RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 95pdb09Oct16_0000; 95pdb09Oct16_0001; 95pdb09Oct16_0002;
95pdb09Oct16_0003 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done

Query= AAL63125.1 paer1 AAL63125.1 GIB00076CH01 "conserved
hypothetical protein"
         (471 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

3dfuB [x.x.x] UNCHARACTERIZED PROTEIN FROM 6-PHOSPHOGLUCONATE          88   5e-20
1bobA [x.x.x] HISTONE ACETYLTRANSFERASE                                67   8e-14
3dfuA [x.x.x] UNCHARACTERIZED PROTEIN FROM 6-PHOSPHOGLUCONATE          66   3e-13
2cb6A [x.x.x] MOSQUITOCIDAL TOXIN                                      64   1e-12
3dcxA [x.x.x] PROTEIN OF UNKNOWN FUNCTION (DUF1696) WITH               63   2e-12
3ebjC [x.x.x] POLYMERASE ACIDIC PROTEIN                                58   6e-11
2e7sD [x.x.x] RAB GUANINE NUCLEOTIDE EXCHANGE FACTOR SEC2              55   4e-10
2e7sK [x.x.x] RAB GUANINE NUCLEOTIDE EXCHANGE FACTOR SEC2              46   2e-07
2a5hA [x.x.x] L-LYSINE 2,3-AMINOMUTASE                                 45   4e-07
3cl4A [x.x.x] HEMAGGLUTININ-ESTERASE                                   44   9e-07
2e7sB [x.x.x] RAB GUANINE NUCLEOTIDE EXCHANGE FACTOR SEC2              44   1e-06
2e7sH [x.x.x] RAB GUANINE NUCLEOTIDE EXCHANGE FACTOR SEC2              42   3e-06
3cl5A [x.x.x] HEMAGGLUTININ-ESTERASE                                   42   4e-06
2a5hB [x.x.x] L-LYSINE 2,3-AMINOMUTASE                                 40   1e-05
1cm0B [d.108.1] P300/CBP ASSOCIATING FACTOR                            40   1e-05
2e7sN [x.x.x] RAB GUANINE NUCLEOTIDE EXCHANGE FACTOR SEC2              40   2e-05
3efaA [x.x.x] PUTATIVE ACETYLTRANSFERASE                               40   2e-05
3dntA [x.x.x] PROTEIN HIPA                                             39   3e-05
2a6aB [x.x.x] HYPOTHETICAL PROTEIN TM0874                              38   4e-05
2b4bA [x.x.x] DIAMINE ACETYLTRANSFERASE 1                              38   4e-05
2b3uB [x.x.x] DIAMINE ACETYLTRANSFERASE 1                              38   4e-05
2b3uA [x.x.x] DIAMINE ACETYLTRANSFERASE 1                              38   5e-05
1cm0A [d.108.1] P300/CBP ASSOCIATING FACTOR                            38   5e-05
3cb8A [x.x.x] PYRUVATE FORMATE-LYASE 1-ACTIVATING ENZYME               38   7e-05
2bswA [x.x.x] GLYPHOSATE N-ACETYLTRANSFERASE                           38   8e-05
3ec4A [x.x.x] PUTATIVE ACETYLTRANSFERASE FROM THE GNAT FAMILY          37   8e-05
3d2pA [x.x.x] PUTATIVE ACETYLGLUTAMATE SYNTHASE                        37   1e-04
2b5gB [x.x.x] DIAMINE ACETYLTRANSFERASE 1                              37   1e-04
2b3vA [x.x.x] DIAMINE ACETYLTRANSFERASE 1                              37   1e-04
1b6bA [d.108.1] PROTEIN (ARYLALKYLAMINE N-ACETYLTRANSFERASE)           37   1e-04
3cixA [x.x.x] FEFE-HYDROGENASE MATURASE                                37   1e-04
3c8fA [x.x.x] PYRUVATE FORMATE-LYASE 1-ACTIVATING ENZYME               37   1e-04
2b4dB [x.x.x] DIAMINE ACETYLTRANSFERASE 1                              36   2e-04
1cjwA [d.108.1] PROTEIN (SEROTONIN N-ACETYLTRANSFERASE)                36   2e-04
2b4dA [x.x.x] DIAMINE ACETYLTRANSFERASE 1                              36   3e-04
2bw2A [x.x.x] BYPASS OF FORESPORE C                                    35   4e-04
3bj8A [x.x.x] DIAMINE ACETYLTRANSFERASE 1                              35   5e-04
2beiB [x.x.x] DIAMINE ACETYLTRANSFERASE 2                              35   5e-04

>3dfuB [x.x.x] UNCHARACTERIZED PROTEIN FROM 6-PHOSPHOGLUCONATE
          Length = 222

 Score = 88.0 bits (217), Expect = 5e-20
 Identities = 22/170 (12%), Positives = 48/170 (28%), Gaps = 9/170 (5%)

Query: 21  CTFCPSSADAPKSYMPDSPVVLRAKRNRYDPYLQTAGRIKVYIENGHTPSKIEAVIMGGT 80
                    +    +   P+          P  Q         E G T   +    +GG+
Sbjct: 62  ARRGQFLHTSLTHGITVDPLETSGGIVSAHPIGQDRWVASALDELGETIVGLLVGELGGS 121

Query: 81  FSALPRGYREWFVANIYKALNDFPHWTSSADPTPNLEAEQIRNETAELRMVALTVETRPD 140
              +    R    A +  A                  +  +     +  + +  V++   
Sbjct: 122 IVEIADDKRAQLAAALTYAGFLSTLQ--------RDASYFLDEFLGDPDVTSDIVDSAQQ 173

