RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 40scop73nmM 
           9549 sequences; 1,678,726 total letters

Searching..................................................done

Query= AAL63787.1 paer1 AAL63787.1 GIB00076CH01 "conserved protein
with 2 CBS domains"
         (142 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

2yziA1 [d.37.1.1] HYPOTHETICAL PROTEIN PH0107 A:4 -- 135               98   8e-24
2ef7A1 [d.37.1.1] HYPOTHETICAL PROTEIN ST2348 A:1 -- 127               92   6e-22
2o16A3 [d.37.1.1] ACETOIN UTILIZATION PROTEIN ACUB, PUTATIVE A:2...    91   1e-21
2j9lA1 [d.37.1.1] CHLORIDE CHANNEL PROTEIN 5 A:578 -- 746              88   1e-20
2rifA1 [d.37.1.1] CONSERVED PROTEIN WITH 2 CBS DOMAINS A:2 -- 132      87   2e-20
3ddjA2 [d.37.1.1] CBS DOMAIN-CONTAINING PROTEIN A:1 -- 135             83   3e-19
2nycA1 [d.37.1.1] NUCLEAR PROTEIN SNF4 A:181 -- 320                    83   4e-19
2v8qE1 [d.37.1.1] 5'-AMP-ACTIVATED PROTEIN KINASE SUBUNIT GAMMA-...    79   4e-18
2yzqA1 [d.37.1.1] PUTATIVE UNCHARACTERIZED PROTEIN PH1780 A:123 ...    79   6e-18
1pvmA4 [d.37.1.1] CONSERVED HYPOTHETICAL PROTEIN TA0289 A:1 -- 142     78   1e-17
2rc3A1 [d.37.1.1] CBS DOMAIN A:23 -- 149                               78   1e-17
1o50A3 [d.37.1.1] CBS DOMAIN-CONTAINING PREDICTED PROTEIN TM0935...    74   2e-16
2v8qE2 [d.37.1.1] 5'-AMP-ACTIVATED PROTEIN KINASE SUBUNIT GAMMA-...    73   3e-16
1xkfA3 [d.37.1.1] HYPOTHETICAL PROTEIN RV2626C A:2 -- 124              73   4e-16
1zfjA4 [d.37.1.1] INOSINE MONOPHOSPHATE DEHYDROGENASE A:95 -- 220      73   4e-16
1e6vC [d.58.31.1] METHYL-COENZYME M REDUCTASE I GAMMA SUBUNIT          72   5e-16
3ddjA1 [d.37.1.1] CBS DOMAIN-CONTAINING PROTEIN A:136 -- 276           71   1e-15
1pbjA3 [d.37.1.1] HYPOTHETICAL PROTEIN A:2 -- 121                      70   3e-15
1yavA3 [d.37.1.1] HYPOTHETICAL PROTEIN BSU14130 A:13 -- 144            69   6e-15
2ouxA2 [d.37.1.1] MAGNESIUM TRANSPORTER A:136 -- 262                   68   1e-14
1b3oB4 [d.37.1.1] PROTEIN (INOSINE MONOPHOSPHATE DEHYDROGENASE 2...    66   5e-14
2d4zA3 [d.37.1.1] CHLORIDE CHANNEL PROTEIN A:527 -- 606 A:691 --...    64   2e-13
1f1zA2 [c.52.1.16] TNSA ENDONUCLEASE A:8 -- 168                        63   3e-13
1vr9A3 [d.37.1.1] CBS DOMAIN PROTEIN/ACT DOMAIN PROTEIN A:1 -- 121     63   3e-13
2yzqA2 [d.37.1.1] PUTATIVE UNCHARACTERIZED PROTEIN PH1780 A:1 --...    63   5e-13
2ooxE1 [d.37.1.1] HYPOTHETICAL PROTEIN C1556.08C IN CHROMOSOME I...    55   8e-11
1nfbA4 [d.37.1.1] INOSINE-5'-MONOPHOSPHATE DEHYDROGENASE 2 A:112...    44   2e-07

>2yziA1 [d.37.1.1] HYPOTHETICAL PROTEIN PH0107 A:4 -- 135
          Length = 132

 Score = 98.4 bits (245), Expect = 8e-24
 Identities = 37/117 (31%), Positives = 71/117 (60%), Gaps = 2/117 (1%)

Query: 6   IASKNVICIKPGASILDAAKLMAQRNIGFLIVSSDCKRDLAGVISERDIIRA-IASGIQP 64
             +K ++ +KP  S+ +A++L  + ++G L+V +D   ++ G  ++ DIIR  I  G+  
Sbjct: 10  YXTKKLLGVKPSTSVQEASRLXXEFDVGSLVVIND-DGNVVGFFTKSDIIRRVIVPGLPY 68

Query: 65  SEPVDNIMTRKVVYVYKDTPVWEIARLMRKYNIRHILVMDNGQIFGVISIRDLLKES 121
             PV+ I TR ++    +TP+ E+ R   ++ I+HIL+ + G+I G+ ++ DLL+ S
Sbjct: 69  DIPVERIXTRNLITANVNTPLGEVLRKXAEHRIKHILIEEEGKIVGIFTLSDLLEAS 125



 Score = 45.6 bits (108), Expect = 6e-08
 Identities = 13/54 (24%), Positives = 32/54 (59%), Gaps = 1/54 (1%)

Query: 67  PVDNIMTRKVVYVYKDTPVWEIARLMRKYNIRHILVMD-NGQIFGVISIRDLLK 119
           P+    T+K++ V   T V E +RL  ++++  ++V++ +G + G  +  D+++
Sbjct: 6   PIKVYXTKKLLGVKPSTSVQEASRLXXEFDVGSLVVINDDGNVVGFFTKSDIIR 59



 Score = 40.2 bits (94), Expect = 3e-06
 Identities = 9/53 (16%), Positives = 25/53 (47%), Gaps = 2/53 (3%)

Query: 5   AIASKNVICIKPGASILDAAKLMAQRNIGFLIVSSDCKRDLAGVISERDIIRA 57
            I ++N+I       + +  +  A+  I  +++  + K  + G+ +  D++ A
Sbjct: 74  RIXTRNLITANVNTPLGEVLRKXAEHRIKHILIEEEGK--IVGIFTLSDLLEA 124


>2ef7A1 [d.37.1.1] HYPOTHETICAL PROTEIN ST2348 A:1 -- 127
          Length = 127

 Score = 92.2 bits (229), Expect = 6e-22
 Identities = 40/118 (33%), Positives = 65/118 (55%), Gaps = 3/118 (2%)

