RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 95pdb09Oct16_0000; 95pdb09Oct16_0001; 95pdb09Oct16_0002;
95pdb09Oct16_0003 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done

Query= AAL62997.1 paer1 AAL62997.1 GIB00076CH01 "RNA binding protein
(fmu, PCNA P120 homolog), pr.."
         (379 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

2as0A [x.x.x] HYPOTHETICAL PROTEIN PH1915                              72   4e-15
3c6kA [x.x.x] SPERMINE SYNTHASE                                        64   8e-13
3cc2M [x.x.x] 50S RIBOSOMAL PROTEIN L15E                               61   8e-12
2c7oA [c.66.1 (10mhA)] MODIFICATION METHYLASE HHAI                     59   2e-11
2b9eA [x.x.x] NOL1/NOP2/SUN DOMAIN FAMILY, MEMBER 5 ISOFORM 2          54   5e-10
3c6kB [x.x.x] SPERMINE SYNTHASE                                        53   1e-09
2ar0B [x.x.x] TYPE I RESTRICTION ENZYME ECOKI M PROTEIN                53   2e-09
2cwwB [x.x.x] PUTATIVE SAM-DEPENDENT RNA METHYLTRANSFERASE             51   4e-09
2cwwA [x.x.x] PUTATIVE SAM-DEPENDENT RNA METHYLTRANSFERASE             51   4e-09
3e05C [x.x.x] PRECORRIN-6Y C5,15-METHYLTRANSFERASE                     50   1e-08
2b25A [x.x.x] HYPOTHETICAL PROTEIN                                     49   2e-08
2ausC [x.x.x] PSEUDOURIDINE SYNTHASE                                   48   5e-08
3c6mC [x.x.x] SPERMINE SYNTHASE                                        48   6e-08
3d79A [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN PH0734                  47   1e-07
3duwA [x.x.x] O-METHYLTRANSFERASE, PUTATIVE                            45   4e-07
3c3yA [x.x.x] O-METHYLTRANSFERASE                                      44   6e-07
2ausA [x.x.x] PSEUDOURIDINE SYNTHASE                                   44   1e-06
2b3tA [x.x.x] PROTEIN METHYLTRANSFERASE HEMK                           43   1e-06
2apoA [x.x.x] PROBABLE TRNA PSEUDOURIDINE SYNTHASE B                   43   1e-06
1eg2A [c.66.1] MODIFICATION METHYLASE RSRI                             42   2e-06
2ar0A [x.x.x] TYPE I RESTRICTION ENZYME ECOKI M PROTEIN                42   3e-06
3a25A [x.x.x] UNCHARACTERIZED PROTEIN PH0793                           40   8e-06
2cx0A [x.x.x] HYPOTHETICAL PROTEIN APE0525                             40   1e-05
3eeyA [x.x.x] PUTATIVE RRNA METHYLASE                                  40   1e-05
2an3A [x.x.x] PHENYLETHANOLAMINE N-METHYLTRANSFERASE                   40   1e-05
2an3B [x.x.x] PHENYLETHANOLAMINE N-METHYLTRANSFERASE                   39   3e-05
3e05D [x.x.x] PRECORRIN-6Y C5,15-METHYLTRANSFERASE                     38   3e-05
3e05H [x.x.x] PRECORRIN-6Y C5,15-METHYLTRANSFERASE                     38   4e-05
3c6mB [x.x.x] SPERMINE SYNTHASE                                        38   5e-05
3bgvB [x.x.x] MRNA CAP GUANINE-N7 METHYLTRANSFERASE                    37   7e-05
3e05B [x.x.x] PRECORRIN-6Y C5,15-METHYLTRANSFERASE                     37   8e-05
3dxxA [x.x.x] TRNA (GUANINE-N(7)-)-METHYLTRANSFERASE                   37   8e-05
3eeyB [x.x.x] PUTATIVE RRNA METHYLASE                                  37   9e-05
3dzbA [x.x.x] PREPHENATE DEHYDROGENASE                                 37   1e-04
3cbgA [x.x.x] O-METHYLTRANSFERASE                                      37   1e-04
3c6mA [x.x.x] SPERMINE SYNTHASE                                        36   2e-04
3dzbB [x.x.x] PREPHENATE DEHYDROGENASE                                 36   2e-04
1d2hA [c.66.1] GLYCINE N-METHYLTRANSFERASE                             36   2e-04
2dpmA [c.66.1] PROTEIN (ADENINE-SPECIFIC METHYLTRANSFERASE             36   2e-04
3e05A [x.x.x] PRECORRIN-6Y C5,15-METHYLTRANSFERASE                     36   2e-04
3c0kA [x.x.x] UPF0064 PROTEIN YCCW                                     35   3e-04
3diiA [x.x.x] SHORT-CHAIN DEHYDROGENASE/REDUCTASE SDR                  35   4e-04
3b3gA [x.x.x] HISTONE-ARGININE METHYLTRANSFERASE CARM1                 35   4e-04
1eizA [c.66.1] FTSJ                                                    34   6e-04
3c3pC [x.x.x] METHYLTRANSFERASE                                        34   6e-04
2aowA [x.x.x] HISTAMINE N-METHYLTRANSFERASE                            34   7e-04
2cmgA [x.x.x] SPERMIDINE SYNTHASE                                      34   8e-04

>2as0A [x.x.x] HYPOTHETICAL PROTEIN PH1915
          Length = 382

 Score = 71.6 bits (174), Expect = 4e-15
 Identities = 29/177 (16%), Positives = 50/177 (28%), Gaps = 14/177 (7%)

Query: 201 VDLNSAPGGKTTHLAQMGI-RVIAVDRSAQKIEKLRSEAARLGLDVFIDILLHDSRYLDR 259
           +D+ +  GG   H A  G   VI +D+S + IE  +  A   G++    I+         
Sbjct: 215 LDVFTYTGGFAIHAAIAGADEVIGIDKSPRAIETAKENAKLNGVEDRKFIVGSAFEEEKL 274

Query: 260 DFPKIKAGVALVDPPCTDIGVRPKIYHKVTFEAAKTLARYQIQFLKTA---LKIAPYVIY 316
                K  + ++DPP                +  K   R            +K    ++ 
Sbjct: 275 QKKGEKFDIVVLDPPA----------FVQHEKDLKAGLRAYFNVNFAGLNLVKDGGILVT 324

Query: 317 STCTLTYIENEGVIEKAGAEIVDAGIEIGAPGWGCRECRRFLPHVHNTPGFFIAVLR 373
            +C+         I  AGA+                               F+ V  
Sbjct: 325 CSCSQHVDLQFKDIIAAGAKAGKFLKLEPYRTQAPDHPILASKDTEYLKCLFLYVED 381


>3c6kA [x.x.x] SPERMINE SYNTHASE
          Length = 335

 Score = 63.7 bits (154), Expect = 8e-13
 Identities = 19/224 (8%), Positives = 46/224 (20%), Gaps = 31/224 (13%)

Query: 165 PKLRNLPEYAEGLFYSQSLPAILVGHIARRITQTDAVDLNSAPGGKTT------------ 212
             ++ L     G     S    L                    G                
Sbjct: 126 QNIKILHSKQFGNILILSGDVNLAESDLAYTRAIMGSGKEDYTGKDVLILGGGDGGILCE 185

Query: 213 HLAQMGIRVIAVDRSAQKIEKLRSEAARLGLDVF---IDILLHDSRYLDRDFPKIKAGVA 269
            +      V  V+     I+  +    ++  ++      +L+ D   + + + K      
Sbjct: 186 IVKLKPKMVTMVEIDQMVIDGCKKYMRKVLDNLKGDCYQVLIEDCIPVLKRYAKEGREFD 245

Query: 270 LVDPPCTDIGVRPKIYHKVTFEAAKTLARYQIQFLKTALKIAPYVIYSTCTLTYIENEGV 329
            V    T + +      +          +         LK           +   E   +
Sbjct: 246 YVINDLTAVPISTSSTWEFLRLILDLSMK--------VLKQDGKYFTQGNCVNLTEALSL 297

Query: 330 IEKAGAEIVDAGIEIGAPGWGCRECRRFLPHVHNTPGFFIAVLR 373
            E+    +               +    +P       F+    +
Sbjct: 298 YEEQLGRLY--------CPVEFSKEIVCVPSYLELWVFYTVWKK 333