Query: 141 FINKAEVDFLLKLGVTRVELGVQSIYDDVLQKVKRGHGAAEVVEATAILK 190
           F     +D ++    +    G Q ++ D+ ++      A + +E  AI K
Sbjct: 174 FQALPSLDEVIAQYDSINNPGRQRLFRDLARRQAEISRAQD-IELWAIQK 222


>1bobA [x.x.x] HISTONE ACETYLTRANSFERASE
          Length = 306

 Score = 67.4 bits (163), Expect = 8e-14
 Identities = 20/268 (7%), Positives = 61/268 (22%), Gaps = 32/268 (11%)

Query: 207 SDPDRDLEMVREIFSNPSYMPDC-----VKIYPLYVVPNTELSEDWRRGLYKSYDEETWL 261
           S    +      +F+ P Y           +       +                ++  +
Sbjct: 17  SIVGENAVQFSPLFTYPIYGDSEKIYGYKDLIIHLAFDSVTFKPYVNVKYSAKLGDDNIV 76

Query: 262 ELLAKIYASIPRWVRVMRFGRDIPLHHVLDGPRWGNMRQIVLKHMERLGLKCQEIRCREV 321
           ++  K+ + +P+   ++R   +          R  +    V + +    L  +E    + 
Sbjct: 77  DVEKKLLSFLPKDDVIVR--DEAKWVDCFAEERKTHNLSDVFEKVSEYSLNGEEFVVYKS 134

Query: 322 G---------IKLANNVPIQPGPVEVKKTEYEASGGLEIFLEAVGPDDTLYAILRLRIPN 372
                      +      +          E + S  +   L     +   +         
Sbjct: 135 SLVDDFARRMHRRVQIFSLLFIEAANYIDETDPSWQIYWLLNKKTKELIGFVTTYKYWHY 194

Query: 373 RPHRPELYKAALVRELHVYGPAVPVGKQGIWWQHSGMGRELMRLAEEIAGEFGALKIAVI 432
              +             +    +        +Q+ G G  L     +   E  ++    +
Sbjct: 195 IDKK---------FRAKISQFLI-----FPPYQNKGHGSCLYEAIIQSWLEDKSITEITV 240

Query: 433 --SGVGVREYYRKLGYERCGPYMCKPLG 458
                   +   +   +R        + 
Sbjct: 241 EDPNEAFDDLRDRNDIQRLRKLGYDAVF 268


>3dfuA [x.x.x] UNCHARACTERIZED PROTEIN FROM 6-PHOSPHOGLUCONATE
          Length = 223

 Score = 65.6 bits (159), Expect = 3e-13
 Identities = 16/115 (13%), Positives = 39/115 (33%), Gaps = 9/115 (7%)

Query: 77  MGGTFSALPRGYREWFVANIYKALNDFPHWTSSADPTPNLEAEQIRNETAELRMVALTVE 136
           +GG+   +    R    A +  A                  +  +     +  + +  V+
Sbjct: 118 LGGSIVEIADDKRAQLAAALTYAGFLSTLQR--------DASYFLDEFLGDPDVTSDIVD 169

Query: 137 TRPDFINKAEVDFLLKLGVTRVELGVQSIYDDVLQKVKRGHGAAEVVEATAILKD 191
           +   F     +D ++    +    G Q ++ D+ ++      A + +E  AI K+
Sbjct: 170 SAQQFQALPSLDEVIAQYDSINNPGRQRLFRDLARRQAEISRAQD-IELWAIQKE 223


>2cb6A [x.x.x] MOSQUITOCIDAL TOXIN
          Length = 238

 Score = 63.6 bits (154), Expect = 1e-12
 Identities = 16/168 (9%), Positives = 39/168 (23%), Gaps = 23/168 (13%)

Query: 49  YDPYLQTAGRIKVYIENGHTPSKIEAVIMGGTFSALPRGYREWFVANIYKALNDFPHWTS 108
              YL+T              + +   I   T  +        +       ++       
Sbjct: 87  LLNYLRTNSPSIFVSTTRARYNNLGLEITPWTPHSANNNIIYRYEIFAPGGIDINA---- 142

Query: 109 SADPTPNLEAEQIRNETAELRMVALTVETRPDFINKAEVDFLLKLG---VTRVELGVQSI 165
               + N      ++E            T P  I    +    +     + R+ +    I
Sbjct: 143 --SFSRNHNPFPNQDEI-----------TFPGGIRPEFIRSTYEYHNGEIVRIWINPNFI 189

Query: 166 YDDVLQKVKRGHGAAEVVEATAILKDSAYK-VCYHVMPGLPGSDPDRD 212
               L  V      ++V       + +      + +    P  +   +
Sbjct: 190 NPSTLNDVSGPSNISKVFWHENHSEGNNMDSQDFDMF--APNGEIPNN 235


>3dcxA [x.x.x] PROTEIN OF UNKNOWN FUNCTION (DUF1696) WITH
          Length = 114

 Score = 63.0 bits (153), Expect = 2e-12
 Identities = 11/119 (9%), Positives = 30/119 (25%), Gaps = 11/119 (9%)

Query: 154 GVTRVELGVQSIYDDVLQKVKRGHGAAEVVEATAILKDSAYK-VCYHVMPGLPGSDPDRD 212
           G    E+ +  +     Q++       ++  A  +++D  +      ++     +     
Sbjct: 1   GGNAAEVNLDEL----AQELGPIGDNEQLALAYRVIRDFVFTNKRLILIDKQGVTGKKVS 56

Query: 213 LEMVREIFSNPSYMPDCVKIYPLYVVPNTELSEDWRRGLYKSYDEETWLELLAKIYASI 271
              V              ++       + EL             E      +  I  +I
Sbjct: 57  YHSVPYK------AITHFEVETAGTFDDAELKLWISGQKDPLVKELKKGTDVVGIQKTI 109