Query: 6   IASKNVICIKPGASILDAAKLMAQRNIGFLIVSSDCKRDLAGVISERDIIRAIASGIQPS 65
                VI +   A + D AK+  ++NIG +IV    K    G+I+ERDI++AI  G    
Sbjct: 9   YXKTQVISVTKDAKLNDIAKVXTEKNIGSVIVVDGNK--PVGIITERDIVKAIGKGKSLE 66

Query: 66  EPVDNIMTRKVVYVYKDTPVWEIARLMRKYNIRHILVMD-NGQIFGVISIRDLLKESD 122
              +   T  ++ + +D+P+     L R++NIRH+ V+D  G + G+ISIRD+ +  D
Sbjct: 67  TKAEEFXTASLITIREDSPITGALALXRQFNIRHLPVVDDKGNLKGIISIRDITRAID 124



 Score = 47.9 bits (114), Expect = 1e-08
 Identities = 16/53 (30%), Positives = 31/53 (58%)

Query: 66  EPVDNIMTRKVVYVYKDTPVWEIARLMRKYNIRHILVMDNGQIFGVISIRDLL 118
           E V      +V+ V KD  + +IA++  + NI  ++V+D  +  G+I+ RD++
Sbjct: 4   EIVKEYXKTQVISVTKDAKLNDIAKVXTEKNIGSVIVVDGNKPVGIITERDIV 56


>2o16A3 [d.37.1.1] ACETOIN UTILIZATION PROTEIN ACUB, PUTATIVE A:20
           -- 158
          Length = 130

 Score = 91.1 bits (226), Expect = 1e-21
 Identities = 31/115 (26%), Positives = 56/115 (48%), Gaps = 4/115 (3%)

Query: 19  SILDAAKLMAQRNIGFLIVSSDCKRDLAGVISERDIIRAIASGIQPSEPVDNIMTRKVVY 78
           ++ DA  LM   +I  + +  D  + L G++S+RD++ A  S +Q   P+  +M   V  
Sbjct: 20  TLNDAKHLMEALDIRHVPIV-DANKKLLGIVSQRDLLAAQESSLQFETPLFEVMHTDVTS 78

Query: 79  VYKDTPVWEIARLMRKYNIRHILVMDNGQIFGVISIRDLLKESDVIERLVEYAEE 133
           V     + E A  M+K+ I  + V+    + G+I+  D +    +   L+E  EE
Sbjct: 79  VAPQAGLKESAIYMQKHKIGCLPVVAKDVLVGIITDSDFV---TIAINLLELQEE 130



 Score = 43.7 bits (103), Expect = 2e-07
 Identities = 14/58 (24%), Positives = 29/58 (50%), Gaps = 2/58 (3%)

Query: 6   IASKNVICIKPGASILDAAKLMAQRNIGFLIVSSDCKRDLAGVISERDIIRAIASGIQ 63
           +   +V  + P A + ++A  M +  IG L V +  K  L G+I++ D +    + ++
Sbjct: 71  VMHTDVTSVAPQAGLKESAIYMQKHKIGCLPVVA--KDVLVGIITDSDFVTIAINLLE 126



 Score = 41.4 bits (97), Expect = 1e-06
 Identities = 17/56 (30%), Positives = 33/56 (58%), Gaps = 1/56 (1%)

Query: 68  VDNIMTRKVVYVYKDTPVWEIARLMRKYNIRHILVMD-NGQIFGVISIRDLLKESD 122
           V+++MTR    + +   + +   LM   +IRH+ ++D N ++ G++S RDLL   +
Sbjct: 4   VEDMMTRHPHTLLRTHTLNDAKHLMEALDIRHVPIVDANKKLLGIVSQRDLLAAQE 59


>2j9lA1 [d.37.1.1] CHLORIDE CHANNEL PROTEIN 5 A:578 -- 746
          Length = 162

 Score = 87.5 bits (216), Expect = 1e-20
 Identities = 29/146 (19%), Positives = 57/146 (39%), Gaps = 26/146 (17%)

Query: 1   MNAGAIASKNVICIKPGASILDAAKLMAQRNIG-FLIVSSDCKRDLAGVISERDIIRAIA 59
           M          +  +   ++ D   ++++     F +V S   + L G +  RD+I +I 
Sbjct: 9   MKPRRNDPLLTVLTQDSMTVEDVETIISETTYSGFPVVVSRESQRLVGFVLRRDLIISIE 68

Query: 60  SGIQ-------------------------PSEPVDNIMTRKVVYVYKDTPVWEIARLMRK 94
           +  +                         P+  + NI+      V   TP+  +  + RK
Sbjct: 69  NARKKQDGVVSTSIIYFTEHSPPLPPYTPPTLKLRNILDLSPFTVTDLTPMEIVVDIFRK 128

Query: 95  YNIRHILVMDNGQIFGVISIRDLLKE 120
             +R  LV  NG++ G+I+ +D+LK 
Sbjct: 129 LGLRQCLVTHNGRLLGIITKKDVLKH 154



 Score = 39.0 bits (90), Expect = 6e-06
 Identities = 7/55 (12%), Positives = 24/55 (43%), Gaps = 2/55 (3%)

Query: 8   SKNVICIKPGASILDAAKLMAQRNIGFLIVSSDCKRDLAGVISERDIIRAIASGI 62
             +   +     +     +  +  +   +V+ + +  L G+I+++D+++ IA   
Sbjct: 107 DLSPFTVTDLTPMEIVVDIFRKLGLRQCLVTHNGR--LLGIITKKDVLKHIAQMA 159


>2rifA1 [d.37.1.1] CONSERVED PROTEIN WITH 2 CBS DOMAINS A:2 -- 132
          Length = 131

 Score = 87.1 bits (215), Expect = 2e-20
 Identities = 39/129 (30%), Positives = 68/129 (52%), Gaps = 3/129 (2%)

Query: 1   MNAGAIASKNVICIKPGASILDAAKLMAQRNIGFL-IVSSDCKRDLAGVISERDIIRAIA 59
           +    +  +  + +   A+I + A  +A+  +G   + + D  +    V+SERDI+RA+A
Sbjct: 1   IRTSELLKRPPVSLPETATIREVATELAKNRVGLAVLTARDNPKRPVAVVSERDILRAVA 60

Query: 60  SGIQPSEPVDNIMTRKVVYVYKDTPVWEIARLMRKYNIRHILVMD-NGQIFGVISIRDLL 118
             +    P   I     + V    PV   A  MR++NIRH++V++ NG++ GV+SIRDL 
Sbjct: 61  QRLDLDGPAMPIANS-PITVLDTDPVHVAAEKMRRHNIRHVVVVNKNGELVGVLSIRDLC 119