>3cc2M [x.x.x] 50S RIBOSOMAL PROTEIN L15E
          Length = 194

 Score = 60.5 bits (145), Expect = 8e-12
 Identities = 21/173 (12%), Positives = 44/173 (25%), Gaps = 13/173 (7%)

Query: 162 YRTPKLRNLPEYAEGLFYSQSLPAILVGHIARRITQTDAVDLNSAPGGKTTHLAQMGIR- 220
            R  + RN          ++   A       +         ++   G       + G R 
Sbjct: 26  QRQQEWRNEGAVERIERPTRLDKARS--QGYKAKQGVIVARVSVRKGSARKRRHKAGRRS 83

Query: 221 ----VIAVDRSAQKIEKLRSEAARLGLDVFIDILLHDSRYLDRDFPKIKAGVALVDPPCT 276
               V  + R           A+R   ++ +     +S  + +D  +    V L+DP   
Sbjct: 84  KRQGVTRITRRKDIQRVAEERASRTFPNLRV----LNSYSVGQDGRQKWHEVILIDPNHP 139

Query: 277 DIGVRPKIYHKVTFEAAKTLARYQIQFLKTALKIAP--YVIYSTCTLTYIENE 327
            I     +      + A  + R      +    ++        T         
Sbjct: 140 AIQNDDDLSWICADDQADRVFRGLTGAGRRNRGLSGKGKGSEKTRPSLRSNGG 192


>2c7oA [c.66.1 (10mhA)] MODIFICATION METHYLASE HHAI
          Length = 327

 Score = 58.9 bits (141), Expect = 2e-11
 Identities = 21/175 (12%), Positives = 41/175 (23%), Gaps = 18/175 (10%)

Query: 201 VDLNSAPGGKTTHLAQMGIR-VIAVDRSAQKIEKLRSEAARLGLDVFIDILLHDSRYLDR 259
           +DL +  GG    L   G   V + +      E                +        ++
Sbjct: 15  IDLFAGLGGFRLALESCGAECVYSNEWDKYAQEVYEMNFGEKPEGDITQVN-------EK 67

Query: 260 DFPKIKAGVALVDPPCTDIGVRPKIYHKVTFEAAKTLARYQIQFLKTA---LKIAPYVIY 316
             P     +     PC    +  K   K   ++  TL     + ++     +     V  
Sbjct: 68  TIPDHD--ILCAGFPCQAFSISGK--QKGFEDSRGTLFFDIARIVREKKPKVVFMENVKN 123

Query: 317 STCTLTYIENEGVIE---KAGAEIVDAGIEIGAPGWGCRECRRFLPHVHNTPGFF 368
                     E V     +         +     G   +  R ++    N     
Sbjct: 124 FASHDNGNTLEVVKNTMNELDYSFHAKVLNALDYGIPQKRERIYMICFRNDLNIQ 178


>2b9eA [x.x.x] NOL1/NOP2/SUN DOMAIN FAMILY, MEMBER 5 ISOFORM 2
          Length = 275

 Score = 54.4 bits (129), Expect = 5e-10
 Identities = 47/243 (19%), Positives = 76/243 (31%), Gaps = 24/243 (9%)

Query: 144 DEALKARRGLYIKVEKSLYRTPKLRNLPEYAEGLFYSQSLPAILVGHIARRITQTDAVDL 203
            +         +           L   P Y  G    Q   + L   +      +  +D 
Sbjct: 42  LKGKHFLLDPLMPELLVFPAQTDLHEHPLYRAGHLILQDRASCLPAMLLDPPPGSHVIDA 101

Query: 204 NSAPGGKTTHLAQMGIRV---IAVDRSAQKIEKLRSEAARLGLDVFIDILLHDSRYLDRD 260
            +APG KT+HLA +        A D  A+++  + +  AR G+                D
Sbjct: 102 CAAPGNKTSHLAALLKNQGKIFAFDLDAKRLASMATLLARAGVSCCELAEEDFLAVSPSD 161

Query: 261 FPKIKAGVALVDPPCTDIGVRPKIYHKVTFEAAKTLARYQIQFLKTALKIAPYVIYSTCT 320
               +    L+DP C+ + +      +                          ++YSTC+
Sbjct: 162 PRYHEVHYILLDPSCSGVRLHALAGFQQRALCHALTFPSL-----------QRLVYSTCS 210

Query: 321 LTYIENEGVIEKAGAEIVD----AGIEIGAPGWGCR------ECRRFLPHVHNTPGFFIA 370
           L   ENE V+  A  +       A      P  G         C R  P    + GFF+A
Sbjct: 211 LCQEENEDVVRDALQQNPGAFRLAPALPAWPHRGLSTFPGAEHCLRASPETTLSSGFFVA 270

Query: 371 VLR 373
           V+ 
Sbjct: 271 VIE 273


>3c6kB [x.x.x] SPERMINE SYNTHASE
          Length = 345

 Score = 53.0 bits (126), Expect = 1e-09
 Identities = 20/223 (8%), Positives = 46/223 (20%), Gaps = 30/223 (13%)

Query: 166 KLRNLPEYAEGLFYSQSLPAILVGHIARRITQTDAVDLNSAPGGKT-----------THL 214
            ++ L     G     S    L                    G                +
Sbjct: 135 NIKILHSKQFGNILILSGDVNLAESDLAYTRAIMGSGKEDYTGKDVLILGGGDGGILCEI 194

Query: 215 AQ-MGIRVIAVDRSAQKIEKLRSEAARLGLDVF---IDILLHDSRYLDRDFPKIKAGVAL 270
            +     V  V+     I+  +    ++  ++      +L+ D   + + + K       
Sbjct: 195 VKLKPKMVTMVEIDQMVIDGCKKYMRKVLDNLKGDCYQVLIEDCIPVLKRYAKEGREFDY 254

Query: 271 VDPPCTDIGVRPKIYHKVTFEAAKTLARYQIQFLKTALKIAPYVIYSTCTLTYIENEGVI 330
           V                 T  +     R  +      LK           +   E   + 
Sbjct: 255 VI-------NDLTAVPISTSPSTWEFLRLILDLSMKVLKQDGKYFTQGNCVNLTEALSLY 307

Query: 331 EKAGAEIVDAGIEIGAPGWGCRECRRFLPHVHNTPGFFIAVLR 373
           E+    +               +    +P       F+    +
Sbjct: 308 EEQLGRLY--------CPVEFSKEIVCVPSYLELWVFYTVWKK 342


>2ar0B [x.x.x] TYPE I RESTRICTION ENZYME ECOKI M PROTEIN
          Length = 474

 Score = 52.9 bits (125), Expect = 2e-09
 Identities = 21/269 (7%), Positives = 52/269 (19%), Gaps = 33/269 (12%)

Query: 140 VMDSDEALKARRGLYIKVEKSLYRTPKLRNLPEYAEGLFYSQSLPAILVGHIARRITQTD 199
           + + D+ L       +    +  +        +  +  +++       + H+ +   +  
Sbjct: 73  LGEDDKKLVQAVFHNVSTTITEPKQITALVSNDSLDWQYFTPRPLIKTIIHLLKPQPREV 132

Query: 200 AVDLNSAPGGKTTHLAQMG--------------------IRVIAVDRSAQKIEKLRSEAA 239
             D  +   G      +                         I ++          +   
Sbjct: 133 VQDPAAGTAGFLIEADRYVKSQTNDLDDLDGDTQDFQIHRAFIGLELVPGTRRLALNCLL 192

Query: 240 RLGLDVFIDILLHDSRYLD--RDFPKIKAGVALVDPPCTDIGVRPKIYHKVTFEAAKTLA 297
                                      KA +   +PP             V   + K L 
Sbjct: 193 HDIEGNLDHGGAIRLGNTLGSDGENLPKAHIVATNPPFGSAAGTNITRTFVHPTSNKQLC 252

Query: 298 RYQI-QFLKTALKIAPYVIYSTCTLTYIENEGVIEKAGAEIVDAGI----EIGAPGWGCR 352
              I + L    +    V+     L        I +   +     I           G +
Sbjct: 253 FQHIIETLHPGGRA--AVVVPDNVLFEGGKGTDIRRDLDKCHLHTILRLPTGIFYAQGVK 310

Query: 353 EC----RRFLPHVHNTPGFFIAVLRGARK 377
                  +      N        +     
Sbjct: 311 TNVLFFTKGTVANPNQDKNCTDDVWVYDL 339


>2cwwB [x.x.x] PUTATIVE SAM-DEPENDENT RNA METHYLTRANSFERASE
          Length = 382

