BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= AAZ20908.1 pubi0 uvrC GIB00256CH01 "excinuclease ABC chain C"
         (611 letters)

Database: 95pdb09Oct16x 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

2nrvA [x.x.x] UVRABC SYSTEM PROTEIN C                                 129   3e-32
2nrtA [x.x.x] UVRABC SYSTEM PROTEIN C                                 129   3e-32
2nrvB [x.x.x] UVRABC SYSTEM PROTEIN C                                 124   7e-31
2nrzB [x.x.x] UVRABC SYSTEM PROTEIN C                                 120   1e-29
2nrxB [x.x.x] UVRABC SYSTEM PROTEIN C                                 119   2e-29
2nrwA [x.x.x] UVRABC SYSTEM PROTEIN C                                 114   6e-28
3c65A [x.x.x] UVRABC SYSTEM PROTEIN C                                  76   3e-16
1yd6D [x.x.x] UVRC                                                     67   2e-13
2nrrA [x.x.x] UVRABC SYSTEM PROTEIN C                                  64   1e-12
1yd6A [x.x.x] UVRC                                                     62   3e-12
1yd6B [x.x.x] UVRC                                                     60   1e-11
1yd6C [x.x.x] UVRC                                                     60   2e-11
1yczA [x.x.x] UVRABC SYSTEM PROTEIN C                                  56   3e-10
1yd4A [x.x.x] UVRABC SYSTEM PROTEIN C                                  54   9e-10
1yd3A [x.x.x] UVRABC SYSTEM PROTEIN C                                  54   9e-10
1yd2A [x.x.x] UVRABC SYSTEM PROTEIN C                                  54   9e-10
1yd5A [x.x.x] UVRABC SYSTEM PROTEIN C                                  53   3e-09
1kftA [a.60.2] EXCINUCLEASE ABC SUBUNIT C                              42   6e-06
1x2iA [x.x.x] HEF HELICASE/NUCLEASE                                    40   1e-05

>2nrvA [x.x.x] UVRABC SYSTEM PROTEIN C
          Length = 218

 Score =  129 bits (323), Expect = 3e-32
 Identities = 78/229 (34%), Positives = 129/229 (56%), Gaps = 20/229 (8%)

Query: 378 KNLFEGVAKKFDLKNGLNLVEVYDNSHISGTNSVGAMITFGNEGFVKKR-YRKFDIKTKG 436
           K   E + K  ++K+    +E  D SH+ G  +V +++ F  +GF KK  YR++ I+   
Sbjct: 5   KEALEELMKLLNMKDFPYRIEGIDISHLQGKYTVASLVVF-EDGFPKKGDYRRYKIEQ-- 61

Query: 437 NEQDDFAMLKEVLTRRFKRAMLEKGNYLTLPDLILIDGGKGQYSSAKEVLDEFGLHDLPM 496
           +  DD+  ++ V+ RR+ +          LP+L+ +DGG GQ ++A E L E G  D P+
Sbjct: 62  DHPDDYESIRTVVKRRYSKH--------PLPNLLFVDGGIGQVNAAIEALKEIG-KDCPV 112

Query: 497 IAIAKGKLRNSGDETFFYKGKSFKFDKNDPTLFFMQRLRDEAHRFAITSHRAKRAKGITK 556
           + +AK       +ET  ++ +      + P L  + ++RDE HRFA++ HR +R K   +
Sbjct: 113 VGLAKK------EETVVFENREIHLPHDHPVLRLLVQIRDETHRFAVSYHRKRREKESLR 166

Query: 557 SLLDQIDGIGSIRKRALLNHFGSARAVESASFDEIKSVEGVEEKVAKKI 605
           S+LD + GIG IRK+ L+ HFGS   + SAS +EI  V G  E +A+++
Sbjct: 167 SVLDNVPGIGPIRKKKLIEHFGSLENIRSASLEEIARVIGSTE-IARRV 214


>2nrtA [x.x.x] UVRABC SYSTEM PROTEIN C
          Length = 217

 Score =  129 bits (323), Expect = 3e-32
 Identities = 78/229 (34%), Positives = 129/229 (56%), Gaps = 20/229 (8%)

Query: 378 KNLFEGVAKKFDLKNGLNLVEVYDNSHISGTNSVGAMITFGNEGFVKKR-YRKFDIKTKG 436
           K   E + K  ++K+    +E  D SH+ G  +V +++ F  +GF KK  YR++ I+   
Sbjct: 4   KEALEELMKLLNMKDFPYRIEGIDISHLQGKYTVASLVVF-EDGFPKKGDYRRYKIEQ-- 60

Query: 437 NEQDDFAMLKEVLTRRFKRAMLEKGNYLTLPDLILIDGGKGQYSSAKEVLDEFGLHDLPM 496
           +  DD+  ++ V+ RR+ +          LP+L+ +DGG GQ ++A E L E G  D P+
Sbjct: 61  DHPDDYESIRTVVKRRYSKH--------PLPNLLFVDGGIGQVNAAIEALKEIG-KDCPV 111

