RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 95pdb09Oct16_0000; 95pdb09Oct16_0001; 95pdb09Oct16_0002;
95pdb09Oct16_0003 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done

Query= AAL65085.1 paer1 AAL65085.1 GIB00076CH01 "pyruvate
formate-lyase activating enzyme homolog"
         (364 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

3canA [x.x.x] PYRUVATE-FORMATE LYASE-ACTIVATING ENZYME                 74   8e-16
3ciwA [x.x.x] FEFE-HYDROGENASE MATURASE                                71   5e-15
3c8fA [x.x.x] PYRUVATE FORMATE-LYASE 1-ACTIVATING ENZYME               68   5e-14
3cixA [x.x.x] FEFE-HYDROGENASE MATURASE                                67   6e-14
2a5hA [x.x.x] L-LYSINE 2,3-AMINOMUTASE                                 65   4e-13
3bz6A [x.x.x] UPF0502 PROTEIN PSPTO_2686                               63   1e-12
3cb8A [x.x.x] PYRUVATE FORMATE-LYASE 1-ACTIVATING ENZYME               60   1e-11
2bw2A [x.x.x] BYPASS OF FORESPORE C                                    58   3e-11
2a5hB [x.x.x] L-LYSINE 2,3-AMINOMUTASE                                 55   2e-10
3chvA [x.x.x] PROKARYOTIC DOMAIN OF UNKNOWN FUNCTION (DUF849)          43   2e-06
3cl5A [x.x.x] HEMAGGLUTININ-ESTERASE                                   40   1e-05
2ekyC [x.x.x] UPF0045 PROTEIN MJ1052                                   40   1e-05
2dzbB [x.x.x] DIHYDROPTEROATE SYNTHASE                                 36   2e-04
3cl4A [x.x.x] HEMAGGLUTININ-ESTERASE                                   36   2e-04
2dwqB [x.x.x] GTP-BINDING PROTEIN                                      34   8e-04

>3canA [x.x.x] PYRUVATE-FORMATE LYASE-ACTIVATING ENZYME
          Length = 158

 Score = 73.7 bits (180), Expect = 8e-16
 Identities = 27/126 (21%), Positives = 47/126 (37%), Gaps = 5/126 (3%)

Query: 142 GDSGVNVSFNEPTLLAEYAEEVFRLARARGLHASINTNGYLTEEAVRRLAEAGMEGMNID 201
           G  GV     EP L  E+  ++ +    +G+H +++T     +E V  +    +  + ID
Sbjct: 1   GG-GVTFCGGEPLLHPEFLIDILKRCGQQGIHRAVDTTLLARKETVDEVRNCEL--LLID 57

Query: 202 IKGGRETYRRWLAANFDKFLSTARHAKGMGIHVEFTYLVIPGVNDHEAEEVIEAVASFGR 261
           +K     ++ +     +  L   R              +I GVN  E    I+  A F  
Sbjct: 58  LKSDSTVHQTFCDVPNELILKNIRRVAEADFPYYIRIPLIEGVNADEKN--IKLSAEFLA 115

Query: 262 ETPLHI 267
             P H 
Sbjct: 116 SLPRHP 121


>3ciwA [x.x.x] FEFE-HYDROGENASE MATURASE
          Length = 344

 Score = 70.9 bits (172), Expect = 5e-15
 Identities = 23/203 (11%), Positives = 61/203 (30%), Gaps = 6/203 (2%)

Query: 80  ESRPMEIKPLYHFYPGTSAVTISTWGCNFPCAWCQNWHLSKTASPAGAYVP-PERVVEWA 138
            +  +  K +       + +   +  C   C +C     +K                  A
Sbjct: 38  LADEIRRKYVGDEVHIRAIIEF-SNVCRKNCLYCGLRRDNKNLKRYRMTPEEIVERARLA 96

Query: 139 LENGDSGVNVSFNEPTLLAEYAEEVFRLARARGLHASINTNGYLTEEAVRRLAEAGMEGM 198
           ++ G   + +   E   + +   ++ +  +  G+     + G    E   +  EAG +  
Sbjct: 97  VQFGAKTIVLQSGEDPYMPDVISDIVKEIKKMGVA-VTLSLGEWPREYYEKWKEAGADRY 155

Query: 199 NIDIKGGRETYRRWL--AANFDKFLSTARHAKGMGIHVEFTYLVIPGVNDHEAEEVIEAV 256
            +  +       R L    +F+  L+     +        + + +PG    +  + +  +
Sbjct: 156 LLRHETANPVLHRKLRPDTSFENRLNLLTLKELGYETGAGSMVGLPGQTIDDLVDDLLFL 215

