RPS-BLAST 2.2.16 [Mar-25-2007]

Database: Pfam-A 
           11,912 sequences; 2,039,872 total letters

Searching..................................................done

Query= AAL63125.1 paer1 AAL63125.1 GIB00076CH01 "conserved
hypothetical protein"
         (471 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

PF04055 Radical_SAM "Radical SAM superfamily"                          65   2e-13

>PF04055 Radical_SAM "Radical SAM superfamily"
          Length = 164

 Score = 65.4 bits (159), Expect = 2e-13
 Identities = 33/94 (35%), Positives = 60/94 (63%), Gaps = 1/94 (1%)

Query: 121 IRNETAELRMVALTVETRPDFINKAEVDFLLKLGVTRVELGVQSIYDDVLQKVKRGHGAA 180
           +R    +L  + +T+ET     +   +D L +LG+ R+ +G+QS+ D+VL+ + RGH   
Sbjct: 67  LRLAKEDLPGIRITLETNGTLPDPELLDELAELGLDRLAIGLQSLDDEVLKAINRGHTLE 126

Query: 181 EVVEATAILKDSAYKVCYHVMPGLPG-SDPDRDL 213
           E++EA  +L+++ +KV  H++ GLPG +D D +L
Sbjct: 127 EILEAIELLREAGFKVVTHLIVGLPGETDEDEEL 160


  Database: Pfam-A
    Posted date:  Oct 30, 2009  9:48 AM
  Number of letters in database: 2,039,872
  Number of sequences in database:  11,912
  
Lambda     K      H
   0.321    0.139    0.434 

Gapped
Lambda     K      H
   0.267   0.0502    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 11912
Number of Hits to DB: 12,322,591
Number of extensions: 696037
Number of successful extensions: 87761
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 1868
Number of HSP's successfully gapped: 279
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.4 bits)