 Score = 51.4 bits (121), Expect = 4e-09
 Identities = 35/205 (17%), Positives = 59/205 (28%), Gaps = 9/205 (4%)

Query: 171 PEYAEGLFYSQSLPAILVGHIARRITQTDAVDLNSAPGGKTTHLAQMGIRVIAVDRSAQK 230
            +   G      L          R     A+D+ S  GG   HLA     V+AVD SA+ 
Sbjct: 184 VDLRAGQKTGAYLDQRENRLYMERFRGERALDVFSYAGGFALHLALGFREVVAVDSSAEA 243

Query: 231 IEKLRSEAARLGLDVFIDILLHDSRYLDRDFPKIKAGVALVDPPCTDIGVRPKIYHKVTF 290
           + +    A   GL     +  +    L R   + +    +V  P      +  +      
Sbjct: 244 LRRAEENARLNGLGNVRVLEANAFDLLRRLEKEGERFDLVVLDPPAFAKGKKDVER---- 299

Query: 291 EAAKTLARYQIQFLKTALKIAPYVIYSTCTLTYIENE--GVIEKAGAEIVDAGIEIGAPG 348
             A    +         LK    +  ++C+    E     ++ +A  +       +   G
Sbjct: 300 --AYRAYKEVNLRAIKLLKEGGILATASCSHHMTEPLFYAMVAEAAQDAHRLLRVVEKRG 357

Query: 349 WGCREC-RRFLPHVHNTPGFFIAVL 372
                      P  H        VL
Sbjct: 358 QPFDHPVLLNHPETHYLKFAVFQVL 382


>2cwwA [x.x.x] PUTATIVE SAM-DEPENDENT RNA METHYLTRANSFERASE
          Length = 376

 Score = 51.3 bits (121), Expect = 4e-09
 Identities = 30/172 (17%), Positives = 49/172 (28%), Gaps = 15/172 (8%)

Query: 207 PGGKTTHLAQMGIRVIAVDRSAQKIEKLRSEAARLGLDVFIDILLHDSRYLDRDFPKIKA 266
            GG   HLA     V+AVD SA+ + +    A   GL     +  +    L R       
Sbjct: 214 AGGFALHLALGFREVVAVDSSAEALRRAEENARLNGLGNVRVLEANAFDLLRRLE----- 268

Query: 267 GVALVDPPCTDIGVRPKIYHKVTFEAAKTLARYQIQFLKTA---LKIAPYVIYSTCTLTY 323
                +    D+ V          +  +   R   +    A   LK    +  ++C+   
Sbjct: 269 ----KEGERFDLVVLDPPAFAKGKKDVERAYRAYKEVNLRAIKLLKEGGILATASCSHHM 324

Query: 324 IENEGV--IEKAGAEIVDAGIEIGAPGWGCREC-RRFLPHVHNTPGFFIAVL 372
            E      + +A  +       +   G           P  H        VL
Sbjct: 325 TEPLFYAMVAEAAQDAHRLLRVVEKRGQPFDHPVLLNHPETHYLKFAVFQVL 376


>3e05C [x.x.x] PRECORRIN-6Y C5,15-METHYLTRANSFERASE
          Length = 190

 Score = 49.6 bits (117), Expect = 1e-08
 Identities = 14/191 (7%), Positives = 46/191 (24%), Gaps = 13/191 (6%)

Query: 160 SLYRTPKLRNLPEYAEGLFYSQSLPAILVGHIARRITQTDAVDLNSAPGGKTTHLAQMG- 218
           + Y    + +          ++     +     R        D+ +     +   + +  
Sbjct: 1   AQYPVIGIDDDEFATAKKLITKQEVRAVTLSKLRLQDDLVMWDIGAGSASVSIEASNLMP 60

Query: 219 -IRVIAVDRSAQKIEKLRSEAARLGLDVFIDILLHDSRYLDRDFPKIKAGVALVDPPCTD 277
             R+ A++R+ Q +  +R    +       ++ L ++   +            +      
Sbjct: 61  NGRIFALERNPQYLGFIRDNLKKFVAR---NVTLVEAFAPEGLDDLPDPDRVFIGGSGGM 117

Query: 278 IGVRPKIYHKVTFE----AAKTLARYQIQFLKTALKIAPYVIYSTCTLTYIENEGVI--- 330
           +        +            +    +      L+   Y++   C              
Sbjct: 118 LEEIIDAVDRRLKSEGVIVLNAVTLDTLTKAVEFLEDHGYMVEVACVNVAKTKGTEYKMF 177

Query: 331 -EKAGAEIVDA 340
                  I+ A
Sbjct: 178 ESHNPVYIITA 188


>2b25A [x.x.x] HYPOTHETICAL PROTEIN
          Length = 254

 Score = 49.2 bits (116), Expect = 2e-08
 Identities = 27/251 (10%), Positives = 59/251 (23%), Gaps = 28/251 (11%)

Query: 132 RVVALGVAVMDSDEALKARRGLYIKVEKS---LYRTPK-LRNLPEYAEGLFYSQSLPAIL 187
           R+   G+  +   + +    G  ++       + R P     +     G   +      +
Sbjct: 21  RLNNFGLLNVPFGKIVGKFPGQILRSSFGKQYMLRRPALEDYVVLMKRGTAITFPKDINM 80

Query: 188 VGHIARRITQTDAVDLNSAPGGKT---THLAQMGIRVIAVDRSAQKIEKLRSEAARLGLD 244
           +  +         ++  S  GG +   +       RVI+ +      +  +         
Sbjct: 81  ILSMMDINPGDTVLEAGSGSGGMSLFLSKAVGSQGRVISFEVRKDHHDLAKKNYKHWRDS 140

Query: 245 VFIDILLHDSRYLDRDFPKIKAGVALVDPPCTDIGVRPKIYHKVTFEAAKTLARYQIQFL 304
             +     +    + DF       A  D    D+                      +   
Sbjct: 141 WKLSH--VEEWPDNVDFIHKDISGATFDAVALDMLNPHVT----------------LPVF 182

Query: 305 KTALKIAPYVIYSTCTLTYIENEGVIEKA--GAEIVDAGIEIGAPGWGCRECRRFLPHVH 362
              LK           +T +       +    A   +   E+    W          H  
Sbjct: 183 YPHLKHGGVCAVYVVNITQVIELLDGIRTCELALSCEKISEVIVRDWL-VCLVARPVHWQ 241

Query: 363 NTPGFFIAVLR 373
                F+  LR
Sbjct: 242 PGHTAFLVKLR 252



 Score = 37.3 bits (85), Expect = 8e-05
 Identities = 4/41 (9%), Positives = 11/41 (26%)

Query: 36 PPRYYIRVNTLKISPRELVKRLNSRGLAVYRDEYIDDALWV 76
            +   R+N   +      K +      + R  +    +  
Sbjct: 15 KFKKLFRLNNFGLLNVPFGKIVGKFPGQILRSSFGKQYMLR 55


>2ausC [x.x.x] PSEUDOURIDINE SYNTHASE
          Length = 311

 Score = 47.8 bits (112), Expect = 5e-08
 Identities = 16/54 (29%), Positives = 27/54 (50%)

Query: 108 YAPAVIKTDRVNIGDEVNIVSDNGRVVALGVAVMDSDEALKARRGLYIKVEKSL 161
               V     +  GD V I++    +VALG A+M + E ++  +G+ + VEK  
Sbjct: 248 VPGIVKLNAGIKKGDLVAIMTLKDELVALGKAMMSTQEMIERSKGIAVDVEKVF 301


>3c6mC [x.x.x] SPERMINE SYNTHASE
          Length = 291

 Score = 47.7 bits (112), Expect = 6e-08
 Identities = 23/252 (9%), Positives = 46/252 (18%), Gaps = 28/252 (11%)

Query: 142 DSDEALKARRGLYIKVEKSLYRT--------PKLRNLPEYAEGLFYSQSLPAILVGHIAR 193
                          VE  +             ++ L     G     S    L      
Sbjct: 45  GGAIDRYWPTADGRLVEYDIDEVVYDEDSPYQNIKILHSKQFGNILILSGDVNLAESDLA 104

Query: 194 RITQTDAVDLNSAPGGKTT------------HLAQMGIRVIAVDRSAQKIEKLRSEAARL 241
                         G                 +      V  V+     I+  +    + 
Sbjct: 105 YTRAIMGSGKEDYTGKDVLILGGGDGGILCEIVKLKPKMVTMVEIDQMVIDGCKKYMRKT 164

