RPS-BLAST 2.2.16 [Mar-25-2007]

Database: Pfam-A 
           11,912 sequences; 2,039,872 total letters

Searching..................................................done

Query= AAL62997.1 paer1 AAL62997.1 GIB00076CH01 "RNA binding protein
(fmu, PCNA P120 homolog), pr.."
         (379 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

PF01189 Nol1_Nop2_Fmu "NOL1/NOP2/sun family"                           91   3e-21
PF03848 TehB "Tellurite resistance protein TehB"                       41   3e-06
PF01472 PUA "PUA domain"                                               39   9e-06

>PF01189 Nol1_Nop2_Fmu "NOL1/NOP2/sun family"
          Length = 229

 Score = 90.9 bits (225), Expect = 3e-21
 Identities = 79/223 (35%), Positives = 111/223 (49%), Gaps = 29/223 (13%)

Query: 169 NLPEYAEGLFYSQS----LPAILVG-HIARRITQTDAVDLNSAPGGKTTHLAQM---GIR 220
           +LP + +G  Y Q     LPA+L+      R+     +DL +APGGKTTHLA +     R
Sbjct: 16  SLPAFEDGAVYVQDAASQLPALLLDPQPGERV-----LDLCAAPGGKTTHLAALMKNTGR 70

Query: 221 VIAVDRSAQKIEKLRSEAARLGLDVFIDILLHDSRYLDRDFPKIKAGVALVDPPCTDIGV 280
           V+A D  A+++++L+    RLGL   + +   D+R LD      K    L+D PC+ +G 
Sbjct: 71  VVANDIDAKRLKRLKENLKRLGL-FNVVVTNGDARKLDPWLLGGKFDRVLLDAPCSGLGT 129

Query: 281 ---RPKIYHKVTFEAAKTLARYQIQFLKTA---LKIAPYVIYSTCTLTYIENEGVIEKAG 334
               P I  + + E  + LA  Q + L  A   LK    ++YSTC+L   ENE V+E   
Sbjct: 130 LRRHPDIKWRRSPEDIEELAELQREILDAAARLLKPGGRLVYSTCSLLPEENEAVVEAFL 189

Query: 335 A-----EIVDAGIEIGAPGWGCRECRRFLPHVHNTPGFFIAVL 372
           A     E+V   +  G P        R LPH H T GFFIA L
Sbjct: 190 ARHPDFELVPVPLAEGPP----EGTLRLLPHRHGTDGFFIARL 228


>PF03848 TehB "Tellurite resistance protein TehB"
          Length = 156

 Score = 40.8 bits (95), Expect = 3e-06
 Identities = 25/74 (33%), Positives = 40/74 (54%)

Query: 201 VDLNSAPGGKTTHLAQMGIRVIAVDRSAQKIEKLRSEAARLGLDVFIDILLHDSRYLDRD 260
           +DL    G    +LA  G  V AVD+S + IEKL+  A + GLD+   ++  ++  LD +
Sbjct: 22  LDLGCGEGRNALYLAAQGFDVTAVDKSEEAIEKLKRIAEKEGLDIHTIVVDLNNLSLDEE 81

Query: 261 FPKIKAGVALVDPP 274
           +  I + V L+  P
Sbjct: 82  YDFILSTVVLMFLP 95


>PF01472 PUA "PUA domain"
          Length = 74

 Score = 39.3 bits (91), Expect = 9e-06
 Identities = 20/61 (32%), Positives = 37/61 (60%), Gaps = 1/61 (1%)

Query: 99  ESVMLGADLYAPAVIKTDR-VNIGDEVNIVSDNGRVVALGVAVMDSDEALKARRGLYIKV 157
           ++V+ GA L AP V+  +     GD V +V ++GR +A+G+A   S E  + + G+ +++
Sbjct: 11  KAVLRGASLLAPGVVSVEGDFEKGDVVAVVVEDGRAIAVGLANYSSAEIRRIKGGISVEI 70

Query: 158 E 158
           E
Sbjct: 71  E 71


  Database: Pfam-A
    Posted date:  Oct 30, 2009  9:48 AM
  Number of letters in database: 2,039,872
  Number of sequences in database:  11,912
  
Lambda     K      H
   0.319    0.136    0.379 

Gapped
Lambda     K      H
   0.267   0.0510    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 11912
Number of Hits to DB: 9,984,716
Number of extensions: 541789
Number of successful extensions: 73509
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 1853
Number of HSP's successfully gapped: 258
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (20.8 bits)