Query: 119 KESDVIERL 127
            E  ++  L
Sbjct: 120 FERAILLEL 128


>3ddjA2 [d.37.1.1] CBS DOMAIN-CONTAINING PROTEIN A:1 -- 135
          Length = 132

 Score = 83.3 bits (206), Expect = 3e-19
 Identities = 24/120 (20%), Positives = 52/120 (43%), Gaps = 12/120 (10%)

Query: 9   KNVICIKPGASILDAAKLMAQRNIGFLIVSSDCKRDLAGVISERDIIRAIASGIQ----- 63
           KN   +     +  A K + +  IG +IV+++    + G+++ RD++  + S        
Sbjct: 9   KNPPILSKEDRLGSAFKKINEGGIGRIIVANE---KIEGLLTTRDLLSTVESYCCSQGDL 65

Query: 64  ---PSEPVDNIMTRKVVYVYKDTPVWEIARLMRKYNIRHILVMD-NGQIFGVISIRDLLK 119
               + P+ +  T   V VY  +  +    +    N   + V+D N +  G+++ R+ L 
Sbjct: 66  YHISTTPIIDYXTPNPVTVYNTSDEFTAINIXVTRNFGSLPVVDINDKPVGIVTEREFLL 125



 Score = 42.1 bits (99), Expect = 7e-07
 Identities = 11/52 (21%), Positives = 21/52 (40%), Gaps = 1/52 (1%)

Query: 6   IASKNVICIKPGASILDAAKLMAQRNIGFLIVSSDCKRDLAGVISERDIIRA 57
             + N + +   +    A  +   RN G L V  D      G+++ER+ +  
Sbjct: 76  YXTPNPVTVYNTSDEFTAINIXVTRNFGSLPV-VDINDKPVGIVTEREFLLL 126



 Score = 37.1 bits (86), Expect = 2e-05
 Identities = 11/52 (21%), Positives = 26/52 (50%), Gaps = 1/52 (1%)

Query: 68  VDNIMTRKVVYVYKDTPVWEIARLMRKYNIRHILVMDNGQIFGVISIRDLLK 119
           ++ +  +    + K+  +    + + +  I  I+V  N +I G+++ RDLL 
Sbjct: 3   IETLXIKNPPILSKEDRLGSAFKKINEGGIGRIIVA-NEKIEGLLTTRDLLS 53


>2nycA1 [d.37.1.1] NUCLEAR PROTEIN SNF4 A:181 -- 320
          Length = 130

 Score = 82.6 bits (204), Expect = 4e-19
 Identities = 25/119 (21%), Positives = 51/119 (42%), Gaps = 4/119 (3%)

Query: 3   AGAIASKNVICIKPGASILDAAKLMAQRNIGFLIVSSDCKRDLAGVISERDIIRAIASGI 62
              I   N+   +    ++D  +++ Q  +  + +  D    L  V    D++  I  G 
Sbjct: 11  LNIITQDNMKSCQMTTPVIDVIQMLTQGRVSSVPII-DENGYLINVYEAYDVLGLIKGG- 68

Query: 63  QPSEPVDNIMTRKVVYVYKDTPVWEIARLMRKYNIRHILVMDN-GQIFGVISIRDLLKE 120
             S  V   + R+     K+  +  I   +RK  +    V+D+ G++ GV+++ D+LK 
Sbjct: 69  -LSLSVGEALMRRSYTCTKNDKLSTIMDNIRKARVHRFFVVDDVGRLVGVLTLSDILKY 126



 Score = 37.9 bits (88), Expect = 1e-05
 Identities = 11/61 (18%), Positives = 22/61 (36%), Gaps = 1/61 (1%)

Query: 1   MNAGAIASKNVICIKPGASILDAAKLMAQRNIGFLIVSSDCKRDLAGVISERDIIRAIAS 60
           ++ G    +          +      + +  +    V  D  R L GV++  DI++ I  
Sbjct: 71  LSVGEALMRRSYTCTKNDKLSTIMDNIRKARVHRFFVVDDVGR-LVGVLTLSDILKYILL 129

Query: 61  G 61
           G
Sbjct: 130 G 130


>2v8qE1 [d.37.1.1] 5'-AMP-ACTIVATED PROTEIN KINASE SUBUNIT GAMMA-1
           E:182 -- 326
          Length = 145

 Score = 79.3 bits (195), Expect = 4e-18
 Identities = 20/127 (15%), Positives = 47/127 (37%), Gaps = 10/127 (7%)

Query: 3   AGAIASKNVICIKPGASILDAAKLMAQRNIGFLIVSSDCKRDLAGVISERDIIRAIASGI 62
                  N+  ++    +  A  +  Q  +  L V  D K  +  + S+ D+I   A   
Sbjct: 14  LQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVV-DEKGRVVDIYSKFDVINLAAEKT 72

Query: 63  Q--------PSEPVDNIMTRKVVYVYKDTPVWEIARLMRKYNIRHILVMD-NGQIFGVIS 113
                     +    +     V+  Y    +  I   + +  +  ++V+D +  + G++S
Sbjct: 73  YNNLDVSVTKALQHRSHYFEGVLKCYLHETLEAIINRLVEAEVHRLVVVDEHDVVKGIVS 132

Query: 114 IRDLLKE 120
           + D+L+ 
Sbjct: 133 LSDILQA 139



 Score = 40.4 bits (94), Expect = 2e-06
 Identities = 8/54 (14%), Positives = 23/54 (42%), Gaps = 1/54 (1%)

Query: 6   IASKNVICIKPGASILDAAKLMAQRNIGFLIVSSDCKRDLAGVISERDIIRAIA 59
              + V+      ++      + +  +  L+V  +    + G++S  DI++A+ 
Sbjct: 89  HYFEGVLKCYLHETLEAIINRLVEAEVHRLVVVDEHDV-VKGIVSLSDILQALV 141


>2yzqA1 [d.37.1.1] PUTATIVE UNCHARACTERIZED PROTEIN PH1780 A:123 --
           278
          Length = 124

 Score = 78.8 bits (194), Expect = 6e-18
 Identities = 36/121 (29%), Positives = 56/121 (46%), Gaps = 3/121 (2%)

