RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 95pdb09Oct16_0000; 95pdb09Oct16_0001; 95pdb09Oct16_0002;
95pdb09Oct16_0003 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done

Query= AAL62792.1 paer1 AAL62792.1 GIB00076CH01 "glycosyltransferase
(type 2)"
         (394 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

2bo4A [x.x.x] MANNOSYLGLYCERATE SYNTHASE                               92   2e-21
2c0nA [x.x.x] A197                                                     85   4e-19
3ckqA [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN                         83   1e-18
3e25A [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN                         82   2e-18
3e26A [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN                         82   4e-18
2bo7A [x.x.x] MANNOSYLGLYCERATE SYNTHASE                               81   6e-18
2d0jD [x.x.x] GALACTOSYLGALACTOSYLXYLOSYLPROTEIN 3-BETA-               74   5e-16
2d0jA [x.x.x] GALACTOSYLGALACTOSYLXYLOSYLPROTEIN 3-BETA-               74   9e-16
3ckjA [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN                         70   9e-15
2dm9A [x.x.x] V-TYPE ATP SYNTHASE SUBUNIT E                            63   2e-12
3bcvA [x.x.x] PUTATIVE GLYCOSYLTRANSFERASE PROTEIN                     61   7e-12
2agdA [x.x.x] BETA-1,4-GALACTOSYLTRANSFERASE 1                         55   4e-10
2ae7A [x.x.x] BETA-1,4-GALACTOSYLTRANSFERASE 1                         54   9e-10
2d7iA [x.x.x] POLYPEPTIDE N-ACETYLGALACTOSAMINYLTRANSFERASE 10         51   5e-09

>2bo4A [x.x.x] MANNOSYLGLYCERATE SYNTHASE
          Length = 380

 Score = 92.5 bits (228), Expect = 2e-21
 Identities = 37/213 (17%), Positives = 60/213 (28%), Gaps = 30/213 (14%)

Query: 5   VVLPTLNEAQALPKVVEELRATGYR-DILVVDGGSTDGTVEEAKRLGLRVIGQY------ 57
           VV P  +E   +      + A   R   ++  G   D T E  +R    +          
Sbjct: 3   VVFPFKHEHPEVLLHNVRVAAAHPRVHEVLCIGYERDQTYEAVERAAPEISRATGTPVSV 62

Query: 58  -------------GRGKGMALRTALMYVETPYVAVLDADYTYP-PAELNKLVPLLR-HYD 102
                        G G   ALR  L   +   +   DAD T   P  + K        Y 
Sbjct: 63  RLQERLGTLRPGKGDGMNTALRYFLEETQWERIHFYDADITSFGPDWITKAEEAADFGYG 122

Query: 103 VVIGARQ---GKMPALYKLGNKVLAWLFRVLFGVDLRDPLTGMYVARTDVLR-----EAV 154
           +V              + +     A L+       +  PL G  + R +V       E V
Sbjct: 123 LVRHYFPRASTDAMITWMITRTGFALLWPHTELSWIEQPLGGELLMRREVAAMLYEDERV 182

Query: 155 TEARGFDLEVEILAKALANGARVAEVPIQYRER 187
                + ++       +  G  + E  I   + 
Sbjct: 183 RRRSDWGIDTLYTFVTVQQGVSIYECYIPEGKA 215


>2c0nA [x.x.x] A197
          Length = 187

 Score = 84.7 bits (208), Expect = 4e-19
 Identities = 19/177 (10%), Positives = 42/177 (23%), Gaps = 13/177 (7%)

Query: 29  RDILVVDGGSTDGTVEEAKRLGLRVI----GQYGRGKGMALRTALMYVETPYVAVLDADY 84
           R +  +  GS    + +              +        +    +  +   +A LD D 
Sbjct: 1   RTLFFIPSGSVRLPLIDFLVKNDIEYVILSRRNHVAVQREIALDFLEKDYDTLAFLDEDV 60