>3ebjC [x.x.x] POLYMERASE ACIDIC PROTEIN
          Length = 176

 Score = 57.8 bits (139), Expect = 6e-11
 Identities = 9/123 (7%), Positives = 20/123 (16%), Gaps = 11/123 (8%)

Query: 136 ETRPDFINKAEVDFLLKLGVTRVEL---GVQSIYDDVLQKVKRGHGAAEVVEATAILKDS 192
           E       +       K       L    + S   ++++   R      V          
Sbjct: 21  EKAMKEYGEDPKIETNKFAAICTHLEVCFMYSHRFEIIEGRDRTMAWTVVNSICNTTGVE 80

Query: 193 AYKVCYHVMPGLPGSD------PDRDLEMVREIFSNPSYMPDCVKIYPLYVVPNTELSED 246
             K    +                       E  +          I+          ++ 
Sbjct: 81  KPKFLPDLYDYKENRFIEIGVTRREVHTYYLEKANKIKSEKT--HIHIFSFTGEEMATKA 138

Query: 247 WRR 249
              
Sbjct: 139 DYT 141


>2e7sD [x.x.x] RAB GUANINE NUCLEOTIDE EXCHANGE FACTOR SEC2
          Length = 122

 Score = 55.0 bits (132), Expect = 4e-10
 Identities = 4/83 (4%), Positives = 26/83 (31%), Gaps = 5/83 (6%)

Query: 112 PTPNLEA--EQIRNETAELRMVALTVETRPDFINKAEVDFLLKLG--VTRVELGVQSIYD 167
              +      ++ +   E++ +   +  + + +     +   KL   V  +   +    +
Sbjct: 25  LKEDYNTLKRELSDRDDEVKRLREDIA-KENELRTKAEEEADKLNKEVEDLTASLFDEAN 83

Query: 168 DVLQKVKRGHGAAEVVEATAILK 190
           +++   +  +    + +      
Sbjct: 84  NLVADAREKYAIEILNKRLTEQL 106


>2e7sK [x.x.x] RAB GUANINE NUCLEOTIDE EXCHANGE FACTOR SEC2
          Length = 115

 Score = 45.9 bits (109), Expect = 2e-07
 Identities = 4/75 (5%), Positives = 25/75 (33%), Gaps = 3/75 (4%)

Query: 118 AEQIRNETAELRMVALTVETRPDFINKAEVDFLLKLG--VTRVELGVQSIYDDVLQKVKR 175
             ++ +   E++ +   +  + + +     +   KL   V  +   +    ++++   + 
Sbjct: 33  KRELSDRDDEVKRLREDI-AKENELRTKAEEEADKLNKEVEDLTASLFDEANNLVADARE 91

Query: 176 GHGAAEVVEATAILK 190
            +    + +      
Sbjct: 92  KYAIEILNKRLTEQL 106


>2a5hA [x.x.x] L-LYSINE 2,3-AMINOMUTASE
          Length = 400

 Score = 45.4 bits (106), Expect = 4e-07
 Identities = 29/283 (10%), Positives = 58/283 (20%), Gaps = 61/283 (21%)

Query: 17  CPGRCTFCPSSADAPKSYMPDSPVVLRAKRNRYDPYLQTAGRIKVYIENGHTPSKIEAVI 76
               C  C     A +S      +       R  P ++                  + ++
Sbjct: 120 DCSYCRHCTRRRFAGQSDDSPERIDKAIDYIRNTPQVR------------------DVLL 161

Query: 77  MGGTFSALPRGYREWFVANIYKALNDFPHWTSSADPTPNLEAEQIRNETAELRMVALTVE 136
            GG          +  +  I   L + PH                           + + 
Sbjct: 162 SGGD----ALLVSDETLEYIIAKLREIPHV------------------------EIVRIG 193

Query: 137 TRPDFINKAEVDFLLKLGVTRVELGVQSIYDDVLQKVKRGHGAAEVVEATAILKDSAYKV 196
           +R   +    +          V L                    E   A  +L D+   +
Sbjct: 194 SRTPVVLPQRITP------ELVNLKKYHPVWLNTHFNHPNEITEESTRACQLLADAGVPL 247

Query: 197 CYHVMPGLPGSDPDRDLEMVREIFSNPSYMPDCVKIYPLYVVPNTELSEDWRRGLYKSYD 256
               +     +D     E+V ++            IY   +    E              
Sbjct: 248 GNQSVLLRGVNDCVHVKELVNKLVKIR---VRPYYIYQCDLSLGLEHFRTPV------SK 298

Query: 257 EETWLELLAKIYASIPRWVRVMRFGRDIPLHHVLDGPRWGNMR 299
               +E L    +       V+          V +     +  
Sbjct: 299 GIEIIEGLRGHTSGYCVPTFVVDAPGGGGKTPVPNYVISQSHD 341


>3cl4A [x.x.x] HEMAGGLUTININ-ESTERASE
          Length = 358

 Score = 44.0 bits (102), Expect = 9e-07
 Identities = 11/184 (5%), Positives = 28/184 (15%), Gaps = 47/184 (25%)

Query: 5   VHVVALMTQPFPCPGRCTFCPSSADAPKSYMPDSPVVLRAKRNRYDPYLQTAGRIKVYIE 64
             + +  T        C +    +    +   +  + +                    I 
Sbjct: 215 YGLNSTETITTGFDFNCHYLVLPSGNYLAISNELLLTV----------------PTKAIC 258