Query: 1   MNAGAIASKNVICIKPGASILDAAKLMAQRNIGFLIVSSDCKRDLAGVISERDIIRAIAS 60
           +       + V  +  G  +  A K +   N   L V  D + +L G++ E D++R    
Sbjct: 4   VEIEPYYQRYVSIVWEGTPLKAALKALLLSNSMALPVV-DSEGNLVGIVDETDLLRDSEI 62

Query: 61  GIQPSEPVDNIMTRKVVYVYKDTPVWEIARLMRKYNIRHILVMD-NGQIFGVISIRDLLK 119
              P++PV  IMTR V+       V E+A  M KY+I  + V+   G + G+I   DLLK
Sbjct: 63  VR-PNKPVAEIMTRDVIVATPHMTVHEVALKMAKYSIEQLPVIRGEGDLIGLIRDFDLLK 121

Query: 120 E 120
            
Sbjct: 122 V 122



 Score = 41.1 bits (96), Expect = 1e-06
 Identities = 14/53 (26%), Positives = 28/53 (52%), Gaps = 1/53 (1%)

Query: 6   IASKNVICIKPGASILDAAKLMAQRNIGFLIVSSDCKRDLAGVISERDIIRAI 58
           I +++VI   P  ++ + A  MA+ +I  L V       L G+I + D+++ +
Sbjct: 72  IMTRDVIVATPHMTVHEVALKMAKYSIEQLPVIRGEGD-LIGLIRDFDLLKVL 123


>1pvmA4 [d.37.1.1] CONSERVED HYPOTHETICAL PROTEIN TA0289 A:1 -- 142
          Length = 142

 Score = 77.8 bits (191), Expect = 1e-17
 Identities = 28/123 (22%), Positives = 58/123 (47%), Gaps = 4/123 (3%)

Query: 1   MNAGAIASKNVICIKPGASILDAAKLMAQRNIGFLIVSSDCKRDLAGVISERDIIRAIAS 60
           M    I + N   +    ++ DA K+M + ++  L+V  D   +  G++SER II+    
Sbjct: 3   MRVEKIMNSNFKTVNWNTTVFDAVKIMNENHLYGLVV-KDDNGNDVGLLSERSIIKRFIP 61

Query: 61  --GIQPSEPVDNIMTRKVVYVYKDTPVWEIARLMRKYNIRHILVMD-NGQIFGVISIRDL 117
                   P+  +M + +  V  D  V ++A  + +  +    V+D  G++ G++++ DL
Sbjct: 62  RNKKPDEVPIRLVMRKPIPKVKSDYDVKDVAAYLSENGLERCAVVDDPGRVVGIVTLTDL 121

Query: 118 LKE 120
            + 
Sbjct: 122 SRY 124



 Score = 45.1 bits (106), Expect = 9e-08
 Identities = 11/69 (15%), Positives = 31/69 (44%), Gaps = 2/69 (2%)

Query: 6   IASKNVICIKPGASILDAAKLMAQRNIGFLIVSSDCKRDLAGVISERDIIRAIASGIQPS 65
           +  K +  +K    + D A  +++  +    V  D  R + G+++  D+ R ++     +
Sbjct: 74  VMRKPIPKVKSDYDVKDVAAYLSENGLERCAVVDDPGR-VVGIVTLTDLSRYLSRAS-IT 131

Query: 66  EPVDNIMTR 74
           + + +  T+
Sbjct: 132 DILLSHRTK 140


>2rc3A1 [d.37.1.1] CBS DOMAIN A:23 -- 149
          Length = 127

 Score = 77.8 bits (191), Expect = 1e-17
 Identities = 34/113 (30%), Positives = 56/113 (49%)

Query: 8   SKNVICIKPGASILDAAKLMAQRNIGFLIVSSDCKRDLAGVISERDIIRAIASGIQPSEP 67
              V+ I P  S+ +A + MA  NIG L+V  D K        +      +         
Sbjct: 12  GHTVVAIGPDDSVFNAMQKMAADNIGALLVMKDEKLVGILTERDFSRKSYLLDKPVKDTQ 71

Query: 68  VDNIMTRKVVYVYKDTPVWEIARLMRKYNIRHILVMDNGQIFGVISIRDLLKE 120
           V  IMTR+V YV  +    +   L+ +  +RH+ V+D+G++ G++SI DL+K+
Sbjct: 72  VKEIMTRQVAYVDLNNTNEDCMALITEMRVRHLPVLDDGKVIGLLSIGDLVKD 124



 Score = 38.9 bits (90), Expect = 6e-06
 Identities = 12/55 (21%), Positives = 25/55 (45%), Gaps = 2/55 (3%)

Query: 6   IASKNVICIKPGASILDAAKLMAQRNIGFLIVSSDCKRDLAGVISERDIIRAIAS 60
           I ++ V  +    +  D   L+ +  +  L V  D K  + G++S  D+++   S
Sbjct: 75  IMTRQVAYVDLNNTNEDCMALITEMRVRHLPVLDDGK--VIGLLSIGDLVKDAIS 127



 Score = 36.6 bits (84), Expect = 3e-05
 Identities = 14/53 (26%), Positives = 27/53 (50%), Gaps = 3/53 (5%)

Query: 67  PVDNIMT---RKVVYVYKDTPVWEIARLMRKYNIRHILVMDNGQIFGVISIRD 116
            V +++      VV +  D  V+   + M   NI  +LVM + ++ G+++ RD
Sbjct: 3   TVKHLLQEKGHTVVAIGPDDSVFNAMQKMAADNIGALLVMKDEKLVGILTERD 55


>1o50A3 [d.37.1.1] CBS DOMAIN-CONTAINING PREDICTED PROTEIN TM0935
           A:1 -- 145
          Length = 138

 Score = 73.6 bits (180), Expect = 2e-16
 Identities = 22/129 (17%), Positives = 48/129 (37%), Gaps = 10/129 (7%)

Query: 1   MNAGAIASKNVICIKPGASILDAAKLMAQRNIGFLIVSSDCKRDLAGVISERDIIRAIAS 60
            +   + S     ++    I +    + +  +   +        L G+I    +++    
Sbjct: 4   KDVCKLISLKPTVVEEDTPIEEIVDRILEDPVTRTVYV-ARDNKLVGMIPVMHLLKVSGF 62

Query: 61  GIQ--------PSEPVDNIMTRKVVYVYKDTPVWEIARLMRKYNIRHILVMD-NGQIFGV 111
                            + +    VYV+ DTP+ E  +LM   NI+ + V+D  G+I G 
Sbjct: 63  HFFGFIPSMKRLIAKNASEIMLDPVYVHMDTPLEEALKLMIDNNIQEMPVVDEKGEIVGD 122

