RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 40scop73nmM 
           9549 sequences; 1,678,726 total letters

Searching..................................................done

Query= AAL65085.1 paer1 AAL65085.1 GIB00076CH01 "pyruvate
formate-lyase activating enzyme homolog"
         (364 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

1r30A [c.1.28.1] BIOTIN SYNTHASE                                      102   8e-25
1tv7A [c.1.28.3] MOLYBDENUM COFACTOR BIOSYNTHESIS PROTEIN A            84   3e-19
2h7aA1 [d.350.1.1] HYPOTHETICAL PROTEIN YCGL A:2 -- 110                59   1e-11
1iwmA [b.125.1.2] OUTER MEMBRANE LIPOPROTEIN LOLB                      44   2e-07
1n7kA [c.1.10.1] DEOXYRIBOSE-PHOSPHATE ALDOLASE                        38   1e-05
2q02A1 [c.1.15.4] PUTATIVE CYTOPLASMIC PROTEIN A:1 -- 271              38   2e-05
2g0wA1 [c.1.15.4] LMO2234 PROTEIN A:10 -- 284                          37   3e-05
1rhcA [c.1.16.3] F420-DEPENDENT ALCOHOL DEHYDROGENASE                  34   2e-04
1b73A2 [c.78.2.1] GLUTAMATE RACEMASE A:106 -- 252                      33   7e-04
2p10A1 [c.1.12.9] MLL9387 PROTEIN A:8 -- 204                           33   8e-04

>1r30A [c.1.28.1] BIOTIN SYNTHASE
          Length = 314

 Score =  102 bits (255), Expect = 8e-25
 Identities = 43/183 (23%), Positives = 76/183 (41%), Gaps = 12/183 (6%)

Query: 91  HFYPG----TSAVTISTWGCNFPCAWCQNWHLSKTASPAGAYVPPERVVEWALENGDSGV 146
           HF P     ++ ++I T  C   C +C      KT   A   +  E+V+E A +   +G 
Sbjct: 31  HFDPRQVQVSTLLSIKTGACPEDCKYCPQSSRYKTGLEAERLMEVEQVLESARKAKAAGS 90

Query: 147 N-----VSFNEPTL-LAEYAEEVFRLARARGLHASINTNGYLTEEAVRRLAEAGMEGMNI 200
                  ++  P      Y E++ +  +A GL A + T G L+E   +RLA AG++  N 
Sbjct: 91  TRFCMGAAWKNPHERDMPYLEQMVQGVKAMGLEACM-TLGTLSESQAQRLANAGLDYYNH 149

Query: 201 DIKGGRETYRRWL-AANFDKFLSTARHAKGMGIHVEFTYLVIPGVNDHEAEEVIEAVASF 259
           ++    E Y   +    + + L T    +  GI V    +V  G    +   ++  +A+ 
Sbjct: 150 NLDTSPEFYGNIITTRTYQERLDTLEKVRDAGIKVCSGGIVGLGETVKDRAGLLLQLANL 209

Query: 260 GRE 262
              
Sbjct: 210 PTP 212


>1tv7A [c.1.28.3] MOLYBDENUM COFACTOR BIOSYNTHESIS PROTEIN A
          Length = 327

 Score = 84.0 bits (207), Expect = 3e-19
 Identities = 31/162 (19%), Positives = 70/162 (43%), Gaps = 10/162 (6%)

Query: 103 TWGCNFPCAWCQNWHLSKTAS---PAGAYVPPE---RVVEWALENGDSGVNVSFNEPTLL 156
           T  CNF C +C    +        P    +  +   R+ +   E G   + ++  EP + 
Sbjct: 19  TDRCNFRCDYCMPKEVFGDDFVFLPKNELLTFDEMARIAKVYAELGVKKIRITGGEPLMR 78

Query: 157 AEYAEEVFRLARARGLHA-SINTNGYLTEEAVRRLAEAGMEGMNIDIKGGRETYRRWLAA 215
            +    + +L +  G+    + TNG L ++  ++L +AG+  +N+ +    +T  + +  
Sbjct: 79  RDLDVLIAKLNQIDGIEDIGLTTNGLLLKKHGQKLYDAGLRRINVSLDAIDDTLFQSINN 138

Query: 216 N---FDKFLSTARHAKGMGIHVEFTYLVIPGVNDHEAEEVIE 254
                   L    +A  +G++V+   ++  G+ND +   ++E
Sbjct: 139 RNIKATTILEQIDYATSIGLNVKVNVVIQKGINDDQIIPMLE 180


>2h7aA1 [d.350.1.1] HYPOTHETICAL PROTEIN YCGL A:2 -- 110
          Length = 109

 Score = 58.7 bits (141), Expect = 1e-11
 Identities = 10/101 (9%), Positives = 25/101 (24%), Gaps = 4/101 (3%)