Query: 65  NGHTPSKIEAVIMGGTFSALPRGYREWFVANIYKALNDFPHWTSSADPTPNLEAEQIRNE 124
                   +         +  R        N+                       Q    
Sbjct: 259 LNKR----KDFTPVQVVDS--RWNNARQSDNMTAVA------------------CQPPYC 294

Query: 125 TAELRMVALTVETRPDFINKAEVDFLLKL------GVTRVELGVQSIYDDVLQKV-KRGH 177
                          +  +      L  L         +      ++          R  
Sbjct: 295 YFRNSTTNYVGVYDINHGDAGFTSILSGLLYDSPCFSQQGVFRYDNVSSVWPLYSYGRCP 354

Query: 178 GAAE 181
            AA+
Sbjct: 355 TAAD 358


>2e7sB [x.x.x] RAB GUANINE NUCLEOTIDE EXCHANGE FACTOR SEC2
          Length = 119

 Score = 43.6 bits (103), Expect = 1e-06
 Identities = 4/76 (5%), Positives = 24/76 (31%), Gaps = 3/76 (3%)

Query: 118 AEQIRNETAELRMVALTVETRPDFINKAEVDFLLKLG--VTRVELGVQSIYDDVLQKVKR 175
             ++ +   E++ +      + + +     +   KL   V  +   +    ++++   + 
Sbjct: 33  KRELSDRDDEVKRLRED-IAKENELRTKAEEEADKLNKEVEDLTASLFDEANNLVADARE 91

Query: 176 GHGAAEVVEATAILKD 191
            +    + +       
Sbjct: 92  KYAIEILNKRLTEQLR 107


>2e7sH [x.x.x] RAB GUANINE NUCLEOTIDE EXCHANGE FACTOR SEC2
          Length = 106

 Score = 42.5 bits (100), Expect = 3e-06
 Identities = 4/70 (5%), Positives = 25/70 (35%), Gaps = 3/70 (4%)

Query: 118 AEQIRNETAELRMVALTVETRPDFINKAEVDFLLKLG--VTRVELGVQSIYDDVLQKVKR 175
             ++ +   E++ +   +  + + +     +   KL   V  +   +    ++++   + 
Sbjct: 33  KRELSDRDDEVKRLREDI-AKENELRTKAEEEADKLNKEVEDLTASLFDEANNLVADARE 91

Query: 176 GHGAAEVVEA 185
            +    + + 
Sbjct: 92  KYAIEILNKR 101


>3cl5A [x.x.x] HEMAGGLUTININ-ESTERASE
          Length = 358

 Score = 41.9 bits (97), Expect = 4e-06
 Identities = 11/172 (6%), Positives = 25/172 (14%), Gaps = 47/172 (27%)

Query: 17  CPGRCTFCPSSADAPKSYMPDSPVVLRAKRNRYDPYLQTAGRIKVYIENGHTPSKIEAVI 76
               C +    +    +   +  +                 + K +       S      
Sbjct: 227 FDFNCHYLVLPSGNYLAISNELLL-------TVPTKAICLNKRKDFTPVQVVDS------ 273

Query: 77  MGGTFSALPRGYREWFVANIYKALNDFPHWTSSADPTPNLEAEQIRNETAELRMVALTVE 136
                    R        N+                       Q                
Sbjct: 274 ---------RWNNARQSDNMTAVA------------------CQPPYCYFRNSTTNYVGV 306

Query: 137 TRPDFINKAEVDFLLKL------GVTRVELGVQSIYDDVLQKV-KRGHGAAE 181
              +  +      L  L         +      ++          R   AA+
Sbjct: 307 YDINHGDAGFTSILSGLLYDSPCFSQQGVFRYDNVSSVWPLYSYGRCPTAAD 358


>2a5hB [x.x.x] L-LYSINE 2,3-AMINOMUTASE
          Length = 401

 Score = 40.4 bits (93), Expect = 1e-05
 Identities = 27/282 (9%), Positives = 56/282 (19%), Gaps = 63/282 (22%)

Query: 17  CPGRCTFCPSSADAPKSYMPDSPVVLRAKRNRYDPYLQTAGRIKVYIENGHTPSKIEAVI 76
               C  C     A +S      +       R  P ++                  + ++
Sbjct: 120 DCSYCRHCTRRRFAGQSDDSPERIDKAIDYIRNTPQVR------------------DVLL 161

Query: 77  MGGTFSALPRGYREWFVANIYKALNDFPHWTSSADPTPNLEAEQIRNETAELRMVALTVE 136
            GG    +     E+ +A + +  +       S  P    +                   
Sbjct: 162 SGGDALLVSDETLEYIIAKLREIPHVEIVRIGSRTPVVLPQ------------------- 202

Query: 137 TRPDFINKAEVDFLLKLGVTRVELGVQSIYDDVLQKVKRGHGAAEVVEATAILKDSAYKV 196
                     +   L        +                    E   A  +L D+   +
Sbjct: 203 ---------RITPELVNLKKYHPV------WLNTHFNHPNEITEESTRACQLLADAGVPL 247

Query: 197 CYHVMPGLPGSDPDRDLEMVREIFSNPSYMPDCVKIYPLYVVPNTELSEDWRRGLYKSYD 256
               +     +D     E+V ++            IY   +    E              
Sbjct: 248 GNQSVLLRGVNDCVHVKELVNKLVKIR---VRPYYIYQCDLSLGLEHFRTPV------SK 298

Query: 257 EETWLELLAKIYASIPRWVRVMRF--GRDIPLHHVLDGPRWG 296
               +E L    +       V+    G            +  
Sbjct: 299 GIEIIEGLRGHTSGYCVPTFVVDAPGGGGKTPVPNYVISQSH 340