Query: 112 ISIRDLLKE 120
           ++  ++L  
Sbjct: 123 LNSLEILLA 131


>2v8qE2 [d.37.1.1] 5'-AMP-ACTIVATED PROTEIN KINASE SUBUNIT GAMMA-1
           E:23 -- 181
          Length = 159

 Score = 73.3 bits (179), Expect = 3e-16
 Identities = 14/133 (10%), Positives = 43/133 (32%), Gaps = 18/133 (13%)

Query: 6   IASKNVICIKPGASILDAAKLMAQRNIGFLIVSSDCKRDLAGVISERDIIRAIASGIQ-- 63
             S  ++       +  A   +    +    +    K+   G+++  D I  +    +  
Sbjct: 20  PTSSKLVVFDTSLQVKKAFFALVTNGVRAAPLWDSKKQSFVGMLTITDFINILHRYYKSA 79

Query: 64  --------------PSEPVDNIMTRKVVYVYKDTPVWEIARLMRKYNIRHILVMD--NGQ 107
                           E       + +V +  +  +++    + +  I  + V+D  +G 
Sbjct: 80  LVQIYELEEHKIETWREVYLQDSFKPLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGN 139

Query: 108 IFGVISIRDLLKE 120
              +++ + +LK 
Sbjct: 140 TLYILTHKRILKF 152



 Score = 41.7 bits (97), Expect = 9e-07
 Identities = 13/58 (22%), Positives = 27/58 (46%)

Query: 6   IASKNVICIKPGASILDAAKLMAQRNIGFLIVSSDCKRDLAGVISERDIIRAIASGIQ 63
            + K ++CI P AS+ DA   + +  I  L V      +   +++ + I++ +   I 
Sbjct: 101 DSFKPLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFIT 158


>1xkfA3 [d.37.1.1] HYPOTHETICAL PROTEIN RV2626C A:2 -- 124
          Length = 120

 Score = 72.8 bits (178), Expect = 4e-16
 Identities = 22/118 (18%), Positives = 51/118 (43%), Gaps = 2/118 (1%)

Query: 3   AGAIASKNVICIKPGASILDAAKLMAQRNIGFLIVSSDCKRDLAGVISERDIIRAIASGI 62
           A  I +  V C+    ++  AA+ M + +IG L +  D  R    +     +I+ +A   
Sbjct: 3   ARDIMNAGVTCVGEHETLTAAAQYMREHDIGALPICGDDDRLHGMLTDRDIVIKGLA--A 60

Query: 63  QPSEPVDNIMTRKVVYVYKDTPVWEIARLMRKYNIRHILVMDNGQIFGVISIRDLLKE 120
                        + YV  +  + E+  +M ++ +R + V+   ++ G+++  D+ + 
Sbjct: 61  GLDPNTATAGELAIYYVDANASIQEMLNVMEEHQVRRVPVISEHRLVGIVTEADIARH 118



 Score = 38.6 bits (89), Expect = 8e-06
 Identities = 12/54 (22%), Positives = 29/54 (53%), Gaps = 1/54 (1%)

Query: 67  PVDNIMTRKVVYVYKDTPVWEIARLMRKYNIRHILV-MDNGQIFGVISIRDLLK 119
              +IM   V  V +   +   A+ MR+++I  + +  D+ ++ G+++ RD++ 
Sbjct: 2   TARDIMNAGVTCVGEHETLTAAAQYMREHDIGALPICGDDDRLHGMLTDRDIVI 55



 Score = 36.2 bits (83), Expect = 4e-05
 Identities = 12/51 (23%), Positives = 25/51 (49%), Gaps = 2/51 (3%)

Query: 8   SKNVICIKPGASILDAAKLMAQRNIGFLIVSSDCKRDLAGVISERDIIRAI 58
              +  +   ASI +   +M +  +  + V S+ +  L G+++E DI R +
Sbjct: 71  ELAIYYVDANASIQEMLNVMEEHQVRRVPVISEHR--LVGIVTEADIARHL 119


>1zfjA4 [d.37.1.1] INOSINE MONOPHOSPHATE DEHYDROGENASE A:95 -- 220
          Length = 126

 Score = 72.8 bits (178), Expect = 4e-16
 Identities = 17/116 (14%), Positives = 48/116 (41%), Gaps = 3/116 (2%)

Query: 6   IASKNVICIKPGASILDAAKLMAQRNIGFLIVSSDCKRDLAGVISERDIIRAIASGIQPS 65
               +   + P   + +A +L  +  I  + +  +   +   V    +      S    +
Sbjct: 2   GVIIDPFFLTPEHKVSEAEELXQRYRISGVPIV-ETLANRKLVGIITNRDXRFISDYN-A 59

Query: 66  EPVDNIMTRKVVYVYKDTPVWEIARLMRKYNIRHILVMD-NGQIFGVISIRDLLKE 120
              ++  +  +V     T +    R++ ++ I  + ++D +G++ G+I+I+D+ K 
Sbjct: 60  PISEHXTSEHLVTAAVGTDLETAERILHEHRIEKLPLVDNSGRLSGLITIKDIEKV 115



 Score = 42.4 bits (99), Expect = 6e-07
 Identities = 7/47 (14%), Positives = 19/47 (40%)

Query: 70  NIMTRKVVYVYKDTPVWEIARLMRKYNIRHILVMDNGQIFGVISIRD 116
           N +     ++  +  V E   L ++Y I  + +++      ++ I  
Sbjct: 1   NGVIIDPFFLTPEHKVSEAEELXQRYRISGVPIVETLANRKLVGIIT 47


>1e6vC [d.58.31.1] METHYL-COENZYME M REDUCTASE I GAMMA SUBUNIT
          Length = 248

 Score = 72.4 bits (176), Expect = 5e-16
 Identities = 9/112 (8%), Positives = 29/112 (25%), Gaps = 2/112 (1%)

Query: 9   KNVICIKPGASILDAAKLMAQRNIGFLIVSSDCKRDLAGVISERDIIRAIASGIQPSEPV 68
                ++        + +      G  +     +  L      R  +      ++  +  
Sbjct: 131 IAKELLETEIFDPARSGVRGATVHGHALR--LDENGLMLHALRRYRLNEETGEVEYVKDQ 188

Query: 69  DNIMTRKVVYVYKDTPVWEIARLMRKYNIRHILVMDNGQIFGVISIRDLLKE 120
             I   + + V       ++      Y I      ++ ++  V+     L+ 
Sbjct: 189 VGIELDEPIPVGAPADEDDLKERTTIYRIDGTPYREDEELLQVVQRIHELRT 240