Query: 103 TWGCNFPCAWCQNWHLSKTASPAGAYVPPERVVEWALENGDSGVNVSF----NEPTLLAE 158
               +  C   ++    +T           RV E  ++                  L+  
Sbjct: 8   LKSKSMFCVIYRSSKRDQTYLYVEKKDDFSRVPEELMKGFGQPQLAMILPLDGRKKLVNA 67

Query: 159 YAEEVFRLARARGLHASINTNGYLTEEAVRRLAEAGMEGMN 199
             E+V +    +G +  +        +    +     +  N
Sbjct: 68  DIEKVKQALTEQGYYLQLPPPPEDLLKQHLSVMGQKTDDTN 108


>1iwmA [b.125.1.2] OUTER MEMBRANE LIPOPROTEIN LOLB
          Length = 177

 Score = 44.3 bits (104), Expect = 2e-07
 Identities = 10/136 (7%), Positives = 26/136 (19%), Gaps = 12/136 (8%)

Query: 149 SFNEPTLLAE------YAEEVFRLARARGLHASINTN-GYLTEEAVRRLAEAGMEGMNID 201
            + +                   ++  + ++A             +      G   + ++
Sbjct: 8   QWRQHQQDVRNLNQYQTRGAFAYISDQQKVYARFFWQQTGQDRYRLLLTNPLGSTELELN 67

Query: 202 IKGGRETYRRWLA--ANFDKFLSTARHAKGMGIHVEFTYLVI---PGVNDHEAEEVIEAV 256
            + G              D          GM I +      I   PG       +    +
Sbjct: 68  AQPGNVQLVDNKGQRYTADDAEEMIGKLTGMPIPLNSLRQWILGLPGDATDYKLDDQYRL 127

Query: 257 ASFGRETPLHITAYYP 272
           +               
Sbjct: 128 SEITYSQNGKNWKVVY 143


>1n7kA [c.1.10.1] DEOXYRIBOSE-PHOSPHATE ALDOLASE
          Length = 234

 Score = 38.3 bits (89), Expect = 1e-05
 Identities = 28/144 (19%), Positives = 49/144 (34%), Gaps = 17/144 (11%)

Query: 124 PAGAYVPPERVVE--WALENG----DSGVNVSFNEPTLLAEYAEEVFRLARARGLH-ASI 176
           P G      ++VE    LE G    D   ++S     +  E +  V +LA++ G     I
Sbjct: 81  PLGQAPLEVKLVEAQTVLEAGATELDVVPHLSLGPEAVYREVSGIV-KLAKSYGAVVKVI 139

Query: 177 NTNGYLTEEAVRRLAEAGMEGMNID-IKGGRETYRRWLAANFDKFLSTARHAKGMGIHVE 235
                  ++ +  L ++       D +K    T       +       A  AK +G+ V+
Sbjct: 140 LEAPLWDDKTLSLLVDSSRRA-GADIVKTS--TGVYTKGGDPVTVFRLASLAKPLGMGVK 196

Query: 236 FTYLVIPGVNDHE-AEEVIEAVAS 258
                  G+     A   + A A 
Sbjct: 197 ----ASGGIRSGIDAVLAVGAGAD 216


>2q02A1 [c.1.15.4] PUTATIVE CYTOPLASMIC PROTEIN A:1 -- 271
          Length = 271

 Score = 38.0 bits (88), Expect = 2e-05
 Identities = 24/116 (20%), Positives = 37/116 (31%), Gaps = 20/116 (17%)

Query: 161 EEVFRLARARGLHA--------SINTNGYLTEEAVRRLAEAGMEGMNIDIKGGRETYRRW 212
           E  FRL +    +         S +    L    VR LAE    G+ I        + + 
Sbjct: 21  EAFFRLVKRLEFNKVELRNDXPSGSVTDDLNYNQVRNLAEKY--GLEIVTINAVYPFNQL 78

Query: 213 LAANFDKFLSTARHAKGMGIHVEFTYLVIPGVND------HEAEEVIEAVASFGRE 262
                 K     R A+G+G       LV+  +ND          E I+ ++     
Sbjct: 79  TEEVVKKTEGLLRDAQGVGA----RALVLCPLNDGTIVPPEVTVEAIKRLSDLFAR 130


>2g0wA1 [c.1.15.4] LMO2234 PROTEIN A:10 -- 284
          Length = 275

 Score = 37.3 bits (86), Expect = 3e-05
 Identities = 20/136 (14%), Positives = 40/136 (29%), Gaps = 14/136 (10%)