>1cm0B [d.108.1] P300/CBP ASSOCIATING FACTOR
          Length = 161

 Score = 40.2 bits (93), Expect = 1e-05
 Identities = 10/67 (14%), Positives = 20/67 (29%)

Query: 403 WWQHSGMGRELMRLAEEIAGEFGALKIAVISGVGVREYYRKLGYERCGPYMCKPLGAPLG 462
             Q  G G  LM   +E   +   L     +      Y++K G+ +            + 
Sbjct: 88  NEQVKGYGTHLMNHLKEYHIKHDILNFLTYADEYAIGYFKKQGFSKEIKIPKTKYVGYIK 147

Query: 463 VADDGLV 469
             +   +
Sbjct: 148 DYEGATL 154


>2e7sN [x.x.x] RAB GUANINE NUCLEOTIDE EXCHANGE FACTOR SEC2
          Length = 110

 Score = 39.8 bits (93), Expect = 2e-05
 Identities = 4/70 (5%), Positives = 25/70 (35%), Gaps = 3/70 (4%)

Query: 118 AEQIRNETAELRMVALTVETRPDFINKAEVDFLLKLG--VTRVELGVQSIYDDVLQKVKR 175
             ++ +   E++ +   +  + + +     +   KL   V  +   +    ++++   + 
Sbjct: 33  KRELSDRDDEVKRLREDI-AKENELRTKAEEEADKLNKEVEDLTASLFDEANNLVADARE 91

Query: 176 GHGAAEVVEA 185
            +    + + 
Sbjct: 92  KYAIEILNKR 101


>3efaA [x.x.x] PUTATIVE ACETYLTRANSFERASE
          Length = 143

 Score = 39.6 bits (92), Expect = 2e-05
 Identities = 12/49 (24%), Positives = 21/49 (42%)

Query: 404 WQHSGMGRELMRLAEEIAGEFGALKIAVISGVGVREYYRKLGYERCGPY 452
           ++  G GR+L+  AEE A + G     +   +  + +Y   GY      
Sbjct: 80  YRGHGWGRQLLTAAEEWATQRGFTHGEIHGELTAQRFYELCGYRVTAGP 128


>3dntA [x.x.x] PROTEIN HIPA
          Length = 405

 Score = 38.9 bits (89), Expect = 3e-05
 Identities = 22/294 (7%), Positives = 54/294 (18%), Gaps = 52/294 (17%)

Query: 15  FPCPGRCTFC--PSSADAPKSYMPDSPVVLRAKRNRYDPYLQTAGRIKVYIENGHTPSKI 72
               G  TF   P    +  +      + L+      D        +             
Sbjct: 16  KLANGAHTFKYAPEWLASRYARPLSLSLPLQRGNITSDAVFNFFDNLLPDSPI------- 68

Query: 73  EAVIMGGTFSALPRGYREWFVANIYKALNDFPHWTSSADPTPNLEAEQIRNETAELRMVA 132
               +   +              + +   D     +          E             
Sbjct: 69  VRDRIVKRY----HAKSRQPFDLLSEIGRDSVGAVTLIPIAWEKLTE------------- 111

Query: 133 LTVETRPDFINKAEVDFLLKLGVTRVELGVQSIYDDVLQKVKRGHGAAEVVEATAILKDS 192
                       A ++ +L      + LG++    +   ++       +           
Sbjct: 112 ------------ARLEEVLTAYKADIPLGIRE---ENDFRISVAGAQEKTALLRIGNDWC 156

Query: 193 AYK--VCYHVMPGLPG---SDPDRDLEMVREI----FSNPSYMPDCVKIYPLYVVPNTEL 243
             K       +  LP     +    L + +E+              V+   +        
Sbjct: 157 IPKGITPTTHIIKLPIQSVDNEYYCLLLAKELGLNVPDAEIIKAGNVRALAVERFDRRWN 216

Query: 244 SEDWRRGLYKSYDEETWLELLAKIYASIPRWVRVMRFGRDIPLHHVLDGPRWGN 297
           +E       +   E+     L             +     +     L       
Sbjct: 217 AERTVL--LRLPQEDCQTFGLPSSVKYESDGGPGIARIAFLGSSEALKDRYDFK 268


>2a6aB [x.x.x] HYPOTHETICAL PROTEIN TM0874
          Length = 186

 Score = 38.5 bits (89), Expect = 4e-05
 Identities = 17/155 (10%), Positives = 35/155 (22%), Gaps = 22/155 (14%)

Query: 301 IVLKHMERLGLKCQEIRCREVGIKLANNVPIQPG--PVEVKKTEYEASGGLEIFLEAVGP 358
           +V K ++ L LK +++    VGI       ++ G   V    + Y+         E    
Sbjct: 40  VVKKLLDELDLKVKDLDVVGVGIGPGGLTGLRVGIATVVGLVSPYDIPVAPLNSFETA-K 98

Query: 359 DDTLYAILRLRIPNRPHRPELYKAALVRELHVYGPAVPVGKQGIWWQHSGMGRELMRLAE 418
                 ++ +    R            +                          +     
Sbjct: 99  SCPADGVVLVARRARKGYHYCAVYLKDKG----------------LNPLKEPSVVSDEEL 142

Query: 419 EIAGEFGALKIAVI---SGVGVREYYRKLGYERCG 450
           E   +  + KI +                   R  
Sbjct: 143 EEITKEFSPKIVLKDDLLISPAVLVEESERLFREK 177


>2b4bA [x.x.x] DIAMINE ACETYLTRANSFERASE 1
          Length = 162

 Score = 38.4 bits (88), Expect = 4e-05
 Identities = 7/49 (14%), Positives = 19/49 (38%), Gaps = 1/49 (2%)