Query: 242 GLDVFIDILLHDSRYLDRDFPKIKAGVALVDPPCTDIGVRPKIYHKVTFEAAKTLARYQI 301
             DV  ++     + L  D   +    A        +          T  +     R  +
Sbjct: 165 CGDVLDNLKGDCYQVLIEDCIPVLKRYAKEGREFDYVINDLTAVPISTSPSTWEFLRLIL 224

Query: 302 QFLKTALKIAPYVIYSTCTLTYIENEGVIEKAGAEIVDAGIEIGAPGWGCRECRRFLPHV 361
                 LK           +   E   + E+         +          +    +P  
Sbjct: 225 DLSMKVLKQDGKYFTQGNCVNLTEALSLYEEQ--------LGRLYCPVEFSKEIVCVPSY 276

Query: 362 HNTPGFFIAVLR 373
                F+    +
Sbjct: 277 LELWVFYTVWKK 288



 Score = 40.0 bits (92), Expect = 1e-05
 Identities = 13/64 (20%), Positives = 22/64 (34%), Gaps = 3/64 (4%)

Query: 12 LYKHFLEFLSDAEIDSLFRSITTPPPRYYIRVNTLKISPRELVKRLNSRGLAVYRDEYID 71
          L    L+     EIDS+   +     R   R+  +            + G  V  D  ID
Sbjct: 9  LVLLDLQSQGKEEIDSILNKVEERMKRV-KRLPPIVRGGAIDRYWPTADGRLVEYD--ID 65

Query: 72 DALW 75
          + ++
Sbjct: 66 EVVY 69


>3d79A [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN PH0734
          Length = 167

 Score = 46.5 bits (110), Expect = 1e-07
 Identities = 19/65 (29%), Positives = 33/65 (50%), Gaps = 2/65 (3%)

Query: 99  ESVMLGADLYAPAVIK-TDRVNIGDEVNIVS-DNGRVVALGVAVMDSDEALKARRGLYIK 156
             ++ GAD+ AP ++   + +  GD V +V    GR +A+G+A+M      +  RG  +K
Sbjct: 94  PHILNGADVMAPGIVDADEGIKEGDFVFVVEEKYGRPLAIGIALMSGKVMKEKNRGKAVK 153

Query: 157 VEKSL 161
           V    
Sbjct: 154 VIHHA 158


>3duwA [x.x.x] O-METHYLTRANSFERASE, PUTATIVE
          Length = 218

 Score = 44.8 bits (104), Expect = 4e-07
 Identities = 22/207 (10%), Positives = 49/207 (23%), Gaps = 25/207 (12%)

Query: 171 PEYAEGLFYSQSLPAILVGHIARRITQTDAVDLNSAPGGKTTHLAQM---GIRVIAVDRS 227
                            +  + +     + +++ +  G  T  LA+    G RV+ ++ S
Sbjct: 30  AAANLPAHDVSPTQGKFLQLLVQIQGARNILEIGTLGGYSTIWLARGLSSGGRVVTLEAS 89

Query: 228 AQKIEKLRSEAARLGLDVFI---DILLHDSRYLDRDFPKIKAGVALVDPPCTDIGVRPKI 284
            +  +  RS   R  L+  +     L  DS     +          +D    +       
Sbjct: 90  EKHADIARSNIERANLNDRVEVRTGLALDSLQQIENEKYEPFDFIFIDADKQNN------ 143

Query: 285 YHKVTFEAAKTLARYQIQFLKTALKIAPYVIYSTCTLTYIENEGVIEKAGAEIVDAGIEI 344
                            ++     +    +I           +        + +    E+
Sbjct: 144 -------------PAYFEWALKLSRPGTVIIGDNVVREGEVIDNTSNDPRVQGIRRFYEL 190

Query: 345 GAPGWGCRECRRFLPHVHNTPGFFIAV 371
            A                   GF   V
Sbjct: 191 IAAEPRVSATALQTVGSKGYDGFIAVV 217


>3c3yA [x.x.x] O-METHYLTRANSFERASE
          Length = 225

 Score = 44.3 bits (103), Expect = 6e-07
 Identities = 25/235 (10%), Positives = 63/235 (26%), Gaps = 17/235 (7%)

Query: 140 VMDSDEALKARRGLYIKVEKSLYRTPKLRNLPEYAEGLFYSQSLPAILVGHIARRITQTD 199
           ++ S+E  +      +   ++ +          + +    +  L   L+  + + +    
Sbjct: 2   LLQSEELCQYILRTSVYPREAGFLKELREANESHPDSYMSTSPLAGQLMSFVLKLVNAKK 61

Query: 200 AVDLNSAPGGKTTHLAQM---GIRVIAVDRSAQKIEKLRSEAARLGLDVFIDILLHDSRY 256
            +++    G      A       ++ A+D   +  E       + G++  I+ +  D+  
Sbjct: 62  TIEVGVFTGYSLLLTALSIPDDGKITAIDFDREAYEIGLPFIRKAGVEHKINFIESDAML 121

Query: 257 LDRDFPKIKAGVALVDPPCTDIGVRPKIYHKVTFEAAKTLARYQIQFLKTALKIAPYVIY 316
              +  + +      D    D       Y K      K             +K+   V Y
Sbjct: 122 ALDNLLQGQESEGSYDFGFVDADKPN--YIKYHERLMK------------LVKVGGIVAY 167

Query: 317 STCTLTYIENEGVIEKAGAEIVDAGIEIGAPGWGCRECRRFLPHVHNTPGFFIAV 371
                     +   E       +    I        + R  + H+    G     
Sbjct: 168 DNTLWGGTVAQPESEVPDFMKENREAVIELNKLLAADPRIEIVHLPLGDGITFCR 222


>2ausA [x.x.x] PSEUDOURIDINE SYNTHASE
          Length = 309

 Score = 43.5 bits (101), Expect = 1e-06
 Identities = 15/41 (36%), Positives = 25/41 (60%)

Query: 121 GDEVNIVSDNGRVVALGVAVMDSDEALKARRGLYIKVEKSL 161
           GD V I++    +VALG A+M + E ++  +G+ + VEK  
Sbjct: 259 GDLVAIMTLKDELVALGKAMMSTQEMIERSKGIAVDVEKVF 299


>2b3tA [x.x.x] PROTEIN METHYLTRANSFERASE HEMK
          Length = 276

 Score = 43.5 bits (101), Expect = 1e-06
 Identities = 30/235 (12%), Positives = 59/235 (25%), Gaps = 25/235 (10%)

Query: 142 DSDEALKARRGLYIKVEK---SLYRTPK---LRNLPEYAEGLFYSQSLPAILVGHIARRI 195
            +DE  +    L  +        + T            +      +     LV     R+
Sbjct: 47  LTDEQCQQLDALLTRRRDGEPIAHLTGVREFWSLPLFVSPATLIPRPDTECLVEQALARL 106

Query: 196 TQT--DAVDLNSAPGGKTTHLAQM--GIRVIAVDRSAQKIEKLRSEAARLGLDVFIDILL 251
            +     +DL +  G     LA       +IAVDR    +   +  A  L +     +  
Sbjct: 107 PEQPCRILDLGTGTGAIALALASERPDCEIIAVDRMPDAVSLAQRNAQHLAIKNIHILQS 166

Query: 252 HDSRYLDRDFPKIKAGVALVDPPCTDIGVRPKIYHKV---------TFEAAKTLARYQIQ 302
                        +  + + +PP  D          V           ++      + I+
Sbjct: 167 DW----FSALAGQQFAMIVSNPPYIDEQDPHLQQGDVRFEPLTALVAADSGMADIVHIIE 222

Query: 303 FLKTALKIAPYVIYSTCTLTYIENEGVIEKAGAEIVDAGIEIGAPGWGCRECRRF 357
             + AL    +++                 AG   V+                R+
Sbjct: 223 QSRNALVSGGFLLLEHGWQQGEAVRQAFILAGYHDVE--TCRDYGDNERVTLGRY 275


>2apoA [x.x.x] PROBABLE TRNA PSEUDOURIDINE SYNTHASE B
          Length = 304

 Score = 43.4 bits (101), Expect = 1e-06
 Identities = 14/41 (34%), Positives = 25/41 (60%)

Query: 121 GDEVNIVSDNGRVVALGVAVMDSDEALKARRGLYIKVEKSL 161
           G+ V + +  G  VA+G A+M++ E L A +G+ + VE+  
Sbjct: 255 GETVLVETLKGEAVAVGKALMNTKEILNADKGVAVDVERVY 295


