++ ++e   + + 
  AAL62997.1   295 TL------ARYQIQFLKTALKIAPYVIYSTCTLTYienegvIEKAGAEIV 338  

                   kagfkvvvvlevhdyvvlllriiggkfrgrkllvpp.......gprptterlrealfnlllllll
                      ++++    +r  kl+  p++++   +    +++l+ ++++++ +   
  AAL62997.1   154    YIKVEKSLYRTPKLRNLPeyaeglfYSQSLPAILVGHIARRITQ--- 197  

                   eggrvLDlgaGsGalaleaasrgaevvavDidpeavalarenaerlglen
                        +Dl +  G+ + ++a++g +v+avD++++ ++ +r  a+rlgl+ 
  AAL62997.1   198 --TDAVDLNSAPGGKTTHLAQMGIRVIAVDRSAQKIEKLRSEAARLGLDV 245  

                   rveviqgdafellaalpgesfDlvvldPPygldglellllllaarllkpg
                    ++++  d + l + +p+ ++ ++++dPP+   g+ + ++  +       
  AAL62997.1   246 FIDILLHDSRYLDRDFPKIKAGVALVDPPCTDIGVRPKIYHKV------- 288  

                   gllvlehglelllpllllrrygltlllllrrpedevkelirsfydraadrydgqnrlleelgdgvmlaqerallrlla
                       +++ k+l r    r +++y+          +g+ + q  ++  + +
  AAL62997.1   154    YIKVEKSLYRTPKLRNLPEYA----------EGLFYSQSLPAILVGH 190  

                   llglrpggrvLdvGcGtGllalalaeagpaevtgvDispemlerareraa
                    ++       +d+ +++G+ + +la+ g  +v++vD s++ +e++r  aa
  AAL62997.1   191 IARRITQTDAVDLNSAPGGKTTHLAQMG-IRVIAVDRSAQKIEKLRSEAA 239  

                   eag..pnvrvlvgdaedllpplpdgsfDavlsDppsrayelplqyitgeldfsglelhvrgyvpaliprpltellaaallrll
                      + + l++   +  l+ +++ l++++  pa  +  +++++        
  AAL62997.1   157    VEKSLYRTPKLRNLPEYAEGLFYSQSLPAILVGHIARRITQT----- 198  

                   gldpgtvlDpgCGsGtllieaalaarrpaarviGvDidpaalelArrnla
                          +D+    G+ ++ +a ++     rvi+vD +++ +e  r  +a
  AAL62997.1   199 -----DAVDLNSAPGGKTTHLAQMGI----RVIAVDRSAQKIEKLRSEAA 239  

                   llgladllllesasellsslleklslldlllaldlleelllgelktlrve
                   +lgl+                                           ++
  AAL62997.1   240 RLGLDV-----------------------------------------FID 248  

                   vvqgDaldalalllplpdgsfDlvvtNPPYgerlgiegllpelryrepll
                   +++ D + ++     +p  ++++ + +PP+ +     ++  ++  +e + 
  AAL62997.1   249 ILLHDSRYLD---RDFPKIKAGVALVDPPCTDIGVRPKIYHKV-TFEAAK 294  

                   alkealpgwlvavltsdggldgldllraflrealrllkpgGrlvlelgng
                    l                      +l+  l+ a+++    ++l  +  +g
  AAL62997.1   295 TL----------------ARYQIQFLKTALKIAPYVIYSTCTLTYIENEG 328  

                   qgikrlvvllvlkglllsrlladalilvprhydlgedlygeelakvydd
                                                             ++ +    
  AAL62997.1   162    ---------------------------------------YRTPKLRN 169  

                   laafldglrsrqeallelllellglkpgkrvLDlGcGtGglalalakllg
                   l+ + +gl++ q + + l+ + ++       +Dl + +Gg + +la++ g
  AAL62997.1   170 LPEYAEGLFYSQSLPAILVGHIARRITQTDAVDLNSAPGGKTTHLAQM-G 218  

                   agrvtgvDispealelarenaa..glpn.vefivgDaedplpdlleegsf
                     rv++vD s++ +e++r  aa  gl+  ++++ +D +  l+  +++ ++
  AAL62997.1   219 I-RVIAVDRSAQKIEKLRSEAArlGLDVfIDILLHDSRY-LDRDFPKIKA 266  

                   Dlvvsdlphvpdp.....................ealleeaarlLkpGGr
                    ++++d+p+ + ++  +++++++ +++++ + ++ ++l+ a+++ +p  +
  AAL62997.1   267 GVALVDPPCTDIGvrpkiyhkvtfeaaktlaryqIQFLKTALKI-AP--Y 313  

                   lvlstpsrteeeleellegf....eellelleeaGfevvevvdllpgpgd
                   +++st++ t  e+e ++e+  +++ +    + + G+   e++++lp+ ++
  AAL62997.1   314 VIYSTCTLTYIENEGVIEKAgaeiVDAGIEIGAPGWGCRECRRFLPHVHN 363  

                   ilvvvllalkkGplriilgefrglklkvdpgvlirpttdrlrelllelladllkgkrv
                          + + ++r+l+ +  +  + +  + +l+ ++++++         
  AAL62997.1   162    ----YRTPKLRNLPEYAEGLFYSQSLPAILVGHIARRI----TQTDA 200  

                   LDlgcGtGglalalakrgakkvtgvDispealelarenaklngldednve
                   +Dl +  Gg + +la++g + v++vD s++ +e +r  a+++gl +  ++
  AAL62997.1   201 VDLNSAPGGKTTHLAQMGIR-VIAVDRSAQKIEKLRSEAARLGL-DVFID 248  

                   fiqgdaldflplllldekfDlivsnppy..............glegledl
                   ++  d +  l++ + + k  + +++pp++++ +  +++++++    +   
  AAL62997.1   249 ILLHDSRY-LDRDFPKIKAGVALVDPPCtdigvrpkiyhkvtFEAAKTLA 297  

                   ekllkea.rlLkpgGilvleinpetleellellkelglkllgivlvllfk
                   +  ++ ++  Lk   +++++++  t+ e   ++++ g ++++ ++ +   
  AAL62997.1   298 RYQIQFLkTALKIAPYVIYSTCTLTYIENEGVIEKAGAEIVDAGIEIG-- 345  

                   lfanrlnkalklrkkllkklgldayrlfdglpglvvdrygdvlviqvt
                       +++l+++ ++ + l+  ++l+                         
  AAL62997.1   163    RTPKLRNLPEYAEGLFYSQSLP------------------------- 184  

                   sagalklkdalvdalevkgiylkvnrrllglplrvllgelpetitveeng
                                                                     
  AAL62997.1     - -------------------------------------------------- -    

                   lkflvdpgsffqtglrpdtrllrealaaalaglakgkrvLDlgcGtGgls
                                            l+ ++a+ +     +Dl +  Gg +
  AAL62997.1   185 -----------------------AILVGHIARRITQTDAVDLNSAPGGKT 211  

                   laaakagaeVtgvDispealelareNaalngleddnvefiqgDafeflkr
                    ++a++g +V++vD s++ +e  r  aa++gl+   ++++ +D + + ++
  AAL62997.1   212 THLAQMGIRVIAVDRSAQKIEKLRSEAARLGLD-VFIDILLHDSRYLDRD 260  