Query: 403 WWQHSGMGRELMRLAEEIAGEFGALKIAVISG-VGVREYYRKLGYERCG 450
            ++  G+G E+++   ++A    +    V         +Y++ G     
Sbjct: 93  DYRGFGIGSEILKNLSQVARCRCSSHFLVAEWNEPSINFYKRRGASDLS 141


>2b3uB [x.x.x] DIAMINE ACETYLTRANSFERASE 1
          Length = 158

 Score = 38.4 bits (88), Expect = 4e-05
 Identities = 7/49 (14%), Positives = 19/49 (38%), Gaps = 1/49 (2%)

Query: 403 WWQHSGMGRELMRLAEEIAGEFGALKIAVISG-VGVREYYRKLGYERCG 450
            ++  G+G E+++   ++A    +    V         +Y++ G     
Sbjct: 90  DYRGFGIGSEILKNLSQVARCRCSSHFLVAEWNEPSINFYKRRGASDLS 138


>2b3uA [x.x.x] DIAMINE ACETYLTRANSFERASE 1
          Length = 157

 Score = 38.3 bits (88), Expect = 5e-05
 Identities = 8/56 (14%), Positives = 20/56 (35%), Gaps = 1/56 (1%)

Query: 404 WQHSGMGRELMRLAEEIAGEFGALKIAVISG-VGVREYYRKLGYERCGPYMCKPLG 458
           ++  G+G E+++   ++A    +    V         +Y++ G           L 
Sbjct: 90  YRGFGIGSEILKNLSQVARCRCSSHFLVAEWNEPSINFYKRRGASDLSSEEGWRLF 145


>1cm0A [d.108.1] P300/CBP ASSOCIATING FACTOR
          Length = 162

 Score = 38.2 bits (88), Expect = 5e-05
 Identities = 10/48 (20%), Positives = 17/48 (35%)

Query: 403 WWQHSGMGRELMRLAEEIAGEFGALKIAVISGVGVREYYRKLGYERCG 450
             Q  G G  LM   +E   +   L     +      Y++K G+ +  
Sbjct: 88  NEQVKGYGTHLMNHLKEYHIKHDILNFLTYADEYAIGYFKKQGFSKEI 135


>3cb8A [x.x.x] PYRUVATE FORMATE-LYASE 1-ACTIVATING ENZYME
          Length = 244

 Score = 37.8 bits (86), Expect = 7e-05
 Identities = 13/135 (9%), Positives = 37/135 (27%), Gaps = 3/135 (2%)

Query: 135 VETRPDFINKAEVDFLLKLGVTRVELGVQSIYDDVLQKVKRGHGAAEVVEATAILKDSAY 194
           ++T         V   L      V L ++ + D++ Q +        +  A  +   +  
Sbjct: 102 LDTNGFVRRYDPVIDELLEVTDLVMLDLKQMNDEIHQNLVGVSNHRTLEFAKYLANKNVK 161

Query: 195 KVCYHVMPGLPGSDPDRDLEMVREIFSNPSYMPDCVKIYPLYVVPNTELSEDWRRGLYKS 254
               +V+      D D    +            + +++ P + +   +            
Sbjct: 162 VWIRYVVVPGWSDDDDSAHRLGEFTRDMG--NVEKIELLPYHELGKHKWVAMGEEYKLDG 219

Query: 255 YDEETWLELLAKIYA 269
                  E + ++  
Sbjct: 220 VKPPKK-ETMERVKG 233


>2bswA [x.x.x] GLYPHOSATE N-ACETYLTRANSFERASE
          Length = 142

 Score = 37.5 bits (86), Expect = 8e-05
 Identities = 14/50 (28%), Positives = 23/50 (46%)

Query: 403 WWQHSGMGRELMRLAEEIAGEFGALKIAVISGVGVREYYRKLGYERCGPY 452
            ++    G  L++ AEEI  + GA  +   +      YY+KLG+   G  
Sbjct: 77  GYREQKAGSSLIKHAEEILRKRGADLLWCNARTSASGYYKKLGFSEQGEV 126


>3ec4A [x.x.x] PUTATIVE ACETYLTRANSFERASE FROM THE GNAT FAMILY
          Length = 218

 Score = 37.5 bits (86), Expect = 8e-05
 Identities = 7/50 (14%), Positives = 14/50 (28%), Gaps = 1/50 (2%)

Query: 404 WQHSGMGRELMRLAEEIAGEFGALKIAVISG-VGVREYYRKLGYERCGPY 452
           ++  G+   L+R     A       +   +        Y  LG+      
Sbjct: 161 YRGRGLAARLIRKVIAGAARGEVPYLHSYASNASAIRLYESLGFRARRAT 210


>3d2pA [x.x.x] PUTATIVE ACETYLGLUTAMATE SYNTHASE
          Length = 424

 Score = 37.2 bits (85), Expect = 1e-04
 Identities = 22/202 (10%), Positives = 50/202 (24%), Gaps = 28/202 (13%)

Query: 255 YDEETWLELLAKIYASIPRWVRVMRFGRDIPLHHVLDGPR------WGNMRQIVLKHMER 308
            + ++  E  A     +         G    +  +                 I     + 
Sbjct: 221 QEAQSLAEHAASETRRLISSAVAALEGGVHRVQILNGAADGSLLQELFTRNGIGTSIAKE 280

Query: 309 LGLKCQEIRCREVGIKLANNVPIQPGPVEVKKTEYEASGGLEIFLEAVGPDDTLYAILRL 368
             +  ++    ++    A  +      +   +   E        LE    D  LY    L
Sbjct: 281 AFVSIRQAHSGDIPHIAA--LIRPLILLHRSREYLENHISEFSILEH---DGNLYGCAAL 335