>1eg2A [c.66.1] MODIFICATION METHYLASE RSRI
          Length = 270

 Score = 42.2 bits (97), Expect = 2e-06
 Identities = 10/59 (16%), Positives = 18/59 (30%)

Query: 201 VDLNSAPGGKTTHLAQMGIRVIAVDRSAQKIEKLRSEAARLGLDVFIDILLHDSRYLDR 259
           +D  +  G       Q G   I  D +    E  + +   L     ++   +    L R
Sbjct: 212 LDFFAGSGVTARVAIQEGRNSICTDAAPVFKEYYQKQLTFLRSYEIVEGAANFGAALQR 270


>2ar0A [x.x.x] TYPE I RESTRICTION ENZYME ECOKI M PROTEIN
          Length = 476

 Score = 41.7 bits (96), Expect = 3e-06
 Identities = 16/189 (8%), Positives = 37/189 (19%), Gaps = 25/189 (13%)

Query: 166 KLRNLPEYAEGLFYSQSLPAILVGHIARRITQTDAVDLNSAPGGKTTHLAQMG------- 218
                 +  +  +++       + H+ +   +    D  +   G      +         
Sbjct: 99  TALVSNDSLDWQYFTPRPLIKTIIHLLKPQPREVVQDPAAGTAGFLIEADRYVKSQTNDL 158

Query: 219 -------------IRVIAVDRSAQKIEKLRSEAARLGLD--VFIDILLHDSRYLDRDFPK 263
                           I ++          +               +   +         
Sbjct: 159 DDLDGDTQDFQIHRAFIGLELVPGTRRLALNCLLHDIEGNLDHGGAIRLGNTLGSDGENL 218

Query: 264 IKAGVALVDPPCTDIGVRPKIYHKVTFEAAKTLARYQ-IQFLKTALKIAPYVIYSTCTLT 322
            KA +   +PP             V   + K L     I+ L         V+     L 
Sbjct: 219 PKAHIVATNPPFGSAAGTNITRTFVHPTSNKQLCFQHIIETLHP--GGRAAVVVPDNVLF 276

Query: 323 YIENEGVIE 331
                  I 
Sbjct: 277 EGGKGTDIR 285


>3a25A [x.x.x] UNCHARACTERIZED PROTEIN PH0793
          Length = 264

 Score = 40.5 bits (94), Expect = 8e-06
 Identities = 20/119 (16%), Positives = 37/119 (31%), Gaps = 13/119 (10%)

Query: 201 VDLNSAPGGKTTHLAQMG-IRVIAVDRSAQKIEKLRSEAARLGLDVFIDILLHDSRYLDR 259
           VD+ +  G  +  +A  G  +VIA+++     + L        ++  +     D+R    
Sbjct: 116 VDMFAGIGHLSLPIAVYGKAKVIAIEKDPYTFKFLVENIHLNKVEDRMSAYNMDNRDFP- 174

Query: 260 DFPKIKAGVALVDPPCTDIGVRPKIY---------HKVTFEAAKTLARYQIQFLKTALK 309
              +  A   L+          PK           H       K + R   +  K   K
Sbjct: 175 --GENIADRILMGYVVRTHEFIPKALSIAKDGAIIHYHNTVPEKLMPREPFETFKRITK 231


>2cx0A [x.x.x] HYPOTHETICAL PROTEIN APE0525
          Length = 181

 Score = 40.1 bits (93), Expect = 1e-05
 Identities = 15/53 (28%), Positives = 20/53 (37%)

Query: 99  ESVMLGADLYAPAVIKTDRVNIGDEVNIVSDNGRVVALGVAVMDSDEALKARR 151
            ++  GA L    V        GD V  +    R   +GVA +DS    K  R
Sbjct: 102 IALAKGAHLIPGVVGVEGSFTRGDVVAALYHETRTPVVGVAEVDSSALEKLYR 154


>3eeyA [x.x.x] PUTATIVE RRNA METHYLASE
          Length = 195

 Score = 40.1 bits (93), Expect = 1e-05
 Identities = 18/127 (14%), Positives = 31/127 (24%), Gaps = 6/127 (4%)

Query: 177 LFYSQSLPAILVGHIARRITQTDAVDLNSAPGGKTTHLAQMG---IRVIAVDRSAQKIEK 233
           L    SL                 VD     G  T  LA +     RV   D   + I  
Sbjct: 1   LTIKNSLGQSHDYIKMFVKEGDTVVDATCGNGNDTAFLASLVGENGRVFGFDIQDKAIAN 60

Query: 234 LRSEAARLGLDVFIDILLHDSRYLDRDFPKIKAGVALVDPPCTDIGV--RPKIYHKVTFE 291
              +   L L   + ++    + +D+          + +      G              
Sbjct: 61  TTKKLTDLNLIDRVTLIKDGHQNMDKYIDC-PVKAVMFNLGYLPSGDHSISTRPETTIQA 119

Query: 292 AAKTLAR 298
            +K +  
Sbjct: 120 LSKAMEL 126


>2an3A [x.x.x] PHENYLETHANOLAMINE N-METHYLTRANSFERASE
          Length = 258

 Score = 39.7 bits (91), Expect = 1e-05
 Identities = 8/103 (7%), Positives = 21/103 (20%), Gaps = 3/103 (2%)

Query: 178 FYSQSLPAILVGHIARRITQTDAVDLNSAPGGKTTHLAQM-GIRVIAVDRSAQKIEKLRS 236
                L  +        ++    +D+ S P       A      +   D      ++L  
Sbjct: 31  VGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGR 90

Query: 237 EAARLGLDVFIDILLHDSRYL--DRDFPKIKAGVALVDPPCTD 277
                       +    +  +    +  + K            
Sbjct: 91  WLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRARVKRVL 133


>2an3B [x.x.x] PHENYLETHANOLAMINE N-METHYLTRANSFERASE
          Length = 269

 Score = 38.9 bits (89), Expect = 3e-05
 Identities = 6/79 (7%), Positives = 18/79 (22%), Gaps = 1/79 (1%)

Query: 201 VDLNSAPGGKTTHLAQMGI-RVIAVDRSAQKIEKLRSEAARLGLDVFIDILLHDSRYLDR 259
           +D+ S P       A      +   D      ++L              +    +  ++ 
Sbjct: 64  IDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEG 123

Query: 260 DFPKIKAGVALVDPPCTDI 278
                +     +      +
Sbjct: 124 KGECWQDKERQLRARVKRV 142


>3e05D [x.x.x] PRECORRIN-6Y C5,15-METHYLTRANSFERASE
          Length = 192

 Score = 38.4 bits (88), Expect = 3e-05
 Identities = 13/219 (5%), Positives = 37/219 (16%), Gaps = 42/219 (19%)

Query: 162 YRTPKLRNLPEYAEGLFYSQSLPAILVGHIARRITQTDAVDLNSAPGGKTTHLAQMGIRV 221
           Y    + +          ++     +     R        D+ +     +   + +    
Sbjct: 1   YPVIGIDDDEFATAKKLITKQEVRAVTLSKLRLQDDLVMWDIGAGSASVSIEASNLMPNG 60

Query: 222 IAVDRSAQKIEKLRSEAARLGLDV-FIDILLHDSRYLDRDFPKIKAGVALVDPPCTDIGV 280
                                     + ++   +     D P                  
Sbjct: 61  RIFALERNPQYLGFIRDNLKKFVARNVTLVEAFAPEGLDDLPDPDRVFIGGSGGM----- 115

Query: 281 RPKIYHKVTFEAAKTLARYQIQFLKTALKIAPYVIYSTCTLTYIENEGVIEKAGAEIVDA 340
                               I  +   LK    ++ +  TL  +           + V+ 
Sbjct: 116 ----------------LEEIIDAVDRRLKSEGVIVLNAVTLDTL----------TKAVEF 149

Query: 341 GIEIGAPGWGCRECRRFLPHVHNTPGFFIAVLRGARKEP 379
             + G            +            +      E 
Sbjct: 150 LEDHG----------YMVEVACVNVAKTKGLTEYKMFES 178


>3e05H [x.x.x] PRECORRIN-6Y C5,15-METHYLTRANSFERASE
          Length = 191

 Score = 38.2 bits (87), Expect = 4e-05
 Identities = 15/189 (7%), Positives = 47/189 (24%), Gaps = 12/189 (6%)