 Score = 37.0 bits (84), Expect = 2e-05
 Identities = 10/57 (17%), Positives = 16/57 (28%), Gaps = 2/57 (3%)

Query: 6   IASKNVICIKPGASILDAAKLMAQRNIGFLIVSSDCKRDLAGVISERDIIRAIASGI 62
           I     I +   A   D  +      I       D   +L  V+     +R +A   
Sbjct: 191 IELDEPIPVGAPADEDDLKERTTIYRIDGTPYRED--EELLQVVQRIHELRTLAGYR 245


>3ddjA1 [d.37.1.1] CBS DOMAIN-CONTAINING PROTEIN A:136 -- 276
          Length = 141

 Score = 71.3 bits (174), Expect = 1e-15
 Identities = 26/128 (20%), Positives = 49/128 (38%), Gaps = 9/128 (7%)

Query: 1   MNAGAIASKNVICIKPGASILDAAKLMAQRNIGFLIVSSDCKRDLAGVISERDIIRAIAS 60
                  S  V  I     +  A KL  +R    L V  D    + G+++  + I+ +A 
Sbjct: 2   FPVKVFXSTKVQTIYKEVRLDQAVKLXLRRGFRRLPVI-DDDNKVVGIVTVVNAIKQLAK 60

Query: 61  GI-------QPSEPVDNIMTRKVVYVYKDTPVWEIARLMRKYNIRHILVMD-NGQIFGVI 112
            +          + V ++    +V + +   V   A       I  +L+++ +  I G+I
Sbjct: 61  AVDKLDPDYFYGKVVKDVXVTNLVTIDELASVNRAAAEXIVKRIGSLLILNKDNTIRGII 120

Query: 113 SIRDLLKE 120
           + RDLL  
Sbjct: 121 TERDLLIA 128



 Score = 35.5 bits (81), Expect = 7e-05
 Identities = 15/59 (25%), Positives = 29/59 (49%), Gaps = 1/59 (1%)

Query: 1   MNAGAIASKNVICIKPGASILDAAKLMAQRNIGFLIVSSDCKRDLAGVISERDIIRAIA 59
                +   N++ I   AS+  AA     + IG L++ +     + G+I+ERD++ A+ 
Sbjct: 73  KVVKDVXVTNLVTIDELASVNRAAAEXIVKRIGSLLILNKDNT-IRGIITERDLLIALH 130


>1pbjA3 [d.37.1.1] HYPOTHETICAL PROTEIN A:2 -- 121
          Length = 120

 Score = 69.8 bits (171), Expect = 3e-15
 Identities = 28/103 (27%), Positives = 50/103 (48%), Gaps = 3/103 (2%)

Query: 18  ASILDAAKLMAQRNIGFLIVSSDCKRDLAGVISERDIIRAIASGIQPSE-PVDNIMTRKV 76
           AS+ D  +   +   G  +V  +  R   G+++  D++ AIA G   +E  V  +  R +
Sbjct: 17  ASLEDVLRNYVENAKGSSVVVKEGVR--VGIVTTWDVLEAIAEGDDLAEVKVWEVXERDL 74

Query: 77  VYVYKDTPVWEIARLMRKYNIRHILVMDNGQIFGVISIRDLLK 119
           V +     + E A    K  +  +LV ++ +I GVIS  D+L+
Sbjct: 75  VTISPRATIKEAAEKXVKNVVWRLLVEEDDEIIGVISATDILR 117



 Score = 44.0 bits (104), Expect = 2e-07
 Identities = 17/57 (29%), Positives = 32/57 (56%), Gaps = 2/57 (3%)

Query: 1   MNAGAIASKNVICIKPGASILDAAKLMAQRNIGFLIVSSDCKRDLAGVISERDIIRA 57
           +    +  ++++ I P A+I +AA+   +  +  L+V  D +  + GVIS  DI+RA
Sbjct: 64  VKVWEVXERDLVTISPRATIKEAAEKXVKNVVWRLLVEEDDE--IIGVISATDILRA 118


>1yavA3 [d.37.1.1] HYPOTHETICAL PROTEIN BSU14130 A:13 -- 144
          Length = 132

 Score = 68.9 bits (168), Expect = 6e-15
 Identities = 19/119 (15%), Positives = 45/119 (37%), Gaps = 8/119 (6%)

Query: 8   SKNVICIKPGASILDAAKLMAQRNIGFLIVSSDCKRDLAGVISERDIIRAIASGI----- 62
           +  V  ++ G ++  A  ++ +     + V  D    L G+I    I+ +I         
Sbjct: 11  ADKVAHVQVGNNLEHALLVLTKTGYTAIPVL-DPSYRLHGLIGTNMIMNSIFGLERIEFE 69

Query: 63  -QPSEPVDNIMTRKVVYVYKDTPVWEIARLMRKYNIRHILVMDNGQIFGVISIRDLLKE 120
                 V+ +M   +  ++ + P+ +   ++        +  D     G+ + R +LKE
Sbjct: 70  KLDQITVEEVMLTDIPRLHINDPIMKGFGMVINNGF-VCVENDEQVFEGIFTRRVVLKE 127


>2ouxA2 [d.37.1.1] MAGNESIUM TRANSPORTER A:136 -- 262
          Length = 127

 Score = 67.7 bits (165), Expect = 1e-14
 Identities = 25/121 (20%), Positives = 55/121 (45%), Gaps = 10/121 (8%)

Query: 3   AGAIASKNVICIKPGASILDAAKLMAQRNIGFLIVSS----DCKRDLAGVISERDIIRAI 58
           AGAI +   + I    ++  A  ++  +      +      D +  L GVIS RD+I   
Sbjct: 3   AGAIXTTEFVSIVANQTVRSAXYVLKNQADXAETIYYVYVVDQENHLVGVISLRDLIV-- 60

Query: 59  ASGIQPSEPVDNIMTRKVVYVYKDTPVWEIARLMRKYNIRHILVMD-NGQIFGVISIRDL 117
                    + +I+  +V+ V+      ++A+ +R Y+   + V D +  + G++++ D+
Sbjct: 61  ---NDDDTLIADILNERVISVHVGDDQEDVAQTIRDYDFLAVPVTDYDDHLLGIVTVDDI 117

Query: 118 L 118
           +
Sbjct: 118 I 118



 Score = 33.4 bits (76), Expect = 3e-04
 Identities = 15/58 (25%), Positives = 26/58 (44%), Gaps = 6/58 (10%)