Query: 369 RIPNRPHRPELYKAALVRELHVYGPAVPVGKQGIWWQHSGMGRELMRLAEEIAGEFGALK 428
           +        E+   A+  +                 Q  G G  L+    + A   G  +
Sbjct: 336 KTFAEADCGEIACLAVSPQ----------------AQDGGYGERLLAHIIDKARGIGISR 379

Query: 429 IAVISGVGVREYYRKLGYERCG 450
           +         E++ + G++   
Sbjct: 380 L-FALSTNTGEWFAERGFQTAS 400


>2b5gB [x.x.x] DIAMINE ACETYLTRANSFERASE 1
          Length = 153

 Score = 37.2 bits (85), Expect = 1e-04
 Identities = 7/51 (13%), Positives = 19/51 (37%), Gaps = 1/51 (1%)

Query: 403 WWQHSGMGRELMRLAEEIAGEFGALKIAVISG-VGVREYYRKLGYERCGPY 452
            ++  G+G E+++   ++A    +    V         +Y++ G       
Sbjct: 85  DYRGFGIGSEILKNLSQVARCRCSSHFLVAEWNEPSINFYKRRGASDLSSE 135


>2b3vA [x.x.x] DIAMINE ACETYLTRANSFERASE 1
          Length = 161

 Score = 37.2 bits (85), Expect = 1e-04
 Identities = 7/49 (14%), Positives = 19/49 (38%), Gaps = 1/49 (2%)

Query: 403 WWQHSGMGRELMRLAEEIAGEFGALKIAVISG-VGVREYYRKLGYERCG 450
            ++  G+G E+++   ++A    +    V         +Y++ G     
Sbjct: 93  DYRGFGIGSEILKNLSQVARCRCSSHFLVAEWNEPSINFYKRRGASDLS 141


>1b6bA [d.108.1] PROTEIN (ARYLALKYLAMINE N-ACETYLTRANSFERASE)
          Length = 168

 Score = 37.1 bits (85), Expect = 1e-04
 Identities = 11/49 (22%), Positives = 22/49 (44%), Gaps = 1/49 (2%)

Query: 404 WQHSGMGRELMRLAEEIAGEFGALKIAVISG-VGVREYYRKLGYERCGP 451
           ++  G G  L+       G   A++ AV+     +  +Y++ G+   GP
Sbjct: 97  FRQQGKGSVLLWRYLHHVGAQPAVRRAVLMCEDALVPFYQRFGFHPAGP 145


>3cixA [x.x.x] FEFE-HYDROGENASE MATURASE
          Length = 345

 Score = 37.0 bits (84), Expect = 1e-04
 Identities = 39/307 (12%), Positives = 73/307 (23%), Gaps = 57/307 (18%)

Query: 17  CPGRCTFCPSSADAPKSYMPDSPVVLRAKRNRYDPYLQTAGRIKVYIENGHTPSKIEAVI 76
           C   C +C                  R        Y  T   I               V+
Sbjct: 62  CRKNCLYCGL----------------RRDNKNLKRYRMTPEEIVERARLAVQFGAKTIVL 105

Query: 77  MGGTFSALPRGYREWFVANIYKALNDFPHWTSSADPTPNLEAEQIRNETAELRMVALTVE 136
             G             +++I K +                                  V 
Sbjct: 106 QSGEDPYYMP----DVISDIVKEIKKMGVA----------------------------VT 133

Query: 137 TRPDFINKAEVDFLLKLGVTRVELGVQSIYDDVLQKVKRGHGAAEVVEATAILKDSAYKV 196
                  +   +   + G  R  L  ++    + +K++        +    + +      
Sbjct: 134 LSLGEWPREYYEKWKEAGADRYLLRHETANPVLHRKLRPDTSFENRLNLLTLKELGYETG 193

Query: 197 CYHVMPGLPGSDPDRDLEMVREIFSNPSYMPDCVKIYPLYVVPNTEL--SEDWRRGLYKS 254
               M GLPG   D  ++ +  +  +     D V I P    P+T L   +     L   
Sbjct: 194 AG-SMVGLPGQTIDDLVDDLLFLKEHD---FDMVGIGPFIPHPDTPLANEKKGDFTLTLK 249

Query: 255 YDEETWLELLAKIYASIPRWVRVMRFGRDIPLHHVLDGPRWGNMRQIVLKHMERLGLKCQ 314
               T + L      +      ++  GR+I L    +             + +   L   
Sbjct: 250 MVALTRILLPDSNIPATTAMGTIVPGGREITLRCGANVIMPNWTPSP---YRQLYQLYPG 306

Query: 315 EIRCREV 321
           +I   E 
Sbjct: 307 KICVFEK 313


>3c8fA [x.x.x] PYRUVATE FORMATE-LYASE 1-ACTIVATING ENZYME
          Length = 245

 Score = 36.6 bits (83), Expect = 1e-04
 Identities = 22/247 (8%), Positives = 53/247 (21%), Gaps = 46/247 (18%)

Query: 17  CPGRCTFCPSSADAPKSYMPDSPVVLRAKRNRYDPYLQTAGRIKVYIENGHTPSKIEAVI 76
           C  RC +C +                     +          +  Y    +         
Sbjct: 29  CLMRCLYCHNRDTWDT------------HGGKEVTVEDLMKEVVTYRHFMNASGGGVTAS 76

Query: 77  MGGTFSALPRGYREWFVANIYKALNDFPHWTSSADPTPNLEAEQIRNETAELRMVALTVE 136
            G          +  FV + ++A       T                           ++
Sbjct: 77  GG------EAILQAEFVRDWFRACKKEGIHT--------------------------CLD 104