Query: 161 LYRTPKLRNLPEYAEGLFYSQSLPAILVGHIARRITQTDAVDLNSAPGGKTTHLAQM--G 218
            Y    + +          ++     +     R        D+ +     +   + +   
Sbjct: 3   QYPVIGIDDDEFATAKKLITKQEVRAVTLSKLRLQDDLVMWDIGAGSASVSIEASNLMPN 62

Query: 219 IRVIAVDRSAQKIEKLRSEAARLGLDVFIDILLHDSRYLDRDFPKIKAGVALVDPPCTDI 278
            R+ A++R+ Q +  +R    +       ++ L ++   +            +      +
Sbjct: 63  GRIFALERNPQYLGFIRDNLKKFV---ARNVTLVEAFAPEGLDDLPDPDRVFIGGSGGML 119

Query: 279 GVRPKIYHKV----TFEAAKTLARYQIQFLKTALKIAPYVIYSTCTLTYI---ENEGVIE 331
                   +            +    +      L+   Y++   C        E +    
Sbjct: 120 EEIIDAVDRRLKSEGVIVLNAVTLDTLTKAVEFLEDHGYMVEVACVNVAKTKGEYKMFES 179

Query: 332 KAGAEIVDA 340
                I+ A
Sbjct: 180 HNPVYIITA 188


>3c6mB [x.x.x] SPERMINE SYNTHASE
          Length = 342

 Score = 38.0 bits (87), Expect = 5e-05
 Identities = 18/229 (7%), Positives = 44/229 (19%), Gaps = 39/229 (17%)

Query: 166 KLRNLPEYAEGLFYSQSLPAILVGHIARRITQTDAVDLNSAPGGK-----------TTHL 214
            ++ L     G     S    L                    G                +
Sbjct: 130 NIKILHSKQFGNILILSGDVNLAESDLAYTRAIMGSGKEDYTGKDVLILGGGDGGILCEI 189

Query: 215 AQ-MGIRVIAVDRSAQKIEKLRSEAARL-------GLDVFIDILLHDSRYLDRD--FPKI 264
            +     V  V+     I+  +    +               +L+ D   + +       
Sbjct: 190 VKLKPKMVTMVEIDQMVIDGCKKYMRKTCGDVLDNLKGDCYQVLIEDCIPVLKRYAKEGR 249

Query: 265 KAGVALVDPPCTDIGVRPKIYHKVTFEAAKTLARYQIQFLKTALKIAPYVIYSTCTLTYI 324
           +    + D               ++  +     R  +      LK           +   
Sbjct: 250 EFDYVINDLTA----------VPISTSSTWEFLRLILDLSMKVLKQDGKYFTQGNCVNLT 299

Query: 325 ENEGVIEKAGAEIVDAGIEIGAPGWGCRECRRFLPHVHNTPGFFIAVLR 373
           E   + E+    +               +    +P       F+    +
Sbjct: 300 EALSLYEEQLGRLY--------CPVEFSKEIVCVPSYLELWVFYTVWKK 340


>3bgvB [x.x.x] MRNA CAP GUANINE-N7 METHYLTRANSFERASE
          Length = 271

 Score = 37.3 bits (85), Expect = 7e-05
 Identities = 13/187 (6%), Positives = 39/187 (20%), Gaps = 17/187 (9%)

Query: 201 VDLNSAPGGKTTHLAQ-MGIRVIAVDRSAQKIEKLRSEAARLGLDVFIDILLHDSRYLDR 259
           +DL    GG      +    +++  D +   +++ +     +      + +         
Sbjct: 32  LDLGCGKGGDLLKWKKGRINKLVCTDIADVSVKQCQQRYEDMKNRRDSEYIFSAEFITAD 91

Query: 260 DFPKIKAGVALVDPPCTDIGVRPKIYHKVTFEAAKTLARYQIQFLKTA---LKIAPYVIY 316
              ++       D              +     +          L+ A   L    Y I 
Sbjct: 92  SSKELLI-----DKFRDPQMCFDICSCQFVCHYSFESYEQADMMLRNACERLSPGGYFIG 146

Query: 317 STCTLTYIENEGVIEKAGAEIVDAGIEIGAPGWG--------CRECRRFLPHVHNTPGFF 368
           +T     +       +  +   +                          +P         
Sbjct: 147 TTPNSFELIRRLEASETESFGNEIYTVKFQKKGDYPLFGCKYDFNLEVDVPEFLVYFPLL 206

Query: 369 IAVLRGA 375
             + +  
Sbjct: 207 NEMAKKY 213


>3e05B [x.x.x] PRECORRIN-6Y C5,15-METHYLTRANSFERASE
          Length = 192

 Score = 37.3 bits (85), Expect = 8e-05
 Identities = 10/117 (8%), Positives = 32/117 (27%), Gaps = 3/117 (2%)

Query: 160 SLYRTPKLRNLPEYAEGLFYSQSLPAILVGHIARRITQTDAVDLNSAPGGKTTHLAQMG- 218
           + Y    + +          ++     +     R        D+ +     +   + +  
Sbjct: 1   AQYPVIGIDDDEFATAKKLITKQEVRAVTLSKLRLQDDLVMWDIGAGSASVSIEASNLMP 60

Query: 219 -IRVIAVDRSAQKIEKLRSEAARLGLDVFIDILLHDSRYLDRDFPKIKAGVALVDPP 274
             R+ A++R+ Q +  +R    +      + ++   +     D P            
Sbjct: 61  NGRIFALERNPQYLGFIRDNLKKFVAR-NVTLVEAFAPEGLDDLPDPDRVFIGGSGG 116


>3dxxA [x.x.x] TRNA (GUANINE-N(7)-)-METHYLTRANSFERASE
          Length = 208

 Score = 37.1 bits (85), Expect = 8e-05
 Identities = 15/127 (11%), Positives = 35/127 (27%), Gaps = 10/127 (7%)

Query: 201 VDLNSAPGGKTTHLAQM--GIRVIAVDRSAQKIEKLRSEAARLGLDVFIDILLHDSRYLD 258
           +++    G     +A+       + ++  +  +    + A   GL     +       L 
Sbjct: 34  LEIGFGMGASLVAMAKDRPEQDFLGIEVHSPGVGACLASAHEEGLSNLRVMCHDAVEVLH 93

Query: 259 RDFPKIKAGVALVDPPCTDIGVRPKIYHKVTFEAAKTLARYQIQFLKTALKIAPYVIYST 318
           +  P     +  +  P      R      V    A+ +           L++      +T
Sbjct: 94  KMIPDNSLRMVQLFFPDPWHKARHNKRRIVQVPFAELVKS--------KLQLGGVFHMAT 145

Query: 319 CTLTYIE 325
               Y E
Sbjct: 146 DWEPYAE 152


>3eeyB [x.x.x] PUTATIVE RRNA METHYLASE
          Length = 192

 Score = 37.0 bits (85), Expect = 9e-05
 Identities = 17/106 (16%), Positives = 28/106 (26%), Gaps = 4/106 (3%)

Query: 177 LFYSQSLPAILVGHIARRITQTDAVDLNSAPGGKTTHLAQMG---IRVIAVDRSAQKIEK 233
           L    SL                 VD     G  T  LA +     RV   D   + I  
Sbjct: 2   LTIKNSLGQSHDYIKMFVKEGDTVVDATCGNGNDTAFLASLVGENGRVFGFDIQDKAIAN 61

Query: 234 LRSEAARLGLDVFIDILLHDSRYLDRDFPKIKAGVALVDPPCTDIG 279
              +   L L   + ++    + +D  +        + +      G
Sbjct: 62  TTKKLTDLNLIDRVTLIKDGHQNMD-KYIDCPVKAVMFNLGYLPSG 106


>3dzbA [x.x.x] PREPHENATE DEHYDROGENASE
          Length = 281

 Score = 36.8 bits (84), Expect = 1e-04
 Identities = 15/151 (9%), Positives = 33/151 (21%), Gaps = 18/151 (11%)

Query: 214 LAQMGIRVIAVDRSAQKIEKLRSEAARLGLDVFIDILLHDSRYL-----DRDFPKIKAGV 268
                  ++  +RS                          +  +      +    +K   
Sbjct: 21  RDHPDYEILGYNRSDYSRNIALERGIVDRATGDFKEFAPLADVIILAVPIKQTAYLKELA 80