Query: 257 ASFGRET-PLHITAYYPAHKLFN 278
                +   +     +P   L N
Sbjct: 216 KEHDFDMVGIGPFIPHPDTPLAN 238


>3c8fA [x.x.x] PYRUVATE FORMATE-LYASE 1-ACTIVATING ENZYME
          Length = 245

 Score = 67.8 bits (164), Expect = 5e-14
 Identities = 34/190 (17%), Positives = 64/190 (33%), Gaps = 9/190 (4%)

Query: 91  HFYPGTSAVTISTWGCNFPCAWCQNWHLSKTASPAGAYV-PPERVVEWALENGDSGVNVS 149
              PG   +     GC   C +C N     T       V    + V       ++     
Sbjct: 15  VDGPGIRFI-TFFQGCLMRCLYCHNRDTWDTHGGKEVTVEDLMKEVVTYRHFMNASGGGV 73

Query: 150 F---NEPTLLAEYAEEVFRLARARGLHASI-NTNGYLTEEAVRRLAEAGMEGMNIDIKGG 205
                E  L AE+  + FR  +  G+H  +         + V        + + +D+K  
Sbjct: 74  TASGGEAILQAEFVRDWFRACKKEGIHTCLDTNGFVRRYDPVIDELLEVTDLVMLDLKQM 133

Query: 206 -RETYRRWLAANFDKFLSTARHAKGMGIHVEFTYLVIPGVND--HEAEEVIEAVASFGRE 262
             E ++  +  +  + L  A++     + V   Y+V+PG +D    A  + E     G  
Sbjct: 134 NDEIHQNLVGVSNHRTLEFAKYLANKNVKVWIRYVVVPGWSDDDDSAHRLGEFTRDMGNV 193

Query: 263 TPLHITAYYP 272
             + +  Y+ 
Sbjct: 194 EKIELLPYHE 203


>3cixA [x.x.x] FEFE-HYDROGENASE MATURASE
          Length = 345

 Score = 67.4 bits (163), Expect = 6e-14
 Identities = 24/204 (11%), Positives = 64/204 (31%), Gaps = 7/204 (3%)

Query: 80  ESRPMEIKPLYHFYPGTSAVTISTWGCNFPCAWCQNWHLSKTASPAGAYVP-PERVVEWA 138
            +  +  K +       + +   +  C   C +C     +K                  A
Sbjct: 37  LADEIRRKYVGDEVHIRAIIEF-SNVCRKNCLYCGLRRDNKNLKRYRMTPEEIVERARLA 95

Query: 139 LENGDSG-VNVSFNEPTLLAEYAEEVFRLARARGLHASINTNGYLTEEAVRRLAEAGMEG 197
           ++ G    V  S  +P  + +   ++ +  +  G+  +++   +  E    +  EAG + 
Sbjct: 96  VQFGAKTIVLQSGEDPYYMPDVISDIVKEIKKMGVAVTLSLGEWPREYY-EKWKEAGADR 154

Query: 198 MNIDIKGGRETYRRWLA--ANFDKFLSTARHAKGMGIHVEFTYLVIPGVNDHEAEEVIEA 255
             +  +       R L    +F+  L+     +        + + +PG    +  + +  
Sbjct: 155 YLLRHETANPVLHRKLRPDTSFENRLNLLTLKELGYETGAGSMVGLPGQTIDDLVDDLLF 214

Query: 256 VASFGRET-PLHITAYYPAHKLFN 278
           +     +   +     +P   L N
Sbjct: 215 LKEHDFDMVGIGPFIPHPDTPLAN 238


>2a5hA [x.x.x] L-LYSINE 2,3-AMINOMUTASE
          Length = 400

 Score = 64.6 bits (156), Expect = 4e-13
 Identities = 18/196 (9%), Positives = 53/196 (27%), Gaps = 11/196 (5%)

Query: 88  PLYHFYPGTSAVTISTWGCNFPCAWCQNWHLSKTASPAGAYVPPERVVEWALENGDSGVN 147
           P+           +        C  C     +  +  +   +  + +           V 
Sbjct: 102 PVPGLTHRYPDRVLLLITDCSYCRHCTRRRFAGQSDDSPERID-KAIDYIRNTPQVRDVL 160

Query: 148 VSFNEPTLL-AEYAEEVFRLARARGLHASIN---TNGYLTEEAVRRLAEAGMEGMNIDIK 203
           +S  +  L+  E  E +    R       +        +  + +        +   + + 
Sbjct: 161 LSGGDALLVSDETLEYIIAKLREIPHVEIVRIGSRTPVVLPQRITPELVNLKKYHPVWLN 220