                   lakegekfDliilDPPyfglgkk.........gevldglrdlrellelal
                   +  ++ k  + ++DPP+ ++g + +++++++  +   ++r+++++l++al
  AAL62997.1   261 F--PKIKAGVALVDPPCTDIGVRpkiyhkvtfEAAKTLARYQIQFLKTAL 308  

                   rllkpgGvlvlcnpatlardlelllelvlealkdagyrvekverltlgpd
                   ++ +p  ++ +c+  t   +  ++++        ag ++++         
  AAL62997.1   309 KI-APYVIYSTCTL-TYIENEGVIEK--------AGAEIVDA-------- 340  

                   hpvlqpvdmfpetahlevvvlypmriiagkfrgrkllv..ppglftrpttdrvreallnilapllpga
                        +r + +++ g+++ +  p+              l++ +a+++   
  AAL62997.1   165    PKLRNLPEYAEGLFYSQslPAI-------------LVGHIARRITQT 198  

                   rvLDlgaGsGalgleaasrgaarvtaveispealelarenaallgldn.v
                     +Dl +  G+ + ++a++   rv+av++s++ +e +r  aa+lgld  +
  AAL62997.1   199 DAVDLNSAPGGKTTHLAQM-GIRVIAVDRSAQKIEKLRSEAARLGLDVfI 247  

                   eviqgdaleflpel.gekfdliflDPPy...............agglldl
                    ++  d   + +++ + k  + ++DPP +++ +  +++++++  ++    
  AAL62997.1   248 DILLHDSRYLDRDFpKIKAGVALVDPPCtdigvrpkiyhkvtfEAAKTLA 297  

                   llllllalrllkpggllvvecnsetlardlleglellkvrkyglfpltlh
                   +  ++ ++  lk   ++++++++ t +                       
  AAL62997.1   298 RYQIQFLKTALKIAPYVIYSTCTLTYI----------------------- 324  

                   vevvvtigellrealalleeagldlldaelllllllgldrlrlllllllpls
                                                                     
  AAL62997.1     -    ----------------------------------------------- -    

                   vlelllllellerrllgepveyllgerefyglafkvgggvftprpttell
                                              + ++l+ +  g +++++   ++l
  AAL62997.1   166 ---------------------------KLRNLPEYAEGLFYSQSL-PAIL 187  

                   lelllellp.kpgkrvLDlGcGtGglalalakllpgarvtgvDispeale
                   + +++   +       +Dl + +Gg + +la++  g rv++vD s++ +e
  AAL62997.1   188 VGHIA---RrITQTDAVDLNSAPGGKTTHLAQM--GIRVIAVDRSAQKIE 232  

                   larenaalngl.dnvefvqgDald...plpdgsfDlivsNPPysgsgvlh
                    +r  aa++gl+  +++++ D +  + ++p+ ++ + +++PP+ ++gv  
  AAL62997.1   233 KLRSEAARLGLdVFIDILLHDSRYldrDFPKIKAGVALVDPPCTDIGVRP 282  

                   hlpdevrlepplalaggedgllvlealleeaarlLkpGGrlvlvtpsgel
                    + + v +e    l          +  ++ ++ +Lk   +++++t++ ++
  AAL62997.1   283 KIYHKVTFEAAKTL---------ARYQIQFLKTALKIAPYVIYSTCTLTY 323  

                   eellelleeagfelveilldla.gvdrvlllr.YlriiaGqfrgrkldvpdglitrpttdrvrealfnilapllegkrvLD
                      lr +   + g+++ +    i           l++++a+++     +D
  AAL62997.1   167    LRNLPEYAEGLFYSQSLPAI-----------LVGHIARRITQTDAVD 202  

                   lfaGsGalgleaasrgaakvvavdispealelakenaalnglenrvevir
                   l +  G+ + ++a++g  +v+avd+s++ +e ++  aa++gl+  ++++ 
  AAL62997.1   203 LNSAPGGKTTHLAQMGI-RVIAVDRSAQKIEKLRSEAARLGLDVFIDILL 251  

                   gdalellkallkegekfDlvvlDPPyfa...............glllyll
                   +d + l + +  ++ k  + ++DPP+  + +  +++++++ +++  l++ 
  AAL62997.1   252 HDSRYLDRDF--PKIKAGVALVDPPCTDigvrpkiyhkvtfeaAKTLARY 299  

                   llllalkllkpggllvvesnsdlllpdllkglvllkarkygrtvltllvl
                    +  ++  lk   ++++++++ +++                         
  AAL62997.1   300 QIQFLKTALKIAPYVIYSTCTLTYI------------------------- 324  

                   ddlakflgqnfltdpellelilellnlkpgdtvLDiGcGtGaltlal
                       +l+ +    f+++   + l+   ++       +D+ + +G+ t +l
  AAL62997.1   168    RNLPEYAEGLFYSQSLPAILVGHIARRITQTDAVDLNSAPGGKTTHL 214  

                   aklgpkvtgvdiseemlelakenlkeng...nvtfihgDalel..pfpdg
                   a++g +v++vd+s   +e+++  ++++g ++ +++++ D + l+ +fp+ 
  AAL62997.1   215 AQMGIRVIAVDRSAQKIEKLRSEAARLGldvFIDILLHDSRYLdrDFPKI 264  

                   kfDlivsNpPynistavlehlpdleelrrl..vlmlqleealrlLkpgGr
                   k+ + +++pP+   ++v +++  +  ++ ++++  +q++ ++ +Lk   +
  AAL62997.1   265 KAGVALVDPPCTD-IGVRPKIYHKVTFEAAktLARYQIQFLKTALKIAPY 313  

                   lvlvvgtledveillkvppgaffpppkvdsavvrltrrespllleiltle
                   ++ ++ tl+                                         
  AAL62997.1   314 VIYSTCTLT----------------------------------------- 322  

                   lrfvffvldeelllrlvkeafsqrrktllnslkklyspeeleelleeaGf
                                                        + e e ++e+aG 
  AAL62997.1   323 -------------------------------------YIENEGVIEKAGA 335  

                   evvevdvaeyfddiaavydgfaeglreaaeallelllellppgkrvLDiGcG
                             ++ + y +  +++   ++ l+ ++++++      +D+ + 
  AAL62997.1   168    -------RNLPEYAEGLFYSQSLPAILVGHIARRI-TQTDAVDLNSA 206  

                   tGglalalakrgarvtgvDispemlelareraaelgl..nvefvvgDaed
                   +Gg + +la+ g+rv++vD s++ +e++r  aa+lgl++ ++++  D + 
  AAL62997.1   207 PGGKTTHLAQMGIRVIAVDRSAQKIEKLRSEAARLGLdvFIDILLHDSRY 256  

                   lp..fpdgsfDlvvsnavlhhlpdedleallrellqeitedllellfnallllienlldgaldalleilpellgllflldl
                                                                     