Query: 85  TYPPAELNKLVPLLRHY--DVVIGARQGKMPALYKLGNKVLAWLFRVLFGVDLRDPLTGM 142
                +  K+          V             +  +       + +F  ++     G 
Sbjct: 61  VPIEIDFQKVEAKFNEGYDVVCGYYYL----KTLRGYSVYRKDWEKEIFDGEVNGCGLGF 116

Query: 143 YVARTDVLREA---VTEARGFDLEVEILAKALANGARVAEVPIQYRERIGKKKLRPW 196
              + + L +       A G D+      K         +      ER+     R  
Sbjct: 117 TFIKREFLEKIKRPAFLAIGEDVYFFSTHKPRTYALSSLKAYHFIDERLALSPDRKL 173


>3ckqA [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
          Length = 302

 Score = 83.1 bits (204), Expect = 1e-18
 Identities = 49/260 (18%), Positives = 85/260 (32%), Gaps = 31/260 (11%)

Query: 1   MCITVVLPTLNEAQALPKVVEELRATGY---RDILVVDGGSTDGTVEEAKRLGLRVIG-- 55
             I+VVLP L+E   +  V++ +         +++V+D GSTD T   A   G RV+   
Sbjct: 34  RTISVVLPALDEEDTIGSVIDSISPLVDGLVDELIVLDSGSTDDTEIRAVAAGARVVSRE 93

Query: 56  ------QYGRGKGMALRTALMYVETPYVAVLDADYTYPPAE-LNKLVPLLRH--YDVVIG 106
                     GKG AL  +L       V  +D+D   P    +  LV  L       ++ 
Sbjct: 94  QALPEVPIRPGKGEALWRSLAASRGDIVVFVDSDLINPHPMFVPWLVGPLLTGDGVHLVK 153

Query: 107 ARQGKMPALYK---LGNKVLAWLFRVLFGVDLRDPLTGMYVARTDVLREA-VTEARGFDL 162
           +   +         +   +LA L   L  +    PL G Y A  ++L         G ++
Sbjct: 154 SFYRRPLGGRVTELVARPLLAALRPELGCI--LQPLGGEYAATRELLTSVPFAPGYGVEI 211

Query: 163 EVEILAKALANGARVAEVPIQYRERIGKKKLRPWHGVGIAVKALELAYRLNP-------- 214
            + +          +A+V +  RE   +            +  L     +          
Sbjct: 212 GLLVDTFDRLGLDAIAQVNLGVREHRNRPLAELGAMSRQVIATLLSRCGIPDSGVGLTQF 271

Query: 215 ---ALFLTLIGALMLIPAVA 231
                            ++A
Sbjct: 272 VADGPEGQSYTQHTWPVSLA 291


>3e25A [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
          Length = 270

 Score = 82.3 bits (202), Expect = 2e-18
 Identities = 52/254 (20%), Positives = 87/254 (34%), Gaps = 24/254 (9%)

Query: 3   ITVVLPTLNEAQALPKVVEELRATGYRD---ILVVDGGSTDGTVEEAKRLG--------L 51
           I+VVLP LNE   +  V++ +          ++V+D GSTD T   A   G         
Sbjct: 22  ISVVLPALNEEATIESVIDSISPLVDGLVDELIVLDSGSTDDTEIRAIASGARVVSREQA 81

Query: 52  RVIGQYGRGKGMALRTALMYVETPYVAVLDADYTYP-PAELNKLVPLLRHY--DVVIGAR 108
                   GKG AL  +L       V  +D+D   P P  +  LV  L       ++ + 
Sbjct: 82  LPEVPVRPGKGEALWRSLAATSGDIVVFIDSDLINPHPLFVPWLVGPLLTGEGIQLVKSF 141

Query: 109 QGKMPALYKLGNKVLAWLFRVLFGVDLRDPLTGMYVARTDVLREA-VTEARGFDLEVEIL 167
             ++  L  +   +LA L   L  V    PL+G Y A  ++L         G ++ + I 
Sbjct: 142 YRRVTEL--VARPLLAALRPELGCV--LQPLSGEYAASRELLTSLPFAPGYGVEIGLLID 197