Query: 269 ALVDPPCTDIGVRPKIYHKVTFEAAKTLARYQIQFLKTALKIAPYV------IYSTCTLT 322
            L       I        ++   A + L    +QF+ +    +          Y   T T
Sbjct: 81  DLDLKDNVIITDAGSTKREIVEAAERYLTGKNVQFVGSHPAGSAADVTLFENAYYIFTPT 140

Query: 323 YIENEGVIEKA-------GAEIVDAGIEIGA 346
            +  E  I +         +  V+       
Sbjct: 141 SLTKETTIPELKDILSGLKSRYVEIDAAEHD 171


>3cbgA [x.x.x] O-METHYLTRANSFERASE
          Length = 218

 Score = 36.6 bits (83), Expect = 1e-04
 Identities = 18/206 (8%), Positives = 50/206 (24%), Gaps = 25/206 (12%)

Query: 172 EYAEGLFYSQSLPAILVGHIARRITQTDAVDLNSAPGGKTTHLAQM---GIRVIAVDRSA 228
                        A  +G +         +++    G     +A       ++IA D+  
Sbjct: 34  HLPGAPMQISPEQAQFLGLLISLTGAKQVLEIGVFRGYSALAMALQLPPDGQIIACDQDP 93

Query: 229 QKIEKLRSEAARLGLDVFIDILLHDSRYLDRDFPKIKAGVALVDPPCTDIGVRPKIYHKV 288
                 +    + G+   I + L  +                        G     +  +
Sbjct: 94  NATAIAKKYWQKAGVAEKISLRLGPALA---------------TLEQLTQGKPLPEFDLI 138

Query: 289 TFEAAKTLARYQIQFLKTALKIAPYVIYSTCTL-TYIENEGVIEKAGAEIVDAGIEIGAP 347
             +A K       +     L+    ++         +      E     +     ++   
Sbjct: 139 FIDADKRNYPRYYEIGLNLLRRGGLMVIDNVLWHGKVTEVDPQEAQTQVLQQFNRDLA-- 196

Query: 348 GWGCRECRRFLPHVHNTPGFFIAVLR 373
               ++ R  +  +    G  +A+ +
Sbjct: 197 ----QDERVRISVIPLGDGMTLALKK 218


>3c6mA [x.x.x] SPERMINE SYNTHASE
          Length = 336

 Score = 36.1 bits (82), Expect = 2e-04
 Identities = 18/192 (9%), Positives = 37/192 (19%), Gaps = 23/192 (11%)

Query: 166 KLRNLPEYAEGLFYSQSLPAILVGHIARRITQTDAVDLNSAPGGKTT------------H 213
            ++ L     G     S    L                    G                 
Sbjct: 127 NIKILHSKQFGNILILSGDVNLAESDLAYTRAIMGSGKEDYTGKDVLILGGGDGGILCEI 186

Query: 214 LAQMGIRVIAVDRSAQKIEKLRSEAARLGLDVFIDILLHDSRYLDRDFPKIKAGVALVDP 273
           +      V  V+     I+  +    +      +   L    Y       I         
Sbjct: 187 VKLKPKMVTMVEIDQMVIDGCKKYMRK--TCGDVLDNLKGDCYQVLIEDCIPVLKRYAKE 244

Query: 274 PCT-DIGVRPKIYHKVTFEAAKTLARYQIQFLKTALKIAP---YVIYSTCTLTYIENEGV 329
               D      + + +T     T   +    L  ++K+             +   E   +
Sbjct: 245 GREFDY-----VINDLTAVPISTTWEFLRLILDLSMKVLKQDGKYFTQGNCVNLTEALSL 299

Query: 330 IEKAGAEIVDAG 341
            E+    +    
Sbjct: 300 YEEQLGRLYCPV 311


>3dzbB [x.x.x] PREPHENATE DEHYDROGENASE
          Length = 270

 Score = 36.1 bits (82), Expect = 2e-04
 Identities = 12/150 (8%), Positives = 31/150 (20%), Gaps = 8/150 (5%)

Query: 214 LAQMGIRVIAVDRSAQKIEKLRSEAARLGLDVFIDILLHDSRYL-----DRDFPKIKAGV 268
                  ++  +RS                          +  +      +    +K   
Sbjct: 21  RDHPDYEILGYNRSDYSRNIALERGIVDRATGDFKEFAPLADVIILAVPIKQTAYLKELA 80

Query: 269 ALVDPPCTDIGVRPKIYHKVTFEAAKTLARYQIQFLKTALKIAPYVI---YSTCTLTYIE 325
            L       I        ++   A + L    +QF+ +    +       +      +  
Sbjct: 81  DLDLKDNVIITDAGSTKREIVEAAERYLTGKNVQFVGSHPAGSHAADVTLFENAYYIFTP 140

Query: 326 NEGVIEKAGAEIVDAGIEIGAPGWGCRECR 355
                E    E+ D    + +         
Sbjct: 141 TSLTKETTIPELKDILSGLKSRYVEIDAAE 170


>1d2hA [c.66.1] GLYCINE N-METHYLTRANSFERASE
          Length = 252

 Score = 36.0 bits (81), Expect = 2e-04
 Identities = 17/133 (12%), Positives = 39/133 (29%), Gaps = 4/133 (3%)

Query: 201 VDLNSAPGGKTTHLAQMGIRVIAVDRSAQKIEKLRSEAARLGLDVFIDILLHDSRYLDRD 260
           +D+    G  +  L + G  V +VD S + ++    E      +   D  + +       
Sbjct: 21  LDVACGTGVDSIMLVEEGFSVTSVDASDKMLKYALKERWNRRKEPAFDKWVIEEANWLTL 80

Query: 261 FPKIKAGVALVDPPCTDIGVRPKIYHKVTFEAAKTLARYQIQFLKTALKIAPYVIYSTCT 320
              + AG       C           K      +      ++ + + ++    ++     
Sbjct: 81  DKDVPAGDGFDAVICLGNSFAHLPDSKGDQSEHRLA----LKNIASMVRPGGLLVIDHKN 136

Query: 321 LTYIENEGVIEKA 333
             YI + G     
Sbjct: 137 YDYILSTGCAPPG 149


>2dpmA [c.66.1] PROTEIN (ADENINE-SPECIFIC METHYLTRANSFERASE
          Length = 258

 Score = 35.9 bits (81), Expect = 2e-04
 Identities = 11/134 (8%), Positives = 32/134 (23%), Gaps = 8/134 (5%)

Query: 207 PGGKTTHLAQMGIRVIAVDRSAQKIEKLRSEAARLGLDVFIDILLHDSRYLDRDFPKIKA 266
            G    +            ++ + +++    A  + ++     +     +          
Sbjct: 121 NGLYRVNSKNQFNVPYGRYKNPKIVDEELISAISVYINNNQLEIKVGD-FEKAIVDVRTG 179

Query: 267 GVALVDPPCTDIGVRPKIYHKVTFEAAKTLARYQIQFLKTALKIAPYVIYSTCTLTYIEN 326
                DPP   +            +  +          K       YV+ S  +   +E 
Sbjct: 180 DFVYFDPPYIPLFTSYTHEGFSFADQVRLRDA-----FKRLSDTGAYVMLSNSSSALVEE 234

Query: 327 EGVIEKAGAEIVDA 340
             + +      V+ 
Sbjct: 235 --LYKDFNIHYVEG 246


>3e05A [x.x.x] PRECORRIN-6Y C5,15-METHYLTRANSFERASE
          Length = 188

 Score = 35.8 bits (81), Expect = 2e-04
 Identities = 14/213 (6%), Positives = 40/213 (18%), Gaps = 29/213 (13%)

Query: 162 YRTPKLRNLPEYAEGLFYSQSLPAILVGHIARRITQTDAVDLNSAPGGKTTHLAQMGIRV 221
           Y    + +          ++     +     R        D+ +     +   + +    
Sbjct: 2   YPVIGIDDDEFATAKKLITKQEVRAVTLSKLRLQDDLVMWDIGAGSASVSIEASNLMPNG 61

Query: 222 IAVDRSAQKIEKLRSEAARLGL-DVFIDILLHDSRYLDRDFPKIKAGVALVDPPCTDIGV 280
                                     + ++   +     D P              +   
Sbjct: 62  RIFALERNPQYLGFIRDNLKKFVARNVTLVEAFAPEGLDDLPDPDRVFIGGSGGMLE--- 118