Query: 66  EPVDNIMTRKVVYVYKDTPVWEIARLMRKYN-----IRHILVMD-NGQIFGVISIRDL 117
           E    I T + V +  +  V     +++        I ++ V+D    + GVIS+RDL
Sbjct: 1   ETAGAIXTTEFVSIVANQTVRSAXYVLKNQADXAETIYYVYVVDQENHLVGVISLRDL 58


>1b3oB4 [d.37.1.1] PROTEIN (INOSINE MONOPHOSPHATE DEHYDROGENASE 2)
           B:112 -- 231
          Length = 90

 Score = 65.7 bits (160), Expect = 5e-14
 Identities = 11/91 (12%), Positives = 31/91 (34%), Gaps = 4/91 (4%)

Query: 30  RNIGFLIVSSDCKRDLAGVISERDIIRAIASGIQPSEPVDNIMTRKVVYVYKDTPVWEIA 89
           +      V    K  +   I   D  R  +   +    +       +V       + E  
Sbjct: 1   QGFITDPVVLSPKDRVRCGIPITDTGRMGS---RLVGIIIMTKREDLVVAPAGITLKEAN 57

Query: 90  RLMRKYNIRHILVMD-NGQIFGVISIRDLLK 119
            ++++     + +++ + ++  +I+  DL K
Sbjct: 58  EILQRSKKGKLPIVNEDDELVAIIARTDLKK 88



 Score = 37.6 bits (87), Expect = 2e-05
 Identities = 7/52 (13%), Positives = 25/52 (48%), Gaps = 1/52 (1%)

Query: 6  IASKNVICIKPGASILDAAKLMAQRNIGFLIVSSDCKRDLAGVISERDIIRA 57
             ++++    G ++ +A +++ +   G L + ++    L  +I+  D+ + 
Sbjct: 39 TKREDLVVAPAGITLKEANEILQRSKKGKLPIVNEDDE-LVAIIARTDLKKN 89


>2d4zA3 [d.37.1.1] CHLORIDE CHANNEL PROTEIN A:527 -- 606 A:691 --
           770
          Length = 160

 Score = 64.1 bits (155), Expect = 2e-13
 Identities = 16/147 (10%), Positives = 41/147 (27%), Gaps = 27/147 (18%)

Query: 1   MNAGAIASKNVICIKPGASILDAAKLMAQRNIGFLIVSSDCKRD-LAGVISERDIIR--- 56
           +  G I  ++V  I   ++  D   ++ Q  + F         + L G I   ++     
Sbjct: 11  IQVGDIMVRDVTSIASTSTYGDLLHVLRQTKLKFFPFVDTPDTNTLLGSIDRTEVEGLLQ 70

Query: 57  -----------------------AIASGIQPSEPVDNIMTRKVVYVYKDTPVWEIARLMR 93
                                                 + +    + + T + +   L  
Sbjct: 71  RRISAYRRQPFEEMLTLEEIYRWEQREKNVVVNFETCRIDQSPFQLVEGTSLQKTHTLFS 130

Query: 94  KYNIRHILVMDNGQIFGVISIRDLLKE 120
              +    V   G++ GV+++ ++   
Sbjct: 131 LLGLDRAYVTSMGKLVGVVALAEIQAA 157



 Score = 36.7 bits (84), Expect = 3e-05
 Identities = 12/52 (23%), Positives = 22/52 (42%), Gaps = 2/52 (3%)

Query: 8   SKNVICIKPGASILDAAKLMAQRNIGFLIVSSDCKRDLAGVISERDIIRAIA 59
            ++   +  G S+     L +   +    V+S  K  L GV++  +I  AI 
Sbjct: 110 DQSPFQLVEGTSLQKTHTLFSLLGLDRAYVTSMGK--LVGVVALAEIQAAIE 159


>1f1zA2 [c.52.1.16] TNSA ENDONUCLEASE A:8 -- 168
          Length = 161

 Score = 63.3 bits (153), Expect = 3e-13
 Identities = 16/131 (12%), Positives = 31/131 (23%), Gaps = 14/131 (10%)

Query: 14  IKPGASILDAAKLMAQRNIGFLIVSSDCKRDLAGVISERDIIRAIASGIQPSEPVDNIMT 73
           IK G         +    +  +  S    R      + R               V   + 
Sbjct: 10  IKEGRGQGHGKDYIPWLTVQEVPSSGRSHRIY-SHKTGRVHHLLSD----LELAVFLSLE 64

Query: 74  R--KVVYVYKDTPVWEIARLMRKYNIRHILVMDNG-----QIFGVISIRDLLKESDVIER 126
               V+ + +  P+          +      +  G         ++  +D   E      
Sbjct: 65  WESSVLDIREQFPLLPSDTRQIAIDSGIKHPVIRGVDQVMSTDFLVDCKDGPFE--QFAI 122

Query: 127 LVEYAEERIDE 137
            V+ A    DE
Sbjct: 123 QVKPAAALQDE 133



 Score = 36.3 bits (83), Expect = 4e-05
 Identities = 5/70 (7%), Positives = 20/70 (28%), Gaps = 1/70 (1%)

Query: 74  RKVVYVYKDTPVWEIARLMRKYNIRHILVMD-NGQIFGVISIRDLLKESDVIERLVEYAE 132
           +    + +          +    ++ +     + +I+   + R     SD+   +    E
Sbjct: 5   QIARRIKEGRGQGHGKDYIPWLTVQEVPSSGRSHRIYSHKTGRVHHLLSDLELAVFLSLE 64

Query: 133 ERIDEISAHD 142
                +   +
Sbjct: 65  WESSVLDIRE 74



 Score = 33.6 bits (76), Expect = 2e-04
 Identities = 5/52 (9%), Positives = 14/52 (26%), Gaps = 3/52 (5%)

Query: 10  NVICIKPGASILDAAKLMAQRNIGFLIVSSDCKR---DLAGVISERDIIRAI 58
           +V+ I+    +L +       + G                 ++  +D     
Sbjct: 68  SVLDIREQFPLLPSDTRQIAIDSGIKHPVIRGVDQVMSTDFLVDCKDGPFEQ 119


>1vr9A3 [d.37.1.1] CBS DOMAIN PROTEIN/ACT DOMAIN PROTEIN A:1 -- 121
          Length = 121

 Score = 63.2 bits (154), Expect = 3e-13
 Identities = 18/116 (15%), Positives = 50/116 (43%), Gaps = 7/116 (6%)