Query: 168 AKALANGARVAEVPIQYRER-IGKKKLRPWHGVGIAVKALELAYRLNPALFLTLIGALML 226
                    +A+V +  R R + +        +   +    +                  
Sbjct: 198 TFDRLGLDAIAQVNLGVRNRPLDELGAMSRQVIATLLSRCGIPDSGVGLTQ----FYTRH 253

Query: 227 IPAVALGGWVAYRY 240
              V+L      + 
Sbjct: 254 TWPVSLVDRPPMKV 267


>3e26A [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
          Length = 274

 Score = 81.6 bits (200), Expect = 4e-18
 Identities = 53/253 (20%), Positives = 87/253 (34%), Gaps = 19/253 (7%)

Query: 3   ITVVLPTLNEAQALPKVVEELRATGYRD---ILVVDGGSTDGTVEEAKRLGLR------- 52
           I+VVLP LNE   +  V++ +          ++V+D GSTD T   A   G R       
Sbjct: 23  ISVVLPALNEEATIESVIDSISPLVDGLVDELIVLDSGSTDDTEIRAIASGARVVSREQA 82

Query: 53  -VIGQYGRGKGMALRTALMYVETPYVAVLDADYTYP-PAELNKLVPLLRHY--DVVIGAR 108
                   GKG AL  +L       V  +D+D   P P  +  LV  L       ++ + 
Sbjct: 83  LPEVPVRPGKGEALWRSLAATSGDIVVFIDSDLINPHPLFVPWLVGPLLTGEGIQLVKSF 142

Query: 109 QGKMPALYKLGNKVLAWLFRVLFGVDLRDPLTGMYVARTDVLREA-VTEARGFDLEVEIL 167
             ++  L  +   +LA L   L  V    PL+G Y A  ++L         G ++ + I 
Sbjct: 143 YRRVTEL--VARPLLAALRPELGCV--LQPLSGEYAASRELLTSLPFAPGYGVEIGLLID 198

Query: 168 AKALANGARVAEVPIQYRERIGKKKLRPWHGVGIAVKALELAYRLNPALFLTLIGALMLI 227
                    +A+V +  R    +            +  L     +  +            
Sbjct: 199 TFDRLGLDAIAQVNLGVRAHRNRPLDELGAMSRQVIATLLSRCGIPDSGVGLTQFYTRHT 258

Query: 228 PAVALGGWVAYRY 240
             V+L      + 
Sbjct: 259 WPVSLVDRPPMKV 271


>2bo7A [x.x.x] MANNOSYLGLYCERATE SYNTHASE
          Length = 375

 Score = 81.0 bits (198), Expect = 6e-18
 Identities = 44/293 (15%), Positives = 80/293 (27%), Gaps = 30/293 (10%)

Query: 5   VVLPTLNEAQALPKVVEELRATGY-RDILVVDGGSTDGTVEEAKRLG------------- 50
           VV P  +E   +      + A       ++  G   D T E  +R               
Sbjct: 3   VVFPFKHEHPEVLLHNVRVAAAHPRVHEVLCIGYERDQTYEAVERAAPEISRATGTPVSV 62

Query: 51  ------LRVIGQYGRGKGMALRTALMYVETPYVAVLDADYTYPPAELNKLVPLL--RHYD 102
                   +    G G   ALR  L   +   +   DAD T    +            Y 
Sbjct: 63  RLQERLGTLRPGKGDGMNTALRYFLEETQWERIHFYDADITSFGPDWITKAEEAADFGYG 122

Query: 103 VVIGARQ---GKMPALYKLGNKVLAWLFRVLFGVDLRDPLTGMYVARTDVLR-----EAV 154
           +V              + +     A L+       +  PL G  + R +V       E V
Sbjct: 123 LVRHYFPRASTDAMITWMITRTGFALLWPHTELSWIEQPLGGELLMRREVAAMLYEDERV 182