  AAL62997.1     -    ----------------------------------------------- -    

                   llddellrelldllseidlseidydilgelyeyllgefagl.rfklgefy
                                                          +l  ++ g fy
  AAL62997.1   169 ---------------------------------------NLpEYAEGLFY 179  

                   tprpvtellvelllpklgdlkglrvLDpgCGsGgllialakrlpnaggae
                    +   + l+ +++++  +       +D+    Gg + +la++     g +
  AAL62997.1   180 SQSLPAILVGHIARRITQT----DAVDLNSAPGGKTTHLAQM-----GIR 220  

                   vtllGvDispealelArenlklngld..vefiqgDale..lplpdk.fDl
                   v+  +vD s++ +e  r  ++++gld+ +++++ D++  + ++p+ +  +
  AAL62997.1   221 VI--AVDRSAQKIEKLRSEAARLGLDvfIDILLHDSRYldRDFPKIkAGV 268  

                   ivsNPPyggsgvlehlpdevlafepg.ldgldllfleealrlefyddyalsfdeglrptqeellelllellglkpgkrvLDlGcGtGgl
                             + + egl+++q + + l+ ++++       +Dl + +Gg 
  AAL62997.1   170    ------LPEYAEGLFYSQSLPAILVGHIARRITQTDAVDLNSAPGGK 210  

                   alalaklgpkvtgvDispealelarenakelglddnvefivgDaedlp..
                   + +la++g +v++vD+s++ +e++r  a++lgld  +++++ D + l+ +
  AAL62997.1   211 TTHLAQMGIRVIAVDRSAQKIEKLRSEAARLGLDVFIDILLHDSRYLDrd 260  

                   lpdgsfDlivsdpplhhlpd...................llkellrlLkp
                   +p+ ++ + ++dpp+  ++   +++++++ +++++ + + ++ l+ +Lk 
  AAL62997.1   261 FPKIKAGVALVDPPCTDIGVrpkiyhkvtfeaaktlaryQIQFLKTALKI 310  

                   GGrlvlstpnpegleellellkklgf.lvelillyifpyvplvellrllg
                     ++++st++  ++ e   +++k+g ++v+       p++   e  r+l+
  AAL62997.1   311 APYVIYSTCTL-TYIENEGVIEKAGAeIVDAGIEIGAPGWGCRECRRFLP 359  

                   lldv.alikvglmelfdevaeryddfadglspgqdrllelllellaellkpgkrvLDiG
                                 +++a+gl++ q   + l+ ++++++       +D+ 
  AAL62997.1   171    -----------PEYAEGLFYSQSLPAILVGHIARRI--TQTDAVDLN 204  

                   cGtGglalalakllgepgarvtgvDispemlelareraaelglsdnvefv
                   + +Gg + +la++    g+rv++vD s++ +e++r  aa+lgl+  ++++
  AAL62997.1   205 SAPGGKTTHLAQM----GIRVIAVDRSAQKIEKLRSEAARLGLDVFIDIL 250  

                   vgDaedlp..lpd..fDlvvsnavlhhlpdpdleallrelnsvsglfdsiashydllndlyellldedyfysygyfddyglglrpaq
                                                          ++y++gl + q
  AAL62997.1   171    ------------------------------------PEYAEGLFYSQ 181  

                   eallelllellglkpgkrvLDiGcGtGglalalakalgarvtgvDispem
                      + l+ + ++       +D+ + +Gg + +la++ g+rv++vD s++ 
  AAL62997.1   182 SLPAILVGHIARRITQTDAVDLNSAPGGKTTHLAQM-GIRVIAVDRSAQK 230  

                   lelarenaaelglpnrvefvvgDaedl.....dgsfDlvvsnavlhhlp.
                   +e++r  aa+lgl+  ++++ +D + l+ ++ + ++ ++++++++  +++
  AAL62997.1   231 IEKLRSEAARLGLDVFIDILLHDSRYLdrdfpKIKAGVALVDPPCTDIGv 280  

                   .vedpeallrelarvLkPGGrlvlsepnrpdleelrllglllgeellell
                    ++ ++++  e+a+ L+                       +++ ++l+  
  AAL62997.1   281 rPKIYHKVTFEAAKTLA-----------------------RYQIQFLKTA 307  

                   dlllrgiepggrlltleelrelleeaGfevvevedlplpyastledwler
                    ++ +++    + lt  e +  +e+aG e+v+                  
  AAL62997.1   308 LKIAPYVIYSTCTLTYIENEGVIEKAGAEIVD------------------ 339  

                   flgrldellalldeeflrlwrlyllacalgfrrgligvvlivarKGadeyfefgpryiqepllelllelldlllkpgkrvLDiGcGtGglal
                         + + +g++y q   + l+ + ++         +D+ + +Gg + 
  AAL62997.1   171    ---PEYAEGLFYSQSLPAILVGHIARR--ITQTDAVDLNSAPGGKTT 212  

                   alakllpgakvtgvDispemlelarenakelgl.pnvefivgdaedlpel
                   +la++  g +v++vD s++ +e++r  a++lgl+  ++++ +d + l+++
  AAL62997.1   213 HLAQM--GIRVIAVDRSAQKIEKLRSEAARLGLdVFIDILLHDSRYLDRD 260  

                   lpdgsfDlivsnpPyp.sgvlhhlpdpl..........lqeellkelarv
                   +p+ +  + +++pP+ ++gv   + ++++ +++++ + +q ++lk ++++
  AAL62997.1   261 FPKIKAGVALVDPPCTdIGVRPKIYHKVtfeaaktlarYQIQFLKTALKI 310  

                   LkpGGrlvlstpnldyleellellkalgflvlliepglllpilkflslte
                        ++++st++l+y+e+                               
  AAL62997.1   311 AP---YVIYSTCTLTYIEN------------------------------- 326  

                   lekllekagfkivelikllddlyddglsliqrellelllelldlllkpgkrvLDiGcGtGglalal
                       + y +gl++ q   + l+ +++++        +D+ + +Gg + +l
  AAL62997.1   171    -PEYAEGLFYSQSLPAILVGHIARR--ITQTDAVDLNSAPGGKTTHL 214  

                   akllpgakvtgvDispemlelarenakelglpn.vefivgDaedlpellp
                   a++  g +v++vD s++ +e++r  a++lgl+  ++++ +D + l++++p
  AAL62997.1   215 AQM--GIRVIAVDRSAQKIEKLRSEAARLGLDVfIDILLHDSRYLDRDFP 262  

                   dgsfDlivsnpPypwpgvlhhlpdellekllkelarvmstvplselskklaeeffydlaadfydllldglfpsqrelldlllel
                                                 ++++glf+sq   + l+ + 
  AAL62997.1   172    ---------------------------EYAEGLFYSQSLPAILVGHI 191  

                   lglkpgkrvLDlGcGtGglalalakrgarvtgvDispemlelarenaael
                   ++       +Dl + +Gg + +la++g rv++vD s++ +e++r  aa+l
  AAL62997.1   192 ARRITQTDAVDLNSAPGGKTTHLAQMGIRVIAVDRSAQKIEKLRSEAARL 241  

                   glsdaddnvefivgDaedl..plpellledgsfDlvvsnfavlhhlptgr
                   gl+     ++++  D + l+ ++p       +  +++++ +++  ++   
  AAL62997.1   242 GLDV---FIDILLHDSRYLdrDFP-----KIKAGVALVD-PPCTDIG--- 279  

                   rdpedlea...................llrelarvLkPGGrlvlstpnpd
                        +++++++++ +++++ + +++++l+ + ++     ++++st++ +
  AAL62997.1   280 ----VRPKiyhkvtfeaaktlaryqiqFLKTALKIAP---YVIYSTCTLT 322  

                   dleellellldlgllvlpelgrlvaldlllleellesidlellrlvydkt
                   + e++  +  ++   v+ +++                             
  AAL62997.1   323 YIENEGVIEKAGAEIVDAGIEIGA-------------------------- 346  

                   leelverlddpthlrfytpeeleelleeaflGFevveveedfdkllpllk
                   +++++++  ++ ++ + tp  +++ l+ a                     
  AAL62997.1   347 PGWGCRECRRFLPHVHNTPGFFIAVLRGA--------------------- 375  

                   dsgrlifvarKpvkllelldldidllklsllklkkinklyknlknlilkntsnvskeeia
                                                                     
  AAL62997.1     -    ----------------------------------------------- -    

                   kfydlvadffdevaayydglfgdllslrpaqeellelllellplkpgkrv
                                     +++++l++   ++  l+ ++++++        
  AAL62997.1   172 ------------------EYAEGLFYSQSLPAILVGHIARRI---TQTDA 200  