Query: 6   IASKNVICIKPGASILDAAKLMAQRNIGFLIVSSDCKRDLAGVISERDIIRAIASGIQPS 65
             +++   ++  A++ +      Q      IV  D +    GV+++ D++      +   
Sbjct: 6   WVTQDFPXVEESATVRECLHRXRQYQTNECIVK-DREGHFRGVVNKEDLL-----DLDLD 59

Query: 66  EPVDNIMTRKVVYVYKDTPVWEIARLMRKYNIRHILVMDN-GQIFGVISIRDLLKE 120
             V N ++    +V+++  +     L  ++   ++ V+D   ++ G +S+ D L+ 
Sbjct: 60  SSVFNKVSLPDFFVHEEDNITHALLLFLEHQEPYLPVVDEEXRLKGAVSLHDFLEA 115



 Score = 41.2 bits (97), Expect = 1e-06
 Identities = 16/63 (25%), Positives = 26/63 (41%), Gaps = 2/63 (3%)

Query: 68  VDNIMTRKVVYVYKDTPVWEIARLMRKYNIRHILVMD-NGQIFGVISIRDLLKESDVIER 126
           V   +T+    V +   V E     R+Y     +V D  G   GV++  DLL + D+   
Sbjct: 3   VKKWVTQDFPXVEESATVRECLHRXRQYQTNECIVKDREGHFRGVVNKEDLL-DLDLDSS 61

Query: 127 LVE 129
           +  
Sbjct: 62  VFN 64


>2yzqA2 [d.37.1.1] PUTATIVE UNCHARACTERIZED PROTEIN PH1780 A:1 --
           122
          Length = 100

 Score = 62.5 bits (152), Expect = 5e-13
 Identities = 19/104 (18%), Positives = 46/104 (44%), Gaps = 17/104 (16%)

Query: 18  ASILDAAKLMAQRNIGFLIVSSDCKRDLAGVISERDIIRAIASGIQPSEPVDNIMTRKVV 77
               +   +     +    V  + +  L G+IS + I+                + R V 
Sbjct: 6   IMTQNPVTITLPATVRSFPVV-NKEGKLVGIISVKRIML---------------VKRDVP 49

Query: 78  YVYKDTPVWEIARLMRKYNIRHILVMD-NGQIFGVISIRDLLKE 120
            V ++  + + A+LM +Y+ R ++V+D  G+  G++++ D+++ 
Sbjct: 50  VVKENDTLKKAAKLMLEYDYRRVVVVDSKGKPVGILTVGDIIRR 93



 Score = 43.6 bits (103), Expect = 2e-07
 Identities = 15/58 (25%), Positives = 30/58 (51%), Gaps = 1/58 (1%)

Query: 6  IASKNVICIKPGASILDAAKLMAQRNIGFLIVSSDCKRDLAGVISERDIIRAIASGIQ 63
          +  ++V  +K   ++  AAKLM + +   ++V  D K    G+++  DIIR   +  +
Sbjct: 43 LVKRDVPVVKENDTLKKAAKLMLEYDYRRVVV-VDSKGKPVGILTVGDIIRRYFAKSE 99



 Score = 32.9 bits (75), Expect = 4e-04
 Identities = 7/39 (17%), Positives = 18/39 (46%), Gaps = 1/39 (2%)

Query: 81  KDTPVWEIARLMRKYNIRHILVMD-NGQIFGVISIRDLL 118
           K         +     +R   V++  G++ G+IS++ ++
Sbjct: 4   KTIMTQNPVTITLPATVRSFPVVNKEGKLVGIISVKRIM 42


>2ooxE1 [d.37.1.1] HYPOTHETICAL PROTEIN C1556.08C IN CHROMOSOME I
           E:3 -- 181
          Length = 179

 Score = 55.2 bits (132), Expect = 8e-11
 Identities = 21/139 (15%), Positives = 42/139 (30%), Gaps = 26/139 (18%)

Query: 8   SKNVICIKPGASILDAAKLMAQRNIGFLIVSSDCKRDLAGVISERDIIRAIASGIQ---- 63
           S  +I       +  +  L+   NI    +        AG+++  D +  I    Q    
Sbjct: 29  SFRLIVFDVTLFVKTSLSLLTLNNIVSAPLWDSEANKFAGLLTMADFVNVIKYYYQSSSF 88

Query: 64  ----------------PSEPVDNIMTRKVVYVYKDTPVWEIARLMRKYNIRHILVM---- 103
                             E     +  + +YV+    + +    M K   R I ++    
Sbjct: 89  PEAIAEIDKFRLLGLREVERKIGAIPPETIYVHPMHSLMDACLAMSKSRARRIPLIDVDG 148

Query: 104 --DNGQIFGVISIRDLLKE 120
              +  I  V++   +LK 
Sbjct: 149 ETGSEMIVSVLTQYRILKF 167



 Score = 31.7 bits (71), Expect = 0.001
 Identities = 9/60 (15%), Positives = 24/60 (40%), Gaps = 4/60 (6%)

Query: 8   SKNVICIKPGASILDAAKLMAQRNIGFLIVSSDCKRD----LAGVISERDIIRAIASGIQ 63
               I + P  S++DA   M++     + +           +  V+++  I++ I+   +
Sbjct: 114 PPETIYVHPMHSLMDACLAMSKSRARRIPLIDVDGETGSEMIVSVLTQYRILKFISMNCK 173


>1nfbA4 [d.37.1.1] INOSINE-5'-MONOPHOSPHATE DEHYDROGENASE 2 A:112 --
           231
          Length = 61

 Score = 43.6 bits (103), Expect = 2e-07
 Identities = 4/71 (5%), Positives = 23/71 (32%), Gaps = 16/71 (22%)

Query: 47  GVISERDIIRAIASGIQPSEPVDNIMTR---KVVYVYKDTPVWEIARLMRKYNIRHILVM 103
           G I++  +                I      ++        + E   ++++     + ++
Sbjct: 2   GFITDPVV------------LSPGIPITDTGRMGSAPAGITLKEANEILQRSKKGKLPIV 49

Query: 104 D-NGQIFGVIS 113
           + + ++  + +
Sbjct: 50  NEDDEVAIIAN 60


  Database: 40scop73nmM
    Posted date:  Nov 2, 2009 11:39 AM
  Number of letters in database: 1,678,726
  Number of sequences in database:  9549
  
Lambda     K      H
   0.324    0.140    0.406 

Gapped
Lambda     K      H
   0.267   0.0571    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 9549
Number of Hits to DB: 11,392,040
Number of extensions: 817848
Number of successful extensions: 4521
Number of sequences better than 1.0e-03: 8
Number of HSP's gapped: 4316
Number of HSP's successfully gapped: 238
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)