Query: 155 TEARGFDLEVEILAKALANGARVAEVPIQYRERIGKKKLRPWHGVGIAVKALELAYRLNP 214
                + ++       +  G  + E  I   +               A+++L+      P
Sbjct: 183 RRRSDWGIDTLYTFVTVQQGVSIYECYIPEGKAHRLDLRTMLVECFAAIQSLQHEVVGQP 242

Query: 215 ALFLTLIGALMLIPAVALGGWVAYRYFYQGVPHYMLGLAALLMLVIGGISTAL 267
           A+        + +      G+      ++ + H+      LL L    +   L
Sbjct: 243 AIHRQEHPHRVPVHIAERVGYDVEATLHRLMQHWTPRQVELLELFTTPVREGL 295


>2d0jD [x.x.x] GALACTOSYLGALACTOSYLXYLOSYLPROTEIN 3-BETA-
          Length = 241

 Score = 74.4 bits (181), Expect = 5e-16
 Identities = 27/238 (11%), Positives = 56/238 (23%), Gaps = 34/238 (14%)

Query: 3   ITVVLPTLNEAQALPKVVEELRATGYRD---ILVVDGGSTDGTVE--EAKRLGLR----- 52
           I  + PT +      ++               ++V+  +    +      R GL      
Sbjct: 4   IYAITPTYSRPVQKAELTRLANTFRQVAQLHWILVEDAAARSELVSRFLARAGLPSTHLH 63

Query: 53  ----------VIGQYGRGKGMALRTALMYVETPYVAVLDADYTYPPAELNKLVPLLR--H 100
                        Q   G     +        P V     D      EL + +   R   
Sbjct: 64  VPTPRRGLPRATEQRNAGLAWLRQRHQHQRAQPGVLFFADDDNTYSLELFQEMRTTRKVS 123

Query: 101 YDVVIGARQGKMPALYKLGNKVLAWLFRVLFGVDLRDPLTGMYVARTD-------VLREA 153
              V      +         KV+ W             + G  V+          V +  
Sbjct: 124 VWPVGLVGGRRYERPLVENGKVVGWYTGWRADRPFAIDMAGFAVSLQVILSNPKAVFKRR 183

Query: 154 VTEARGFDLE----VEILAKALANGARVAEVPIQYRERIGKKKLRPWHGVGIAVKALE 207
            ++    + +    +  + +         +V + +  R  K  L       +    +E
Sbjct: 184 GSQPGMQESDFLKQITTVEELEPKANNCTKVLV-WHTRTEKVNLANEPKYHLDTVKIE 240


>2d0jA [x.x.x] GALACTOSYLGALACTOSYLXYLOSYLPROTEIN 3-BETA-
          Length = 242

 Score = 73.6 bits (179), Expect = 9e-16
 Identities = 31/240 (12%), Positives = 58/240 (24%), Gaps = 38/240 (15%)

Query: 3   ITVVLPTLNEAQALPKVVEELRATGYR---DILVVDGGST--DGTVEEAKRLGLRVIG-- 55
           I  + PT +      ++               ++V+  +   +       R GL      
Sbjct: 5   IYAITPTYSRPVQKAELTRLANTFRQVAQLHWILVEDAAARSELVSRFLARAGLPSTHLH 64

Query: 56  -------------QYGRGKGMALRTALMYVETPYVAVLDADYTYPPAELNKLVPLLRH-- 100
                        Q   G     +        P V     D      EL + +   R   
Sbjct: 65  VPTPRRGLPRATEQRNAGLAWLRQRHQHQRAQPGVLFFADDDNTYSLELFQEMRTTRKVS 124

Query: 101 ---YDVVIGAR-QGKMPALYKLGNKVLAWLFRVLFGVDLRDPL--------TGMYVARTD 148
                +V G R +  +    K+      W     F +D+                V +  
Sbjct: 125 VWPVGLVGGRRYERPLVENGKVVGWYTGWRADRPFAIDMAGFAVSLQVILSNPKAVFKRR 184