Query: 281 RPKIYHKVTFEAAKTLARYQIQFLKTALKIAPYVIYSTCTLTYIENEGVIEKAGAEIVDA 340
                     E    + R         LK    ++ +  TL  +       +   +    
Sbjct: 119 ----------EIIDAVDRR--------LKSEGVIVLNAVTLDTLTK---AVEFLEDHGYM 157

Query: 341 GIEIGAPGWGCRECRRFLPHVHNTPGFFIAVLR 373
                      +E + F     +    +I    
Sbjct: 158 VEVACVNVAKTKEYKMFE----SHNPVYIITAW 186


>3c0kA [x.x.x] UPF0064 PROTEIN YCCW
          Length = 386

 Score = 35.1 bits (79), Expect = 3e-04
 Identities = 28/221 (12%), Positives = 55/221 (24%), Gaps = 22/221 (9%)

Query: 158 EKSLYRTPKLRNLPEYAEGLFYSQSLPAILVGHIARRITQTDAVDLNSAPGGKTTHLAQM 217
               +    +     +  G +  Q    +              ++  S  GG        
Sbjct: 181 PIEEHGKLLVDIQHGHKTGYYLDQRDSRLATRRYVENKR---VLNCFSYTGGFAVSALGG 237

Query: 218 GIRVIAVDRSAQKIEKLRSEAARLGLDVFIDI---LLHDSRYLDRDFPKIKAGVALVDPP 274
             +V++VD S + ++  R       LD+                      K  V +  P 
Sbjct: 238 CSQVVSVDTSQEALDIARQNVELNKLDLSKAEFVRDDVFKLLRTYRDRGEKFDVIVDPPK 297

Query: 275 CTDIGVRPKIYHKVTFEAAKTLARYQIQFLKTALKIAPYVIYSTCTLTYIENEGVIEKAG 334
                     + +   +         I      L     ++  +C+    +    I    
Sbjct: 298 ----------FVENKSQLGACRGYKDINLAIQLLNEGGILLTFSCSGLTSDLFQKI---- 343

Query: 335 AEIVDAGIEIGAPGWGCRECRRFLPHVHNTPGFFIAVLRGA 375
             I DA I+ G       + R+   H           L+G 
Sbjct: 344 --IADAAIDAGRDVQFIEQFRQAADHPVIATYPEGLYLKGF 382


>3diiA [x.x.x] SHORT-CHAIN DEHYDROGENASE/REDUCTASE SDR
          Length = 239

 Score = 35.0 bits (79), Expect = 4e-04
 Identities = 8/78 (10%), Positives = 21/78 (26%), Gaps = 3/78 (3%)

Query: 213 HLAQMGIRVIAVDRSAQKIEKLRSEAARLGLDVFIDILLHDSRYLDRDFPKIKAGVALVD 272
              + G +V  +D   ++       A       +    + D   L +        +  +D
Sbjct: 20  DFLEAGDKVCFIDIDEKRSADF---AKERPNLFYFHGDVADPLTLKKFVEYAMEKLQRID 76

Query: 273 PPCTDIGVRPKIYHKVTF 290
               +      I   + +
Sbjct: 77  VLVNNACGSKGILSSLLY 94


>3b3gA [x.x.x] HISTONE-ARGININE METHYLTRANSFERASE CARM1
          Length = 324

 Score = 34.8 bits (78), Expect = 4e-04
 Identities = 11/76 (14%), Positives = 20/76 (26%), Gaps = 2/76 (2%)

Query: 201 VDLNSAPGGKTTHLAQMGIRVIAVDRSAQKIEKLRSEAARLGLDVFIDILLHDSR--YLD 258
           +D+    G  +   AQ G R I    ++   +          L   I ++        L 
Sbjct: 36  LDVGCGSGILSFFAAQAGARKIYAVEASTMAQHAEVLVKSNNLTDRIVVIPGKVEEVSLP 95

Query: 259 RDFPKIKAGVALVDPP 274
                I +        
Sbjct: 96  EQVDIIISEPMGYMLF 111


>1eizA [c.66.1] FTSJ
          Length = 180

 Score = 34.3 bits (77), Expect = 6e-04
 Identities = 18/161 (11%), Positives = 38/161 (23%), Gaps = 17/161 (10%)

Query: 201 VDLNSAPGGKTTHLAQM---GIRVIAVDRSAQKIEKLRSEAARLGLDVFIDILLHDSRYL 257
           VDL +APGG + ++        R+IA D                  D  +   L +    
Sbjct: 27  VDLGAAPGGWSQYVVTQIGGKGRIIACDLLPMDPIVGVDFLQGDFRDELVMKALLERVGD 86

Query: 258 DRDFPKIKAGVALVDPPCTDIGVRPKIYHKVTFEAAKTLARYQIQFLKTALKIAPYVIYS 317
            +    +    + + P  +              E         ++  +  L      +  
Sbjct: 87  SKVQVVM----SDMAPNMSGTPAVDIPRAMYLVEL-------ALEMCRDVLAPGGSFVVK 135

Query: 318 TCTLTYIENEGVIEKAGAEIVDAGIEIGAPGWGCRECRRFL 358
                  E      +    +              R    ++
Sbjct: 136 VFQ---GEGFDEYLREIRSLFTKVKVRKPDSSRARSREVYI 173


>3c3pC [x.x.x] METHYLTRANSFERASE
          Length = 190

 Score = 34.2 bits (77), Expect = 6e-04
 Identities = 12/124 (9%), Positives = 25/124 (20%), Gaps = 7/124 (5%)

Query: 141 MD-SDEALKARRGLYIKVEKSLYRTPKLRNLPEYAEGLFYSQSLPAILVGHIARRITQTD 199
           +   D  + A       +                   +         L+  +AR      
Sbjct: 1   IPIVDSRIGAY---LDGLLPEADPVVAAEQ-IARERNIPIVDRQTGRLLYLLARIKQPQL 56

Query: 200 AVDLNSAPGGKTTHLAQMG--IRVIAVDRSAQKIEKLRSEAARLGLDVFIDILLHDSRYL 257
            V      G  +   A+       + +D     +E  R       +D     +       
Sbjct: 57  VVVPGDGLGCASWWFARAISISSRVVIDPDRDNVEHARRLHDNGLIDRVELQVGDPLGIA 116

Query: 258 DRDF 261
               
Sbjct: 117 AGQR 120


>2aowA [x.x.x] HISTAMINE N-METHYLTRANSFERASE
          Length = 288

 Score = 34.0 bits (76), Expect = 7e-04
 Identities = 9/111 (8%), Positives = 33/111 (29%), Gaps = 1/111 (0%)

Query: 168 RNLPEYAEGLFYSQSLPAILVGHIARRITQTDAVDLNSAPGGKTTHLAQ-MGIRVIAVDR 226
            +  E+     +       ++G I    ++   + +    G     +   +  +   V  
Sbjct: 20  NHSTEHQCMQEFMDKKLPGIIGRIGDTKSEIKILSIGGGAGEIDLQILSKVQAQYPGVCI 79

Query: 227 SAQKIEKLRSEAARLGLDVFIDILLHDSRYLDRDFPKIKAGVALVDPPCTD 277
           + + +E    + A+    V     L + ++        +    +++     
Sbjct: 80  NNEVVEPSAEQIAKYKELVAKISNLENVKFAWHKETSSEYQSRMLEKKELQ 130


>2cmgA [x.x.x] SPERMIDINE SYNTHASE
          Length = 262

 Score = 33.9 bits (76), Expect = 8e-04
 Identities = 9/93 (9%), Positives = 22/93 (23%)

Query: 171 PEYAEGLFYSQSLPAILVGHIARRITQTDAVDLNSAPGGKTTHLAQMGIRVIAVDRSAQK 230
            +     F       +       +    + + ++         L +    +  V    + 
Sbjct: 47  RQLLFKNFLHIESELLAHMGGCTKKELKEVLIVDGFDLELAHQLFKYDTHIDFVQADEKI 106

Query: 231 IEKLRSEAARLGLDVFIDILLHDSRYLDRDFPK 263
           ++   S               H  + LD D  K
Sbjct: 107 LDSFISFFPHFHEVKNNKNFTHAKQLLDLDIKK 139


  Database: 95pdb09Oct16_0000
    Posted date:  Oct 27, 2009  4:27 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.319    0.136    0.379 

Gapped
Lambda     K      H
   0.267   0.0574    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 16,578,335
Number of extensions: 1021529
Number of successful extensions: 12061
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 5989
Number of HSP's successfully gapped: 184
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (20.8 bits)