                   LDiGcGtGglalalakrlgarvtgvDispemlelarenaaelgl...vef
                   +D+ + +Gg + +la++ g rv++vD s++ +e++r  aa+lgl++ +++
  AAL62997.1   201 VDLNSAPGGKTTHLAQM-GIRVIAVDRSAQKIEKLRSEAARLGLdvfIDI 249  

                   ivgDaedlp..fpdgsfDlvvsngvlhhlpdpelk...............
                   + +D + l+ +fp+ ++ + ++++++  ++    ++++++ +++++ + +
  AAL62997.1   250 LLHDSRYLDrdFPKIKAGVALVDPPCTDIGVRPKIyhkvtfeaaktlary 299  

                   ..kllkelarvLkpGGrlvistpnrdd.......ldflllipphgrffsl
                   ++++lk + ++     ++++st++ ++++++ ++++   +i + g ++  
  AAL62997.1   300 qiQFLKTALKIAP---YVIYSTCTLTYienegviEKAGAEIVDAGIEIGA 346  

                   eelrelleeaGfevveveelpgnplsllelllkalkfdsyayfydalnllqlrprtea.lleallellglkpgkrvLDlGcGt
                               ++++l++ ++ +a+l+ ++++++        +Dl + +
  AAL62997.1   172    --------EYAEGLFYSQSLPAiLVGHIARRI---TQTDAVDLNSAP 207  

                   GglalalakrgakrvtgvDisp.mlelarenaaenglpnrvefivgDaed
                   Gg + +la++g + v++vD s++ +e++r  aa++gl+  ++++  D + 
  AAL62997.1   208 GGKTTHLAQMGIR-VIAVDRSAqKIEKLRSEAARLGLDVFIDILLHDSRY 256  

                   l..plpdgsfDlvvsnplpfvlhhlpdleallrealllldkllkllkpgdlvllllannlllpltlrvnklkltrfgllnvl
                                                                     
  AAL62997.1     -    ----------------------------------------------- -    

                   elsgknavahydlsndvyellldpaysdslarfgegntllqpelaellle
                                                   + eg +++q   a l+ +
  AAL62997.1   173 --------------------------------YAEGLFYSQSLPAILVGH 190  

                   lldlkpgkrvLDiGcGtGglalalakllgpdarvtgvDispealelAren
                   +++       +D+ + +Gg + +la++ g  +rv++vD+s++ +e++r  
  AAL62997.1   191 IARRITQTDAVDLNSAPGGKTTHLAQM-G--IRVIAVDRSAQKIEKLRSE 237  

                   akrlglddnvefivgDaed...plpdgsfDlivsdppdpe..........
                   a+rlgld  ++++  D +  + ++p+ ++ ++++dpp+ ++ +  +++++
  AAL62997.1   238 AARLGLDVFIDILLHDSRYldrDFPKIKAGVALVDPPCTDigvrpkiyhk 287  

                   ..............elleellrlLkpGGrlvlsepspedleellellkea
                   ++ +++++ + +++++l+ +l++     ++++s+++  +  e + ++++a
  AAL62997.1   288 vtfeaaktlaryqiQFLKTALKIAP---YVIYSTCTLTY-IENEGVIEKA 333  

                   gfelveifevgflpllveeyllrlidlfplgegylitlrkwgfnklqnfltdpeilekilelldlkegdrvLdiGcGtGaltlelakrggkvt
                      + f+++   + ++  +++   +   +d+ + +G+ t +la++g +v+
  AAL62997.1   176    GLFYSQSLPAILVGHIARRITQTDAVDLNSAPGGKTTHLAQMGIRVI 222  

                   aieideemlelakenlkelg.....nvefiqgDalklpfpdgkfDlivsN
                   a++++   +e+++  +++lg ++ + + ++ + +l+ +fp+ k  + +++
  AAL62997.1   223 AVDRSAQKIEKLRSEAARLGldvfiDILLHDSRYLDRDFPKIKAGVALVD 272  

                   pPy..nissavlhhledlekarrltlmlqleealrlLkpgGrlvilvqnl
                   pP+++ + ++ ++h +   +a      +q+++++  Lk   +++ ++++l
  AAL62997.1   273 PPCtdIGVRPKIYH-KVTFEAAKTLARYQIQFLKTALKIAPYVIYSTCTL 321  

                   tlvelllkvpkeafvPpPkvdsavvrlepkgipllpkdeellerlvkaaf
                   t++e                                              
  AAL62997.1   322 TYIE---------------------------------------------- 325  

                   sqrrktlrnalklleelgfdpilraedlspeeflrlaellllllekngikdeilldyilsrprgepldelldeyedyalkfglglliiqpel
                                                            gl+++q   
  AAL62997.1   176    --------------------------------------GLFYSQSLP 184  

                   lalllelldlkpgkrvLDiGcGtGglalalakllppgakvtgvDispeal
                   + l+ ++++       +D+ + +Gg + +la++   g +v++vD s++ +
  AAL62997.1   185 AILVGHIARRITQTDAVDLNSAPGGKTTHLAQM---GIRVIAVDRSAQKI 231  

                   elarenakenglpnrvefivgdaedflpfllaeglldgsfDlivsdalh.
                   e++r  a+++gl+  ++++  d +  l+  ++    + +  + ++d++++
  AAL62997.1   232 EKLRSEAARLGLDVFIDILLHDSRY-LDRDFP----KIKAGVALVDPPCt 276  

                   ..pdlpk................lleelarlLkpGGrlvlsdplrpgeev
                   ++  +pk++++++ +++++ + + ++ l+ +Lk   ++++s+++  + e 
  AAL62997.1   277 diGVRPKiyhkvtfeaaktlaryQIQFLKTALKIAPYVIYSTCTLTYIEN 326  

                   llelldalfil..........kllfkglrellkllledegfevvllplgd
                   +  + +a  +++++ +++ + ++  ++ r++l+++ + +gf + +l+   
  AAL62997.1   327 EGVIEKAGAEIvdagieigapGWGCRECRRFLPHVHNTPGFFIAVLRG-- 374  