Query: 149 VLREAVTEARGF-DLEVEILAKALANGARVAEVPIQYRERIGKKKLRPWHGVGIAVKALE 207
             +  + E+     +      +  AN      V   +  R  K  L       +    +E
Sbjct: 185 GSQPGMQESDFLKQITTVEELEPKANNCTKVLV---WHTRTEKVNLANEPKYHLDTVKIE 241


>3ckjA [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
          Length = 300

 Score = 70.4 bits (171), Expect = 9e-15
 Identities = 49/233 (21%), Positives = 85/233 (36%), Gaps = 18/233 (7%)

Query: 1   MCITVVLPTLNEAQALPKVVEELRATGYRD---ILVVDGGSTDGTVEEAKRLGLRVIGQY 57
             I+VVLP L+E   +  V++ +          ++V+D GSTD T   A   G RV+ + 
Sbjct: 34  RTISVVLPALDEEDTIGSVIDSISPLVDGLVDELIVLDSGSTDDTEIRAVAAGARVVSRE 93

Query: 58  GR--------GKGMALRTALMYVETPYVAVLDADYTY-PPAELNKLVPLLRHY--DVVIG 106
                     GKG AL  +L       V  +D+D     P  +  LV  L       ++ 
Sbjct: 94  QALPEVPIRPGKGEALWRSLAASRGDIVVFVDSDLINPHPMFVPWLVGPLLTGDGVHLVK 153

Query: 107 ARQGKMPALYKL-GNKVLAWLFRVLFGVDLRDPLTGMYVARTDVLREA-VTEARGFDLEV 164
           +   +   + +L    +LA L   L  +    PL G Y A  ++L         G ++ +
Sbjct: 154 SFYRRPGRVTELVARPLLAALRPELGCI--LQPLGGEYAATRELLTSVPFAPGYGVEIGL 211

Query: 165 EILAKALANGARVAEVPIQYRERIGKKKLRPWHGVGIAVKALELAYRLNPALF 217
            +          +A+V +  RE   +            +  L     +  +  
Sbjct: 212 LVDTFDRLGLDAIAQVNLGVREHRNRPLAELGAMSRQVIATLLSRCGIPDSGV 264


>2dm9A [x.x.x] V-TYPE ATP SYNTHASE SUBUNIT E
          Length = 118

 Score = 62.5 bits (151), Expect = 2e-12
 Identities = 9/117 (7%), Positives = 24/117 (20%), Gaps = 11/117 (9%)

Query: 20  VEELRATGYRD--ILVVDGGSTDGTVEEAKRLGLR-------VIGQYGRGKGMALRTALM 70
           +  +     R    +  D           + +          +  +   G   +    + 
Sbjct: 3   ISSVLEEVKRRLETMSEDEYFESVKALLKEAIKELNEKKVRVMSNEKTLGLIASRIEEIK 62

Query: 71  YVETPYVAVLDADYTYPPAELNKLVPLLRHYDVVIGARQGKMPALYKLGNKVLAWLF 127
                    L          + +        D    AR        ++ + +   LF
Sbjct: 63  SELGDVSIELGETVDTMGGVIVETEDGRIRIDNTFEARME--RFEGEIRSTIAKVLF 117


>3bcvA [x.x.x] PUTATIVE GLYCOSYLTRANSFERASE PROTEIN
          Length = 192

 Score = 60.7 bits (146), Expect = 7e-12
 Identities = 30/192 (15%), Positives = 60/192 (31%), Gaps = 17/192 (8%)

Query: 3   ITVVLPTLNEAQALPKVVEELRATGYRD--ILVVDGGSTDGTV----EEAKRLGLRVIGQ 56
           ++V++P  N  + L + V+ L A    D  I+++D  S D       + A +     +  
Sbjct: 5   VSVIVPIYNVEKYLDQCVQALLAQTLSDIEIILIDDESPDNCPKICDDYAAQYPNIKVIH 64

Query: 57  YGRGKGMALRTALMYVETPYVAVLDADYTYPPAELNKLVPLLRHYDVVIGARQGKMPALY 116
                  A  + L      YVA  D+D          +        V           ++
Sbjct: 65  KKNAGLGACNSGLDVATGEYVAFCDSDDYVDSDYTYNVAQKYTCDAVFTFKLYKNKNEIH 124