Query: 204 GGRETYRRWLAANFDKFLSTARHAKGMGIHVEFTYLVIPGVNDHE-AEEVIEAVASFG-R 261
               T+        ++     +     G+ +    +++ GVND    +E++  +     R
Sbjct: 221 ----THFNHPNEITEESTRACQLLADAGVPLGNQSVLLRGVNDCVHVKELVNKLVKIRVR 276

Query: 262 ETPLHITAYYPAHKLF 277
              ++        + F
Sbjct: 277 PYYIYQCDLSLGLEHF 292


>3bz6A [x.x.x] UPF0502 PROTEIN PSPTO_2686
          Length = 164

 Score = 63.3 bits (153), Expect = 1e-12
 Identities = 9/141 (6%), Positives = 26/141 (18%), Gaps = 14/141 (9%)

Query: 83  PMEIKPLYHFYPGTSAVTIS-TWGCNFPCAWCQNWHLSKTASPAGAYVPPERVVEWALEN 141
             E++ L       +    +     N     C         +     V   + +      
Sbjct: 9   STEVRILGCLIEKQATNPETYPLTLNALVIACNQKTSRDPVNLTQGQV--GQSLRALEGR 66

Query: 142 GDSGVNVSFNEPTL---------LAEYAEEVFRLARARGL--HASINTNGYLTEEAVRRL 190
           G + +  S  +            +         L           +  +     E   ++
Sbjct: 67  GLTRLVGSRADRWEHKVDKGLELVPAQVILTGLLLLRGPQTVSELLTRSNRHDFEDSEQV 126

Query: 191 AEAGMEGMNIDIKGGRETYRR 211
                  +   +         
Sbjct: 127 VHQLERLIARGLATLVPRQSG 147


>3cb8A [x.x.x] PYRUVATE FORMATE-LYASE 1-ACTIVATING ENZYME
          Length = 244

 Score = 59.8 bits (143), Expect = 1e-11
 Identities = 37/192 (19%), Positives = 69/192 (35%), Gaps = 13/192 (6%)

Query: 91  HFYPGTSAVTISTWGCNFPCAWCQNWHLSKTASPAGAYVPPERVVEWALENGDSGVNV-- 148
              PG         GC   C +C N       +  G  V  E +++  +           
Sbjct: 14  VDGPGI-RFITFFQGCLMRCLYCHNRDTWD--THGGKEVTVEDLMKEVVTYRHFMNASGG 70

Query: 149 ----SFNEPTLLAEYAEEVFRLARARGLHASINTN-GYLTEEAVRRLAEAGMEGMNIDIK 203
               S  E  L AE+  + FR  +  G+H  ++TN      + V        + + +D+K
Sbjct: 71  GVTASGGEAILQAEFVRDWFRACKKEGIHTCLDTNGFVRRYDPVIDELLEVTDLVMLDLK 130

Query: 204 GG-RETYRRWLAANFDKFLSTARHAKGMGIHVEFTYLVIPGVND--HEAEEVIEAVASFG 260
               E ++  +  +  + L  A++     + V   Y+V+PG +D    A  + E     G
Sbjct: 131 QMNDEIHQNLVGVSNHRTLEFAKYLANKNVKVWIRYVVVPGWSDDDDSAHRLGEFTRDMG 190

Query: 261 RETPLHITAYYP 272
               + +  Y+ 
Sbjct: 191 NVEKIELLPYHE 202


>2bw2A [x.x.x] BYPASS OF FORESPORE C
          Length = 140

 Score = 58.4 bits (140), Expect = 3e-11
 Identities = 11/135 (8%), Positives = 25/135 (18%), Gaps = 11/135 (8%)

Query: 103 TWGCNFPCAWCQNWHLSKTASPAGAYVPPERVVEW---ALENGDSGVNVSFNEPTLLAEY 159
                                        E+V              +        L  + 
Sbjct: 4   EHYEPLQVHVQLEKVYLDG--DVSIEHKHEKVFSMDDFWAAYAGWTLVEQKKGYVLFRKQ 61

Query: 160 AEEVFRLARARGLHASINT-NGYLTEEAVRRLAEAGMEGMNIDIKGGRET-----YRRWL 213
            +++  L++  G     +              +E       ID++           +   
Sbjct: 62  MDDISPLSKVNGYIGVSDNGVISTFHGRPEPASEPIQSFFQIDLERLESHMQKNLLKGIP 121

Query: 214 AANFDKFLSTARHAK 228
                +F     H K
Sbjct: 122 FRTKAEFEDVIEHMK 136


>2a5hB [x.x.x] L-LYSINE 2,3-AMINOMUTASE
          Length = 401

 Score = 55.5 bits (132), Expect = 2e-10
 Identities = 18/196 (9%), Positives = 52/196 (26%), Gaps = 11/196 (5%)