                   GltlarklkvlipfehqevlleellellklkpgkrvLDlGcGtGglalalakllpg
                       +++ + +  l+ ++++++        +Dl  ++Gg + +la++  g
  AAL62997.1   177    LFYSQSLPAILVGHIARRI---TQTDAVDLNSAPGGKTTHLAQM--G 218  

                   arvigvDispealelarenlkelg..dnvefiqgdaldlpellllfpdgs
                   +rvi+vD+s++ +e++r  +++lg +  +++++ d + l++    fp+ +
  AAL62997.1   219 IRVIAVDRSAQKIEKLRSEAARLGldVFIDILLHDSRYLDRD---FPKIK 265  

                   fDlilsDpPysslgl.........lifvlhhledleefleealrvLkpgG
                   + ++l+DpP+   g+  ++++++++ ++    +++ +fl+ al++     
  AAL62997.1   266 AGVALVDPPCTDIGVrpkiyhkvtFEAAKTLARYQIQFLKTALKIAP--- 312  

                   rlvlvtfss...ledeivkkllkelgklvlvvkgpllpsl...eeleell
                   +++++t++ ++++++++++k+ +e+ +  +++  p +  ++  ++l++ +
  AAL62997.1   313 YVIYSTCTLtyiENEGVIEKAGAEIVDAGIEIGAPGWGCRecrRFLPHVH 362  

                   rkagfklvvleklfyTPreivellvelldpkpggrvlDpgcGsGgfllalaerllpgarv
                      fy +   + l+ ++++       +D+  ++Gg++++la++   g+rv
  AAL62997.1   178    FYSQSLPAILVGHIARRITQTDAVDLNSAPGGKTTHLAQM---GIRV 221  

                   vgvDidpealelaren..........eivvgDalell...pdesfDliia
                   ++vD ++  +e +r  ++    ++ ++i+  D++ l+ + p+ +  + + 
  AAL62997.1   222 IAVDRSAQKIEKLRSEaarlgldvfiDILLHDSRYLDrdfPKIKAGVALV 271  

                   NPPyggsgdldrlldellkrlydelalalsgvlglldlyrafleealrl<
                   +PP+  +g+  + + ++             ++  l+  +  fl+ al++ 
  AAL62997.1   272 DPPCTDIGVRPKIYHKVTF----------EAAKTLARYQIQFLKTALKI  310  

                   -*
                     
  AAL62997.1     -    -    

0048438: domain 1 of 1, from 181 to 363: score 27.8, E = 6.2e-08
                   *->seildglvivgkydlskdlfeeflgdydlvlafldglrsraerllel
                                                            s  + l+ +
  AAL62997.1   181    -------------------------------------QSLPAILVGH 190  

                   llellglkpgkrvLDlGcGtGglalalakllgagrvtgvDispealelar
                   ++++  ++     +Dl +++Gg + +la++ g  rv++vD s++ +e++r
  AAL62997.1   191 IARR--IT-QTDAVDLNSAPGGKTTHLAQM-GI-RVIAVDRSAQKIEKLR 235  

                   enakrlg...nvefivgDaedlldlplpdgsfDlvvsdlphlpdp.....
                     a+rlg ++ ++++ +D + l + ++p+ ++ ++++d+p+ +  +  ++
  AAL62997.1   236 SEAARLGldvFIDILLHDSRYLDR-DFPKIKAGVALVDPPCTDIGvrpki 284  

                   ................eallreaarlLkpGGrlvlstpsreeeellelll
                   +++++ +++++ + ++ ++l+ a+++     ++++st++ +  e++ +++
  AAL62997.1   285 yhkvtfeaaktlaryqIQFLKTALKIAP---YVIYSTCTLTYIENEGVIE 331  

                   ll.eellellee.gfelveivellpleedlllvkkkklledllrayllllpellllleslenladhldlgnppfelllgeeffey
                                                                     
  AAL62997.1     -    ----------------------------------------------- -    

                   fakvyelydafndglrpatrlllelllellglkpgkrvLDiGcGtGglal
                                      + l+ +++++  + + +  +D+ + +Gg + 
  AAL62997.1   181 ---------------QSLPAILVGHIARR--ITQTD-AVDLNSAPGGKTT 212  

                   alakalPgarvtgvDi.pemlelarenaaelglspnvefvvgDaed...p
                   +la++  g+rv++vD  ++ +e +r  aa+lgl+  ++++ +D +  + +
  AAL62997.1   213 HLAQM--GIRVIAVDRsAQKIEKLRSEAARLGLDVFIDILLHDSRYldrD 260  

                   lpd.sfDlvvsngvlhhlpd.................pdleallrelarv
                   +p +++ ++++++++ +++   +++++++ +++++ ++ + ++l+ + ++
  AAL62997.1   261 FPKiKAGVALVDPPCTDIGVrpkiyhkvtfeaaktlaRYQIQFLKTALKI 310  

                   LkpGGrlvlsepvrpdleellellgllldlllyifpggrfrtleeleall
                        +++ s+++                           +t  e e  +
  AAL62997.1   311 AP---YVIYSTCT---------------------------LTYIENEGVI 330  

                   eeaGFevvevedldlgylpglfrviekklglqrellelllellg.lkpgkrvLDiGcGtGglalalakrgprvtgvDi
                       + l + l+ +++        +D+ + +Gg + +la++g rv++vD 
  AAL62997.1   181    -QSLPAILVGHIArRITQTDAVDLNSAPGGKTTHLAQMGIRVIAVDR 226  

                   spemlelareraaelglpn.vefvvgDaedlp..fpdgsfDlvvsnavlh
                   s++ +e++r  aa+lgl+  ++++ +D + l+ +fp  ++ ++++++++ 
  AAL62997.1   227 SAQKIEKLRSEAARLGLDVfIDILLHDSRYLDrdFPKIKAGVALVDPPCT 276  

                   hl...pdp................eallrelarvLkPGGrlvlstpnrpd
                    + + p ++++++ +++++ + ++ ++l+ ++++     ++++st+++  
  AAL62997.1   277 DIgvrPKIyhkvtfeaaktlaryqIQFLKTALKIAP---YVIYSTCTLTY 323  

                   leelrelldllerlllpgh.................grflsleelealle
                    e+++ + ++  + ++ g+++ +      +      + + ++  ++a l+
  AAL62997.1   324 IENEGVIEKAGAEIVDAGIeigapgwgcrecrrflpHVHNTPGFFIAVLR 373  

                   eaGfevveveelplpltllsllellrelkglgvnlldgllallelllell
                    a                                                
  AAL62997.1   374 GA------------------------------------------------ 375  

                   lllllllalkkgllklgllkkeleeeeQnfltdpalldailellglkpgdrVLDiGcGtGaltlalakrgarvt
                          +++ l+ +i++++        +D+ + +G+ t +la++g rv+
  AAL62997.1   181    --QSLPAILVGHIARRI---TQTDAVDLNSAPGGKTTHLAQMGIRVI 222  

                   gvDispemlelareraaengladnvefiqgDaedl..plpd..fDlvvsn
                   +vD s+  +e +r  aa++gl+  ++++  D + l+ ++p+++  +++  
  AAL62997.1   223 AVDRSAQKIEKLRSEAARLGLDVFIDILLHDSRYLdrDFPKikAGVALVD 272  

                   lpYdlgndlyellldedyfysdayyddpgdllrpaqerllelllellgl
                                                       ++ l+ ++++++  
  AAL62997.1   183    --------------------------------LPAILVGHIARRIT- 196  

                   kpgkrvLDiGcGtGglalalakalgarvtgvDispemlelareraaelgl
                         +D+ + +Gg + +la++ g+rv++vD s++ +e++r  aa+lgl
  AAL62997.1   197 --QTDAVDLNSAPGGKTTHLAQM-GIRVIAVDRSAQKIEKLRSEAARLGL 243  

                   pnrvefvvgDaedl....d.gsfDlvvsnavlhhlpledleallrelladvlanvlldirksekvldlGcGtGlllialaelgarkvyavDlsp
                      l   l  ++++   +  ++dl++  G+  ++la+ g+ +v+avD+s 
  AAL62997.1   183    LPAILVGHIARRITQTDAVDLNSAPGGKTTHLAQMGI-RVIAVDRSA 228  

                   lalelcrknlallglddrvkvvhgd..lldlldleessfDlilldppy..
                     +e  r+ +a lgld  ++++  d  +ld  d+++ ++ ++l+dpp+++
  AAL62997.1   229 QKIEKLRSEAARLGLDVFIDILLHDsrYLD-RDFPKIKAGVALVDPPCtd 277  