Query: 149 SFNEPTLLAEYA-EEVFRLARARGLHA---------SINTNGYLTEEAVRRLAEAGMEGM 198
           + +  TL  E +  +  ++A   G                 G   E+ +R L E   +  
Sbjct: 5   TISSYTLGTEVSFPKRVKVAAENGFDGIGLRAENYVDALAAGLTDEDXLRILDEHNXKVT 64

Query: 199 NIDIKGGRETYRRWLAANFDKFLSTARHAKGMGIHVEFTYLVIPGVNDHEAEEVIEAVAS 258
            ++      T     A    K  +T   A+  G+     ++    +     E++I A+  
Sbjct: 65  EVEYITQWGTAEDRTAEQQKKEQTTFHXARLFGV----KHINCGLLEKIPEEQIIVALGE 120

Query: 259 FGRETPLHITAYYPAH 274
                   I       
Sbjct: 121 LCDRAEELIIGLEFXP 136


>1rhcA [c.1.16.3] F420-DEPENDENT ALCOHOL DEHYDROGENASE
          Length = 330

 Score = 34.3 bits (78), Expect = 2e-04
 Identities = 10/80 (12%), Positives = 19/80 (23%), Gaps = 7/80 (8%)

Query: 132 ERVVEWALENGDSGVNVSFNEPTLLAEYAEEVFRLARARGLH-------ASINTNGYLTE 184
            +  + A   GD  + V+    TL      +    AR  G           I  +     
Sbjct: 177 PKGAKLAGMYGDHLMTVAAAPSTLKNVTIPKFEEGAREAGKDPSKMEHAMLIWYSVDPDY 236

Query: 185 EAVRRLAEAGMEGMNIDIKG 204
           +            +   +  
Sbjct: 237 DKAVEALRFWAGCLVPSMFK 256


>1b73A2 [c.78.2.1] GLUTAMATE RACEMASE A:106 -- 252
          Length = 147

 Score = 32.7 bits (74), Expect = 7e-04
 Identities = 25/123 (20%), Positives = 41/123 (33%), Gaps = 13/123 (10%)

Query: 155 LLAEYAEEVFRLARARGLHASINTNGYLTEEAVRRLAEAGME--GMNIDIKGGRETYRRW 212
            L E   +V   A+A  L A +   G L  E  R++ E  ++     ID      T+   
Sbjct: 21  KLEEGGADV--FAKACPLFAPLAEEGLLEGEITRKVVEHYLKEFKGKIDTLILGCTHYPL 78

Query: 213 LAANFDKFLSTARHAKGMGIHVEFT--YLVIPGVNDHEA-----EEVIEAVA--SFGRET 263
           L     KFL  A               ++   G +  E         ++ +     GR+ 
Sbjct: 79  LKKEIKKFLGDAEVVDSSEALSLSLHNFIKDDGSSSLELFFTDLSPNLQFLIKLILGRDY 138

Query: 264 PLH 266
           P+ 
Sbjct: 139 PVK 141


>2p10A1 [c.1.12.9] MLL9387 PROTEIN A:8 -- 204
          Length = 188

 Score = 32.5 bits (74), Expect = 8e-04
 Identities = 23/129 (17%), Positives = 39/129 (30%), Gaps = 22/129 (17%)

Query: 139 LENGDSGVNVSFNEPTLLAEYAEEVFRLARARGLHASINTNGYLT--EEAVRRLAEAGME 196
           L  G++   V         + A EV  + R   + A +N           +R L E G  
Sbjct: 64  LAYGNANQIV--------VDXAREVLPVVRHTPVLAGVNGTDPFXVXSTFLRELKEIGFA 115

Query: 197 GMNIDIKGGR-ETYRRWLAANF----DKFLSTARHAKGMGIHVEFTYLVIPGV-NDHEAE 250
           G+      G  +   R           + +     A  + +      L  P V +  +A 
Sbjct: 116 GVQNFPTVGLIDGLFRQNLEETGXSYAQEVEXIAEAHKLDL------LTTPYVFSPEDAV 169

Query: 251 EVIEAVASF 259
              +A A  
Sbjct: 170 AXAKAGADI 178


  Database: 40scop73nmM
    Posted date:  Nov 2, 2009 11:39 AM
  Number of letters in database: 1,678,726
  Number of sequences in database:  9549
  
Lambda     K      H
   0.321    0.139    0.452 

Gapped
Lambda     K      H
   0.267   0.0518    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 9549
Number of Hits to DB: 11,512,532
Number of extensions: 796662
Number of successful extensions: 3979
Number of sequences better than 1.0e-03: 5
Number of HSP's gapped: 3939
Number of HSP's successfully gapped: 73
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.4 bits)