Query: 88  PLYHFYPGTSAVTISTWGCNFPCAWCQNWHLSKTASPAGAYVPPERVVEWALENGDSGVN 147
           P+           +        C  C     +  +  +   +  + +           V 
Sbjct: 102 PVPGLTHRYPDRVLLLITDCSYCRHCTRRRFAGQSDDSPERI-DKAIDYIRNTPQVRDVL 160

Query: 148 VSFNEPTLL-AEYAEEVFRLARARGLHASINT---NGYLTEEAVRRLAEAGMEGMNIDIK 203
           +S  +  L+  E  E +    R       +        +  + +        +   +   
Sbjct: 161 LSGGDALLVSDETLEYIIAKLREIPHVEIVRIGSRTPVVLPQRITPELVNLKKYHPVW-- 218

Query: 204 GGRETYRRWLAANFDKFLSTARHAKGMGIHVEFTYLVIPGVND-HEAEEVIEAVASFG-R 261
               T+        ++     +     G+ +    +++ GVND    +E++  +     R
Sbjct: 219 --LNTHFNHPNEITEESTRACQLLADAGVPLGNQSVLLRGVNDCVHVKELVNKLVKIRVR 276

Query: 262 ETPLHITAYYPAHKLF 277
              ++        + F
Sbjct: 277 PYYIYQCDLSLGLEHF 292


>3chvA [x.x.x] PROKARYOTIC DOMAIN OF UNKNOWN FUNCTION (DUF849)
          Length = 270

 Score = 42.7 bits (99), Expect = 2e-06
 Identities = 20/256 (7%), Positives = 44/256 (17%), Gaps = 31/256 (12%)

Query: 102 STWGCNFPCAWCQNWHLSKTASPAGAYVPPE---RVVEWALENGDSGVNVSFNEPTL--- 155
           +   C    A   +      A      +         + A E G +  +           
Sbjct: 1   ANKPCIICVAITGSVP--TKADNPAVPITVSEQVESTQEAFEAGAAIAHCHVRNDDGTPS 58

Query: 156 --LAEYAEEVFRLARARGLHASINTNGYLTEEAVR-RLAEAGMEGMNIDIKGGRETYRRW 212
                +A     L          +T G       R  L       +++            
Sbjct: 59  SDPDRFARLTEGLHTHCPGIVQFSTGGRSGAGQARGGLPLKPDASLSVGSNNFPSRVYEN 118

Query: 213 L--AANFDKFLSTARHAKGMGIHVEFTYLVIPGVNDHEAEEVIEAVASFGRETPLHITAY 270
                ++     + R    +        L             +       +  P     +
Sbjct: 119 PPDLVDWLAAQRSYRVTPEIEAFDLSHILRAIDHGRGLLYGKLYVQFVGVKNAPADREVF 178

Query: 271 YPAHKLFNXXXXXXXXXXXXXXXXXXXDYVYVGNVPGHPGQHTYCPRCGYAVIKRAGDRA 330
               +                      ++   G        + +    G        D  
Sbjct: 179 DFYVRR---------------TRAPQAEWCAAGIGANQLTVNEWAIAAGGHTRTGLED-- 221

Query: 331 VKIELAQGRCPKCGWE 346
             I L +         
Sbjct: 222 -NIRLDRQTLAPSNAA 236


>3cl5A [x.x.x] HEMAGGLUTININ-ESTERASE
          Length = 358

 Score = 40.0 bits (92), Expect = 1e-05
 Identities = 13/142 (9%), Positives = 26/142 (18%), Gaps = 17/142 (11%)

Query: 83  PMEIKPLYHFYPGTSAVTISTWGCNFPCAWCQNWHLSKTASPAGAYVPPERVVEWALENG 142
                       G ++    T G +F C +      +  A      +    V   A+   
Sbjct: 204 QYYFNKDTGVIYGLNSTETITTGFDFNCHYLVLPSGNYLAISNELLL---TVPTKAICLN 260

Query: 143 D------SGVNVSFNEPTLLAEYAEEVFRLARARGLHASINTNGYLT------EEAVRRL 190
                    V  S       ++    V           S      +             L
Sbjct: 261 KRKDFTPVQVVDSRWNNARQSDNMTAVACQPPYCYFRNSTTNYVGVYDINHGDAGFTSIL 320

