RPS-BLAST 2.2.16 [Mar-25-2007]

Database: Pfam-A 
           11,912 sequences; 2,039,872 total letters

Searching..................................................done

Query= AAL65054.1 paer1 AAL65054.1 GIB00076CH01 "conserved
hypothetical protein"
         (346 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

PF06858 NOG1 "Nucleolar GTP-binding protein 1 (NOG1)"                  49   1e-08
PF02421 FeoB_N "Ferrous iron transport protein B"                      48   2e-08
PF01926 MMR_HSR1 "GTPase of unknown function"                          39   1e-05

>PF06858 NOG1 "Nucleolar GTP-binding protein 1 (NOG1)"
          Length = 58

 Score = 48.5 bits (115), Expect = 1e-08
 Identities = 26/57 (45%), Positives = 36/57 (63%), Gaps = 1/57 (1%)

Query: 236 IEKQAILALRHLAGVIVFVVDPTPHSGYSLEMQERLWREIKEGF-SAPAVAVLNKID 291
           IE QAI AL HL   +++V+D +   GYS+E Q  L+  IK  F + P + V+NKID
Sbjct: 2   IEMQAITALAHLRAAVLYVMDLSEQCGYSIEEQLELFESIKPLFANKPWIVVINKID 58


>PF02421 FeoB_N "Ferrous iron transport protein B"
          Length = 188

 Score = 48.2 bits (114), Expect = 2e-08
 Identities = 49/176 (27%), Positives = 80/176 (45%), Gaps = 17/176 (9%)

Query: 170 TIVVAGAPNVGKSSFVRCVSTAKPEVAEYPFTTKQIHLGHIFLRGDRVQVIDTPGLLD-R 228
           TI + G PNVGK++    ++ A+  V  +P  T +   G   L G +V ++D PG     
Sbjct: 2   TIALVGNPNVGKTTLFNALTGARQHVGNWPGVTVEKKEGKFKLGGKQVTLVDLPGTYSLS 61

Query: 229 PLSERNQIEKQAILALRHLAGVIVFVVDPTPHSGYSLEMQERLWREIKEGFSAPAVAVLN 288
           P S   Q+ +  +L  +    VI+ VVD T     +LE    L  ++ E    P V  LN
Sbjct: 62  PYSLDEQVARDYLLEEK--PDVIINVVDAT-----NLERNLYLTLQLLE-LGIPVVVALN 113

Query: 289 KIDIATEE----ELEK-ARAIFAPIGEISTLNCRG---TKEVMDYVLQKYYVPAAL 336
            +D A +     +++K ++ +  P+   S     G    KE +D + +K   P  L
Sbjct: 114 MMDEAEKRGIKIDIKKLSKLLGVPVVPTSARKGEGIDELKEAIDELAEKKKKPKPL 169


>PF01926 MMR_HSR1 "GTPase of unknown function"
          Length = 105

 Score = 38.9 bits (90), Expect = 1e-05
 Identities = 32/113 (28%), Positives = 61/113 (53%), Gaps = 11/113 (9%)

Query: 180 GKSSFVRCVS-TAKPEVAEYPFTTKQIHLGHIFLR-GDRVQVIDTPGLLDRPLSERNQIE 237
           GKS+    ++  A+ +VA YP TT+  ++G + ++ G +++++DTPGL+        ++ 
Sbjct: 1   GKSTLFNALTGRARAKVANYPGTTRDPNVGVVEVKDGTQIELVDTPGLIKGASKGEGELG 60

Query: 238 KQAILALRHLAGVIVFVVDP-TPHSGYSLEMQERLWREIKEGFSAPAVAVLNK 289
            + +  +R  A  I+ VVD   P +   LE+ + L   +K+      + VLNK
Sbjct: 61  NKFLRHIRE-ADAILHVVDAFEPDNENDLEIIDLL--RLKK-----VIVVLNK 105


  Database: Pfam-A
    Posted date:  Oct 30, 2009  9:48 AM
  Number of letters in database: 2,039,872
  Number of sequences in database:  11,912
  
Lambda     K      H
   0.329    0.145    0.468 

Gapped
Lambda     K      H
   0.267   0.0533    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 11912
Number of Hits to DB: 13,611,329
Number of extensions: 765672
Number of successful extensions: 106624
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 2315
Number of HSP's successfully gapped: 201
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)