RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 40scop73nmM 
           9549 sequences; 1,678,726 total letters

Searching..................................................done

Query= AAL64265.1 paer1 AAL64265.1 GIB00076CH01 "conserved
hypothetical protein"
         (360 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

2fnaA2 [c.37.1.20] CONSERVED HYPOTHETICAL PROTEIN A:1 -- 283          202   7e-55

>2fnaA2 [c.37.1.20] CONSERVED HYPOTHETICAL PROTEIN A:1 -- 283
          Length = 278

 Score =  202 bits (514), Expect = 7e-55
 Identities = 107/256 (41%), Positives = 156/256 (60%), Gaps = 13/256 (5%)

Query: 33  LTLILGMRRVGKTSVVKAAT--YGKLRIYIDARYFEEKRYISYGDXXXXXXXXXXXXXXX 90
           +TL+LG+RR GK+S++K          IY+D R FEE+ YISY D               
Sbjct: 31  ITLVLGLRRTGKSSIIKIGINELNLPYIYLDLRKFEERNYISYKDFLLELQKEINKLVKR 90

Query: 91  XXXXGELLSKIRGVSVAGVDVKFEIGRNAPSFAEILEAFDQWAREQGERLVLIIDEAQEL 150
                + L  I+G+ + G ++KF    N  SFA +LE+F+Q +++    +++++DEAQEL
Sbjct: 91  LPSLLKALKNIQGIVIXGNEIKF----NRLSFANLLESFEQASKD---NVIIVLDEAQEL 143

Query: 151 AKLRGRTLLPPLGYAYDNLRNISMVFTGSKAGLLLRFLRLEDPHSPLFGRYFEKIELGPF 210
            KLRG  LLP L YAYDNL+ I  + +GS+ GLL  +LR+EDP SPLFGR F  +EL PF
Sbjct: 144 VKLRGVNLLPALAYAYDNLKRIKFIXSGSEXGLLYDYLRVEDPESPLFGRAFSTVELKPF 203

Query: 211 SRELSVQFLTKGFEEAGVRVSRELIDRAVDELDGVVGWLAYFGLRAV--KKPDSALEETL 268
           SRE +++FL +GF+EA +    +  +   +++ G+ GWL YFG   +  K  D A+ +TL
Sbjct: 204 SREEAIEFLRRGFQEADIDF--KDYEVVYEKIGGIPGWLTYFGFIYLDNKNLDFAINQTL 261

Query: 269 EYAARLAAAEFCNFVQ 284
           EYA +L   EF NF+ 
Sbjct: 262 EYAKKLILKEFENFLH 277


  Database: 40scop73nmM
    Posted date:  Nov 2, 2009 11:39 AM
  Number of letters in database: 1,678,726
  Number of sequences in database:  9549
  
Lambda     K      H
   0.322    0.140    0.405 

Gapped
Lambda     K      H
   0.267   0.0648    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 9549
Number of Hits to DB: 10,236,236
Number of extensions: 735672
Number of successful extensions: 3262
Number of sequences better than 1.0e-03: 7
Number of HSP's gapped: 3246
Number of HSP's successfully gapped: 31
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.4 bits)