                   ............sllilelldvllsaa.rvLkpgGlvvvvdpdvlvlade
                   + +  ++++++++++ ++l ++ ++ +++ Lk   +v++++++  +++ e
  AAL62997.1   278 igvrpkiyhkvtFEAAKTLARYQIQFLkTALKIAPYVIYSTCT--LTYIE 325  

                   ledlvkkllkeiklvlvvplpdveehydelaefydkllgelliprpateellelllellglkpgkrvLD
                                               ++ l+ ++++++       ++D
  AAL62997.1   184    -------------------------PAILVGHIARRI---TQTDAVD 202  

                   lGCGtGrlalalakrgpevtgvDispemlelArerakengl..nvefiqg
                   l + +G+ + +la++g +v++vD s++ +e++r  a+++gl++ ++++++
  AAL62997.1   203 LNSAPGGKTTHLAQMGIRVIAVDRSAQKIEKLRSEAARLGLdvFIDILLH 252  

                   Daedlp..f.dgsfDlvvsnpnvlhhlppedlekllrelerlfdeyaefydlanglglrprqeallelllellplkpgkrvLDlGc
                                             + l+ ++++++        +Dl +
  AAL62997.1   185    -----------------------AILVGHIARRI---TQTDAVDLNS 205  

                   GtGglalalaklgpkrvtgvDisp.mlelarenaaenglpnrvefivgDa
                    +Gg + +la++g + v++vD s++ +e++r  aa++gl+  ++++  D 
  AAL62997.1   206 APGGKTTHLAQMGIR-VIAVDRSAqKIEKLRSEAARLGLDVFIDILLHDS 254  

                   edlleplpd..fDlvvsnPpggvlhhlpd.................leal
                   + l++++p++++ +++++Pp ++   ++++++++++ +++++ + ++ ++
  AAL62997.1   255 RYLDRDFPKikAGVALVDPP-CTDIGVRPkiyhkvtfeaaktlaryQIQF 303  

                   lrelarvLkPGGrlvlstpnrpglpellelllaelleifpgvggfdlsel
                   l+ ++++     ++++st++    + ++e + +     + + g++     
  AAL62997.1   304 LKTALKIAP---YVIYSTCT--LTYIENEGVIEKAGAEIVDAGIE----- 343  

                   lellleeagfegvdyerllepplellefdllkllldelgfrvefylaace
                                                                     
  AAL62997.1     - -------------------------------------------------- -    

                   dgflhgllgwfdvvldkdgldkivvlstgPtsplthwkqtvfllekpltv
                                                                     
  AAL62997.1     - -------------------------------------------------- -    

                   kkgdelsgsvsrkpnsknvrylwivlslelngellelellllllesllle
                                                                     
  AAL62997.1     - -------------------------------------------------- -    

                   ealklelllellg.lkpgkrvLDiGcGtGglalalakrgarvtgvDis
                          + l+ +++        +D+ + +Gg + +la++g rv++vD s
  AAL62997.1   185    ----AILVGHIArRITQTDAVDLNSAPGGKTTHLAQMGIRVIAVDRS 227  

                   pemlelareraaelglpn.vefvvgDaedlp..fpdgsfDlvvsnavlhh
                   ++ +e++r  aa+lgl+  ++++ +D + l+ +fp  ++ ++++++++  
  AAL62997.1   228 AQKIEKLRSEAARLGLDVfIDILLHDSRYLDrdFPKIKAGVALVDPPCTD 277  

                   lpdpe...................allrelarvLkPGGrlvlstpnlpdl
                   +  +++++++++ +++++ + +++++l+ ++++     ++++st++l   
  AAL62997.1   278 IGVRPkiyhkvtfeaaktlaryqiQFLKTALKIAP---YVIYSTCTL--- 321  

                   ellrlllalllrlldppggrfrspeeleelleeaGfevveveelplplal
                                         +  e e  +e+aG e+v+          
  AAL62997.1   322 ----------------------TYIENEGVIEKAGAEIVD---------- 339  

                   tlllkllrllkklleilklllkellerllelllllleggfleklllklll
                                                                     
  AAL62997.1     - -------------------------------------------------- -    

                   llllkptgyvsrgalklqelleklgllkpgervLDlGcGpGgltlvlaervgpg
                                               ++Dl ++pGg+t++la++   g
  AAL62997.1   195    --------------------ITQTDAVDLNSAPGGKTTHLAQM---G 218  

                   grvvavDlsp.mlelar...........vefiqgdardl..plldlllel
                    rv+avD s++ +e +r +++    ++ ++++++d r+l+ ++       
  AAL62997.1   219 IRVIAVDRSAqKIEKLRseaarlgldvfIDILLHDSRYLdrDF------- 261  

                   lpdgsfDlvlsdaplshlgdlrr........dlarlaalqlalleealrl
                    p+ ++ ++l+d+p+  +g++ +++++++ ++  +la++q ++l+ al++
  AAL62997.1   262 -PKIKAGVALVDPPCTDIGVRPKiyhkvtfeAAKTLARYQIQFLKTALKI 310  

                   LkpgGrlvlstcs...eeneevllallkkyfdlvllvkpiasrdgnsefy
                        ++++stc+ ++ ene+v++++ +++ d +  ++ + ++ +   ++
  AAL62997.1   311 AP---YVIYSTCTltyIENEGVIEKAGAEIVDAGIEIGAPGWGCRECRRF 357  

                   lvalgfkgdlsndlyelyldlydlyssaydllgdrpltdalleallellglkpgk
                                                                     
  AAL62997.1   196    --------------------------------------------TQT 198  

                   rvLDlGcGtGglalalakrgakrvtgvDisp.mlelarenaaenglpnrv
                     +Dl + +Gg + +la+ g + v++vD s++ +e++r  aa++gl+  +
  AAL62997.1   199 DAVDLNSAPGGKTTHLAQMGIR-VIAVDRSAqKIEKLRSEAARLGLDVFI 247  

                   efivgDaedl..plpdgsfDlvvsnpsgvlhhlpd...............
                   +++  D + l+ ++p  ++ + +++p  ++  ++   +++++++ +++++
  AAL62997.1   248 DILLHDSRYLdrDFPKIKAGVALVDP--PCTDIGVrpkiyhkvtfeaakt 295  