Query: 117 K-LGNKVLAWLFRVLFGVDLRDPLTGMYVARTDVLREAVTEARGFDL------EVEILAK 169
             L + + +  +              +Y  R +++ +     R          ++     
Sbjct: 125 TLLKDLIASDPYAREERAIQVSAKVVLY--RRNLIEK--KHLRFVSERILPSEDLIFNVD 180

Query: 170 ALANGARVAEVP 181
            LAN   V  +P
Sbjct: 181 VLANSNIVCVLP 192


>2agdA [x.x.x] BETA-1,4-GALACTOSYLTRANSFERASE 1
          Length = 273

 Score = 54.9 bits (130), Expect = 4e-10
 Identities = 11/108 (10%), Positives = 24/108 (22%), Gaps = 18/108 (16%)

Query: 1   MCITVVLPTLNEAQALPKVVEELRATGYR-----DILVVDGGSTDGTVEEAKRLGLRVIG 55
             + +++P  N  + L   +  L     R      I V++                    
Sbjct: 51  HKVAIIIPFRNRQEHLKYWLYYLHPVLQRQQLDYGIYVINQAGDTIF------------- 97

Query: 56  QYGRGKGMALRTALMYVETPYVAVLDADYTYPPAELNKLVPLLRHYDV 103
              +   +  + AL   +       D D                 +  
Sbjct: 98  NRAKLLNVGFQEALKDYDYTCFVFSDVDLIPMNDHNAYRCFSQPRHIS 145


>2ae7A [x.x.x] BETA-1,4-GALACTOSYLTRANSFERASE 1
          Length = 272

 Score = 53.7 bits (127), Expect = 9e-10
 Identities = 11/107 (10%), Positives = 24/107 (22%), Gaps = 18/107 (16%)

Query: 1   MCITVVLPTLNEAQALPKVVEELRATGYRD-----ILVVDGGSTDGTVEEAKRLGLRVIG 55
             + +++P  N  + L   +  L     R      I V++                    
Sbjct: 50  HKVAIIIPFRNRQEHLKYWLYYLHPVLQRQQLDYGIYVINQAGDTIF------------- 96

Query: 56  QYGRGKGMALRTALMYVETPYVAVLDADYTYPPAELNKLVPLLRHYD 102
              +   +  + AL   +       D D                 + 
Sbjct: 97  NRAKLLNVGFQEALKDYDYTCFVFSDVDLIPMNDHNAYRCFSQPRHI 143


>2d7iA [x.x.x] POLYPEPTIDE N-ACETYLGALACTOSAMINYLTRANSFERASE 10
          Length = 536

 Score = 51.2 bits (120), Expect = 5e-09
 Identities = 13/117 (11%), Positives = 30/117 (25%), Gaps = 12/117 (10%)

Query: 1   MCITVVLPTLNEAQALPKVVEELRA-TGYRD----ILVVDGGSTDGTVEEAKRLGLRVIG 55
              ++++P  NE  +               +    I++VD  S    +++     + +  
Sbjct: 78  PNTSIIIPFHNEGWSSLLRTVHSVLNRSPPELVAEIVLVDDFSDREHLKKPLEDYMALFP 137

Query: 56  QY-------GRGKGMALRTALMYVETPYVAVLDADYTYPPAELNKLVPLLRHYDVVI 105
                      G                +  LD+        L  L+  +      I
Sbjct: 138 SVRILRTKKREGLIRTRMLGASVATGDVITFLDSHCEANVNWLPPLLDRIARNRKTI 194


  Database: 95pdb09Oct16_0000
    Posted date:  Oct 27, 2009  4:27 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.320    0.135    0.397 

Gapped
Lambda     K      H
   0.267   0.0507    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 21,027,724
Number of extensions: 1284244
Number of successful extensions: 15436
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 7674
Number of HSP's successfully gapped: 331
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.4 bits)