Query: 137 TRPDFINKAEVDFLLKLGVTRVELGVQSIYDDVLQKVKRGHGAAEVVEATAILKDSAYKV 196
           T         V   L      V L ++ + D++ Q +        +  A  +   +    
Sbjct: 105 TNGFVRRYDPVIDELLEVTDLVMLDLKQMNDEIHQNLVGVSNHRTLEFAKYLANKNVKVW 164

Query: 197 CYHVMPGLPGSDPDRDLEMVREIFSNPSYMPDCVKIYPLYVVPNTELSEDWRRGLYKSYD 256
             +V+      D D    +            + +++ P + +   +              
Sbjct: 165 IRYVVVPGWSDDDDSAHRLGEFTRDM--GNVEKIELLPYHELGKHKWVAMGEEYKLDGVK 222

Query: 257 EETWLEL 263
                 +
Sbjct: 223 PPKKETM 229


>2b4dB [x.x.x] DIAMINE ACETYLTRANSFERASE 1
          Length = 163

 Score = 36.1 bits (82), Expect = 2e-04
 Identities = 7/49 (14%), Positives = 19/49 (38%), Gaps = 1/49 (2%)

Query: 403 WWQHSGMGRELMRLAEEIAGEFGALKIAVISG-VGVREYYRKLGYERCG 450
            ++  G+G E+++   ++A    +    V         +Y++ G     
Sbjct: 94  DYRGFGIGSEILKNLSQVARCRCSSHFLVAEWNEPSINFYKRRGASDLS 142


>1cjwA [d.108.1] PROTEIN (SEROTONIN N-ACETYLTRANSFERASE)
          Length = 166

 Score = 36.1 bits (82), Expect = 2e-04
 Identities = 9/59 (15%), Positives = 21/59 (35%), Gaps = 1/59 (1%)

Query: 403 WWQHSGMGRELMRLAEEIAGEFGALK-IAVISGVGVREYYRKLGYERCGPYMCKPLGAP 460
            ++  G G  L+       G   A++   ++    +  +Y++ G+   GP         
Sbjct: 100 SFRQQGKGSVLLWRYLHHVGAQPAVRRAVLMCEDALVPFYQRFGFHPAGPCAIVVGSLT 158


>2b4dA [x.x.x] DIAMINE ACETYLTRANSFERASE 1
          Length = 164

 Score = 35.7 bits (81), Expect = 3e-04
 Identities = 7/49 (14%), Positives = 19/49 (38%), Gaps = 1/49 (2%)

Query: 403 WWQHSGMGRELMRLAEEIAGEFGALKIAVISG-VGVREYYRKLGYERCG 450
            ++  G+G E+++   ++A    +    V         +Y++ G     
Sbjct: 95  DYRGFGIGSEILKNLSQVARCRCSSHFLVAEWNEPSINFYKRRGASDLS 143


>2bw2A [x.x.x] BYPASS OF FORESPORE C
          Length = 140

 Score = 35.3 bits (80), Expect = 4e-04
 Identities = 7/177 (3%), Positives = 30/177 (16%), Gaps = 51/177 (28%)

Query: 17  CPGRCTFC--PSSADAPKSYMPDSPVVLRAKRNRYDPYLQTAGRIKVYIENGHTPSKIEA 74
            P +          D   S       V          +        +  +          
Sbjct: 7   EPLQVHVQLEKVYLDGDVSIEHKHEKVFSMDD-----FWAAYAGWTLVEQKKGYV----- 56

Query: 75  VIMGGTFSALPRGYREWFVANIYKALNDFPHWTSSADPTPNLEAEQIRNETAELRMVALT 134
                             + +I        +                             
Sbjct: 57  -------------LFRKQMDDISPLSKVNGYIGV-------------------------- 77

Query: 135 VETRPDFINKAEVDFLLKLGVTRVELGVQSIYDDVLQKVKRGHGAAEVVEATAILKD 191
            +           +   +   +  ++ ++ +   + + + +G       E   +++ 
Sbjct: 78  SDNGVISTFHGRPEPASEPIQSFFQIDLERLESHMQKNLLKGIPFRTKAEFEDVIEH 134


>3bj8A [x.x.x] DIAMINE ACETYLTRANSFERASE 1
          Length = 163

 Score = 34.9 bits (79), Expect = 5e-04
 Identities = 7/51 (13%), Positives = 21/51 (41%), Gaps = 3/51 (5%)

Query: 403 WWQHSGMGRELMRLAEEIAGEFGALKIAVI---SGVGVREYYRKLGYERCG 450
            ++  G+G E+++   ++A +     +  +          +Y++ G    G
Sbjct: 97  DYRGFGIGSEILKNLSQVAMKCRCSSMHFLVAEWNEPSINFYKRRGASDLG 147


>2beiB [x.x.x] DIAMINE ACETYLTRANSFERASE 2
          Length = 157

 Score = 34.8 bits (79), Expect = 5e-04
 Identities = 10/49 (20%), Positives = 25/49 (51%), Gaps = 2/49 (4%)

Query: 404 WQHSGMGRELMRLAEEIAGEFGA--LKIAVISGVGVREYYRKLGYERCG 450
           ++  G+G ++++   E+A + G    ++AV+      + Y+ LG +   
Sbjct: 88  YRGQGIGSKIIKKVAEVALDKGCSQFRLAVLDWNQRADLYKALGAQDLT 136


  Database: 95pdb09Oct16_0000
    Posted date:  Oct 27, 2009  4:27 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.321    0.139    0.434 

Gapped
Lambda     K      H
   0.267   0.0470    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 19,908,523
Number of extensions: 1246227
Number of successful extensions: 13067
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 5864
Number of HSP's successfully gapped: 283
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.4 bits)