                   ..e.leallrelarvLkPGGrlvlstps......................
                    + ++ ++l+ ++++     ++++st++ ++++++ +++++ ++++++ +
  AAL62997.1   296 laRyQIQFLKTALKIAP---YVIYSTCTltyienegviekagaeivdagi 342  

                   ppllpeelelllkellpggpdvegfdlelleeagfedvevlgldyartls
                     ++p ++ +  +++lp+ ++++gf+++ l+ a  e              
  AAL62997.1   343 EIGAPGWGCRECRRFLPHVHNTPGFFIAVLRGARKE-------------- 378  

                   eplelfsfdfleivdedlartwefylavlrdgflhgllgwfdvvldkdgn
                                                                     
  AAL62997.1     - -------------------------------------------------- -    

                   kpvvlstgPlsplthWkqtvflldepltvkkgdeltgsisrlpndknvrw
                                                                     
  AAL62997.1     - -------------------------------------------------- -    

                   leitlslpvkgellnlnldgwfteilwpglrlllkldellheekskyqiiriydlgndgrvlll
                                                                     
  AAL62997.1     -    ----------------------------------------------- -    

                   dglvlgsrpdeaqerllllllallplkpgkrvLDiGcGtGglalalakrg
                                                   +D+ + +Gg + +la++g
  AAL62997.1   196 ---------------------------TQTDAVDLNSAPGGKTTHLAQMG 218  

                   pdarvtgvDispealelarenlalnglelglpnvefivgDaedflpfl..
                      rv++vD s++ +e++r  +a++gl+     ++++ +D +  l++   
  AAL62997.1   219 I--RVIAVDRSAQKIEKLRSEAARLGLD---VFIDILLHDSRY-LDRDfp 262  

                   dgsfDlivsdpp...............lhhlpdpellqreflreaarlLk
                   + +  + ++dpp +++ +  ++++++++++ + ++++q +fl+ a ++  
  AAL62997.1   263 KIKAGVALVDPPctdigvrpkiyhkvtFEAAKTLARYQIQFLKTALKIAP 312  

                   pGGrlvlstpspdpdeellrellerlrelfpdvelvelfvplfpsggwgi
                      ++++st++ ++ e++                                
  AAL62997.1   313 ---YVIYSTCTLTYIENE-------------------------------- 327  

                   llaskgplpldildalllelglryynaeillaafalPkfvrkllLlvlgllielltpglrlllkvdelllserskyqeirvyelgddgrvl
                                                                     
  AAL62997.1     -    ----------------------------------------------- -    

                   lldgllqgsslderqrallllllallglkpgkrvLDiGcGtGglalalak
                                                     +D+ + +Gg + +la+
  AAL62997.1   196 -----------------------------TQTDAVDLNSAPGGKTTHLAQ 216  

                   rpegarvtgvDispealelarenlaelglgllddpnvefivgDaedflpf
                   +  g rv++vD s++ +e++r  +a+lgl+      ++++  D +  l++
  AAL62997.1   217 M--GIRVIAVDRSAQKIEKLRSEAARLGLD----VFIDILLHDSRY-LDR 259  

                   l..dgsfDlivsdpplhhlpdpel.............drL..lqeeflre
                      + +  + ++dpp+   +d+ +  +++++++ ++++ L+ +q +fl+ 
  AAL62997.1   260 DfpKIKAGVALVDPPC---TDIGVrpkiyhkvtfeaaKTLarYQIQFLKT 306  

                   aarlLkPGGrlvlstpsppd.grlelleellealrel.fpvvrlvfvpvp
                   a+++     ++++st++ ++++ ++++e+  +++ ++  +++        
  AAL62997.1   307 ALKIAP---YVIYSTCTLTYiENEGVIEKAGAEIVDAgIEIG-------- 345  

                   kvdsgnvfllaskgppvpfldpeeleellkeagfelryydpelhraafal
                       g+++  +++ +p+ + +p  ++++l+ a                  
  AAL62997.1   346 --APGWGCRECRRFLPHVHNTPGFFIAVLRGA------------------ 375  

                   pkflrealeneakvvtddnpvlvrlenlaldlalkalldillwliellslglalslkidklleeekskyqiiriydlgnfg
                                                                     
  AAL62997.1     -    ----------------------------------------------- -    

                   yelfldgrllysrldeaqytelllllllldlkpgkrvLDiGcGtGglala
                                                        +D+ + +Gg + +
  AAL62997.1   196 --------------------------------TQTDAVDLNSAPGGKTTH 213  

                   lakrgpaakvtgvDispealelarenlkelglslddpnvefivgDaedll
                   la+ g   +v++vD s++ +e++r  +++lgl   d  ++++  D + l 
  AAL62997.1   214 LAQMG--IRVIAVDRSAQKIEKLRSEAARLGL---DVFIDILLHDSRYLD 258  

                   kplpdgsfDliisdpplhhlpdphllteeflkeleldgqlldlllklikeklkknlglnldllplgegqyieelwpglals
                                                                     
  AAL62997.1     -    ----------------------------------------------- -    

                   lkvdevlhekkskyqiiriydlgndgrrlfldggvqysrlderqleelll
                                                                     
  AAL62997.1     - -------------------------------------------------- -    

                   llalldlkpgkrvLDlGcGtGglalalakrgpdarvtgvDispealelar
                                +Dl + +Gg + +la+ g   rv++vD s++ +e++r
  AAL62997.1   196 --------TQTDAVDLNSAPGGKTTHLAQMG--IRVIAVDRSAQKIEKLR 235  

                   enlaenglalddpnvefivgDaedflp.fpdgsfDlivsdpplhhlpdp.
                     +a++gl+     ++++  D + ++++fp+ +  + ++dpp+  ++ + 
  AAL62997.1   236 SEAARLGLD---VFIDILLHDSRYLDRdFPKIKAGVALVDPPCTDIGVRp 282  

                   ..............dllqeefleeaarlLkpGGrlvlstpsppldpelle
                   +++++++ +++++ +++q +fl+ a+++     ++++st++ +       
  AAL62997.1   283 kiyhkvtfeaaktlARYQIQFLKTALKIAP---YVIYSTCTLT------- 322  

                   eilellkelfpgvelprlpvplfpsgewgvllaskgfgldyaetlellel
                                                                     
  AAL62997.1     - -------------------------------------------------- -    

                   leergfdlrfyrlwlhylafclpgflaraldetlgellklrlnklikeefdlgnkfsklwldrsvydsyyfeakllgl
                                                                     
  AAL62997.1     -    ----------------------------------------------- -    

                   yrsraalkleelleklglkpgkrvLDlGCGtGglalylakrypgakvtgv
                                           +Dl +++Gg++ +la++  g +v++v
  AAL62997.1   200 -----------------------AVDLNSAPGGKTTHLAQM--GIRVIAV 224  