Query: 191 AEAGMEGMNI--DIKGGRETYR 210
           +    +            +   
Sbjct: 321 SGLLYDSPCFSQQGVFRYDNVS 342


>2ekyC [x.x.x] UPF0045 PROTEIN MJ1052
          Length = 99

 Score = 40.0 bits (93), Expect = 1e-05
 Identities = 8/102 (7%), Positives = 27/102 (26%), Gaps = 14/102 (13%)

Query: 135 VEWALENGDSGVNVSFNEPTLLAEYAEEVFRLARARGLHASINTNGYLTEEAVRR----- 189
           +       +  +         +++Y ++   + +   L    N  G + E  +       
Sbjct: 1   IFMRKVVAEVSIIPLGKGA-SVSKYVKKAIEVFKKYDLKVETNAMGTVLEGDLDEILKAF 59

Query: 190 -----LAEAGMEGMNIDIKGGRETYRRWLAANFDKFLSTARH 226
                     ++ +   +K      R+      ++ L     
Sbjct: 60  KEAHSTVLNDVDRVVSSLKIDE---RKDKENTIERKLKAIGE 98


>2dzbB [x.x.x] DIHYDROPTEROATE SYNTHASE
          Length = 247

 Score = 36.2 bits (83), Expect = 2e-04
 Identities = 22/135 (16%), Positives = 32/135 (23%), Gaps = 15/135 (11%)

Query: 131 PERVVEWALENGDSG-----VNVSFNEPTLLAEYAEEVFRLARARGLHASINTNGYLTEE 185
           PER +E A E    G     +                V     + G+  S++T      E
Sbjct: 27  PERALERAREMVAEGADILDLGAESTPVEEEKRRLLPVLEAVLSLGVPVSVDT---RKPE 83

Query: 186 AVRRLAEAGMEGMNIDIKGGRETYRRWLAANFDKFLSTARHAKGMGIHVEFTYLVIPGVN 245
                 + G   +N       E      A            A  M +     Y  +    
Sbjct: 84  VAEEALKLGAHLLNDVTGLRDERMVALAAR-------HGVAAVVMHMPAHARYRDVVAEV 136

Query: 246 DHEAEEVIEAVASFG 260
               E       S G
Sbjct: 137 KAFLEAQARRALSAG 151


>3cl4A [x.x.x] HEMAGGLUTININ-ESTERASE
          Length = 358

 Score = 35.5 bits (80), Expect = 2e-04
 Identities = 10/128 (7%), Positives = 28/128 (21%), Gaps = 7/128 (5%)

Query: 88  PLYHFYPGTSAVTISTWGCNFPCAWCQNWHLSKTASPAGAYVPPERVVEWALENGDSGVN 147
                  G ++    T G +F C +      +  A      +    V   A+        
Sbjct: 209 KDTGVIYGLNSTETITTGFDFNCHYLVLPSGNYLAISNELLL---TVPTKAICLNKRKDF 265

Query: 148 VSFNEPTL----LAEYAEEVFRLARARGLHASINTNGYLTEEAVRRLAEAGMEGMNIDIK 203
                         +         +    +   +T  Y+    +          ++  + 
Sbjct: 266 TPVQVVDSRWNNARQSDNMTAVACQPPYCYFRNSTTNYVGVYDINHGDAGFTSILSGLLY 325

Query: 204 GGRETYRR 211
                 ++
Sbjct: 326 DSPCFSQQ 333


>2dwqB [x.x.x] GTP-BINDING PROTEIN
          Length = 337

 Score = 33.8 bits (77), Expect = 8e-04
 Identities = 33/108 (30%), Positives = 44/108 (40%), Gaps = 18/108 (16%)

Query: 132 ERVVEWALENGDSGVNVSFNEPTLLAEYAEEVFRLARARGLHASINTNGYLTEEAVRRLA 191
           E V   ALE G   V VS      LAE + E      AR L A+      L E  ++RLA
Sbjct: 194 EAVRRKALEEGAEVVVVSARLEAELAELSGE-----EARELLAAYG----LQESGLQRLA 244

Query: 192 EAGMEGMN-IDI--KGGRETYRRWLAANFDKFLSTARHAKGMGIHVEF 236
            AG   ++ +     G +E  R W      +  + A  A G  IH + 
Sbjct: 245 RAGYRALDLLTFFTAGEKEV-RAWT----VRRGTKAPRAAGE-IHSDM 286


  Database: 95pdb09Oct16_0000
    Posted date:  Oct 27, 2009  4:27 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.321    0.139    0.452 

Gapped
Lambda     K      H
   0.267   0.0598    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 19,596,314
Number of extensions: 1185390
Number of successful extensions: 13858
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 6709
Number of HSP's successfully gapped: 220
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.4 bits)