                   Dispemlelaren.krlgl.dnvefiqgvda....lpfpdgkfDlvvsDp
                   D s+  +e++r  ++rlgl+  +++++  d  + + +fp+ k  +++ Dp
  AAL62997.1   225 DRSAQKIEKLRSEaARLGLdVFIDILLH-DSryldRDFPKIKAGVALVDP 273  

                   pfsgvlhhvpdpellel..........lkeaarvLkpGGrlvlstftlfe
                   p+ + +   + +++++++++++ + ++++ ++  Lk   ++++st+tl  
  AAL62997.1   274 PCTDIGVRPKIYHKVTFeaaktlaryqIQFLKTALKIAPYVIYSTCTLTY 323  

                   eeneelleilkklfpgvllpspasrkgnseaylvakgfknlglhyaktln
                    ene+++e++                                        
  AAL62997.1   324 IENEGVIEKA---------------------------------------- 333  

                   awlerflanldeilalfdflrmwefyceaaLDlGcGtGglalalaravgarvtgvDispemlelareraeelglpdn
                      +Dl + +Gg + +la++ g rv++vD+s++ +e  r  a++lgl+  
  AAL62997.1   201    VDLNSAPGGKTTHLAQM-GIRVIAVDRSAQKIEKLRSEAARLGLDVF 246  

                   vefvvgDaedl...fpdgsfDlvvsngvlhhlp.dpeallrelarvLkpG
                   +++++ D + l+ +fp  ++ ++++++++ +++++p  + +  +++ k  
  AAL62997.1   247 IDILLHDSRYLdrdFPKIKAGVALVDPPCTDIGvRPKIYHKVTFEAAK-- 294  

                   Grlvlseptleg.eepeelldfilryifpggflsleellalleeaGfevv
                         +  ++++ +   +l+   ++i+  + l+  e + ++e+aG    
  AAL62997.1   295 ------TLARYQiQFLKTALKIAPYVIYSTCTLTYIENEGVIEKAG---- 334  

                   evedltagvvevlrlhyaltlrlwleanllelleelvleyleeflrlwrl
                                            +++ ++ +e+ +  ++ +  r++ +
  AAL62997.1   335 -------------------------AEIVDAGIEIGAPGWGCRECRRFLP 359  

                   ylaglagyflivarKpLDiGcGsGyltlalarlvpelgkdpggrvvgvDispealelarenle
                      +D+ + +G+ t +la++        g rv++vD+s++ +e++r  ++
  AAL62997.1   201    VDLNSAPGGKTTHLAQM--------GIRVIAVDRSAQKIEKLRSEAA 239  

                   rlgldlllpdnvefivgdaedlp..fpdgsfDlvvsnavlhhl.......
                   rlgld      +++++ d + l+ +fp  ++ ++++++++ ++ +  +++
  AAL62997.1   240 RLGLD----VFIDILLHDSRYLDrdFPKIKAGVALVDPPCTDIgvrpkiy 285  

                   ...............leellrlLkpGGrlvlsvpnregleellellrelg
                   ++++ +++++ + ++++ l+ +Lk   +++ s+++              +
  AAL62997.1   286 hkvtfeaaktlaryqIQFLKTALKIAPYVIYSTCTL-------------T 322  

                   feeleelleeagfvvvLDlGCGtGgltlalAklgarVvgvDispealelarenaklngldn.v
                      +Dl + +Gg t +lA++g rV++vD+s++ +e++r  a+++gld  +
  AAL62997.1   201    VDLNSAPGGKTTHLAQMGIRVIAVDRSAQKIEKLRSEAARLGLDVfI 247  

                   efivgDaeellkelpfpdgsfDvvvsDPPy...........sglsgvlhh
                   +++  D + l  + +fp+ ++ v ++DPP++++ +  +++++   ++ + 
  AAL62997.1   248 DILLHDSRYL--DRDFPKIKAGVALVDPPCtdigvrpkiyhKVTFEAAKT 295  

                   lpdpelkrivyvscnpellaelarlLkpGGrlvlstgsrdmfpntehves
                   l+ +++          ++l+ ++++     ++++st++ +  +n+ ++e+
  AAL62997.1   296 LARYQI----------QFLKTALKIAP---YVIYSTCTLTYIENEGVIEK 332  

                   vlllerkLDlGcGsGgltlhlaelvgpeGkVygvDispemlelarenleelg..
                      +Dl +++Gg+t+hla+++    +V++vD+s + +e++r  +++lg +
  AAL62997.1   201    VDLNSAPGGKTTHLAQMGI---RVIAVDRSAQKIEKLRSEAARLGld 244  

                   .nvefilgDaeellklpfpdgsfDvvlsdavlh.....pdp.........
                   + + ++l D + l++  fp  ++ v+l+d+++ ++ + p ++++++ +++
  AAL62997.1   245 vFIDILLHDSRYLDRD-FPKIKAGVALVDPPCTdigvrPKIyhkvtfeaa 293  

                   ....eaaleealrvLkpGGrlvisdftreq....dsplepfeteeelvel
                   ++ ++  ++ ++ +Lk   ++++s++t + ++++++ ++      +   +
  AAL62997.1   294 ktlaRYQIQFLKTALKIAPYVIYSTCTLTYieneGVIEKAGAEIVDAGIE 343  

                   lee.gfelveivellpsrkdhaevvavkllDlgcGtGghslalaerggrvigvDidpealalarerlaglgllnrv
                      +Dl  ++Gg++ +la++g rvi+vD++++ ++ +r  +a+lgl++ +
  AAL62997.1   201    VDLNSAPGGKTTHLAQMGIRVIAVDRSAQKIEKLRSEAARLGLDVFI 247  

                   efvqgdalalp..lpdgsfDgvlldlgllDlgaGiGilalpaaklgakkVvaveidpeavellreNaklnglenr
                      +Dl +  G+ + ++a++g  +V+av+ + + +e lr  a++ gl+ +
  AAL62997.1   201    VDLNSAPGGKTTHLAQMGI-RVIAVDRSAQKIEKLRSEAARLGLDVF 246  

                   vevingdardllpe...ekfDvvvldppasg...................
                   +++++ d r l+++  ++k+ v ++dpp+  + +  +++++++ +++++ 
  AAL62997.1   247 IDILLHDSRYLDRDfpkIKAGVALVDPPCTDigvrpkiyhkvtfeaaktl 296  

                   ....lellkaalkllkpggivyvscnpatlardellleelgyrleklgvv
                   + +++++lk alk+    ++v++s+++ t+ ++e ++e++g +++ +g  
  AAL62997.1   297 aryqIQFLKTALKI---APYVIYSTCTLTYIENEGVIEKAGAEIVDAGIE 343  

                   dmfphthhvesvapfvrhvvldlrlpeeGllaialaklgaakvtgvDispealelArenaelnglsnrvefivgd
                      G+ + +la++g  +v++vD s++ +e +r  a+++gl+  +++++ d
  AAL62997.1   208    GGKTTHLAQMGI-RVIAVDRSAQKIEKLRSEAARLGLDVFIDILLHD 253  

                   aleflp..fpdgkfDlivsNPPyggls.......ellievlhhlpdlald
                    +  l+ +fp+ k+ + +++PP+ + ++  +++++  +e+   l      
  AAL62997.1   254 SRY-LDrdFPKIKAGVALVDPPCTDIGvrpkiyhKVTFEAAKTL------ 296  

                   ggkdglealleeaarlLkpgGrlvistgprtleelrelleeagfevveiq
                        ++  ++ ++ +Lk   ++++st++ t  e + ++e+ag e+v+  
  AAL62997.1   297 -----ARYQIQFLKTALKIAPYVIYSTCTLTYIENEGVIEKAGAEIVD-- 339  

                   pvdlfpgtshve