Query: 497 IAIAKGKLRNSGDETFFYKGKSFKFDKNDPTLFFMQRLRDEAHRFAITSHRAKRAKGITK 556
           + +AK       +ET  ++ +      + P L  + ++RDE HRFA++ HR +R K   +
Sbjct: 112 VGLAKK------EETVVFENREIHLPHDHPVLRLLVQIRDETHRFAVSYHRKRREKESLR 165

Query: 557 SLLDQIDGIGSIRKRALLNHFGSARAVESASFDEIKSVEGVEEKVAKKI 605
           S+LD + GIG IRK+ L+ HFGS   + SAS +EI  V G  E +A+++
Sbjct: 166 SVLDNVPGIGPIRKKKLIEHFGSLENIRSASLEEIARVIGSTE-IARRV 213


>2nrvB [x.x.x] UVRABC SYSTEM PROTEIN C
          Length = 214

 Score =  124 bits (311), Expect = 7e-31
 Identities = 78/229 (34%), Positives = 129/229 (56%), Gaps = 21/229 (9%)

Query: 378 KNLFEGVAKKFDLKNGLNLVEVYDNSHISGTNSVGAMITFGNEGFVKKR-YRKFDIKTKG 436
           K   E + K  ++K+    +E  D SH+ G  +V +++ F  +GF KK  YR++ I+   
Sbjct: 5   KEALEELMKLLNMKDFPYRIEGIDISHLQGKYTVASLVVF-EDGFPKKGDYRRYKIEQ-- 61

Query: 437 NEQDDFAMLKEVLTRRFKRAMLEKGNYLTLPDLILIDGGKGQYSSAKEVLDEFGLHDLPM 496
           +  DD+  ++ V+ RR+ +          LP+L+ +DGG GQ ++A E L E G  D P+
Sbjct: 62  DHPDDYESIRTVVKRRYSKH--------PLPNLLFVDGGIGQVNAAIEALKEIG-KDCPV 112

Query: 497 IAIAKGKLRNSGDETFFYKGKSFKFDKNDPTLFFMQRLRDEAHRFAITSHRAKRAKGITK 556
           + +AK       +ET  ++ +      + P L  + ++RDE HRFA++ HR +R K   +
Sbjct: 113 VGLAKK------EETVVFENREIHLPHDHPVLRLLVQIRDETHRFAVSYHRKRREKESLR 166

Query: 557 SLLDQIDGIGSIRKRALLNHFGSARAVESASFDEIKSVEGVEEKVAKKI 605
           S+LD + GIG IRK+ L+ HFGS   + SAS +EI  V G  E +A+++
Sbjct: 167 SVLD-VPGIGPIRKKKLIEHFGSLENIRSASLEEIARVIGSTE-IARRV 213


>2nrzB [x.x.x] UVRABC SYSTEM PROTEIN C
          Length = 213

 Score =  120 bits (300), Expect = 1e-29
 Identities = 76/229 (33%), Positives = 126/229 (55%), Gaps = 25/229 (10%)

Query: 378 KNLFEGVAKKFDLKNGLNLVEVYDNSHISGTNSVGAMITFGNEGFVKKR-YRKFDIKTKG 436
           K   E + K  ++K+    +E  D SH+ G  +V +++ F  +GF KK  YR++ I+   
Sbjct: 4   KEALEELMKLLNMKDFPYRIEGIDISHLQGKYTVASLVVF-EDGFPKKGDYRRYKIEQ-- 60

Query: 437 NEQDDFAMLKEVLTRRFKRAMLEKGNYLTLPDLILIDGGKGQYSSAKEVLDEFGLHDLPM 496
           +  DD+  ++ V+ RR+ +          LP+L+ +DGG GQ ++A E L E G  D P+
Sbjct: 61  DHPDDYESIRTVVKRRYSKH--------PLPNLLFVDGGIGQVNAAIEALKEIG-KDCPV 111

Query: 497 IAIAKGKLRNSGDETFFYKGKSFKFDKNDPTLFFMQRLRDEAHRFAITSHRAKRAKGITK 556
           + +AK       +ET  ++ +      + P L  + ++RDE HRFA++ HR        +
Sbjct: 112 VGLAKK------EETVVFENREIHLPHDHPVLRLLVQIRDETHRFAVSYHRES-----LR 160

Query: 557 SLLDQIDGIGSIRKRALLNHFGSARAVESASFDEIKSVEGVEEKVAKKI 605
           S+LD + GIG IRK+ L+ HFGS   + SAS +EI  V G  E +A+++
Sbjct: 161 SVLDNVPGIGPIRKKKLIEHFGSLENIRSASLEEIARVIGSTE-IARRV 208


>2nrxB [x.x.x] UVRABC SYSTEM PROTEIN C
          Length = 208

 Score =  119 bits (298), Expect = 2e-29
 Identities = 76/229 (33%), Positives = 126/229 (55%), Gaps = 28/229 (12%)

Query: 378 KNLFEGVAKKFDLKNGLNLVEVYDNSHISGTNSVGAMITFGNEGFVKKR-YRKFDIKTKG 436
           K   E + K  ++K+    +E  D SH+ G  +V +++ F  +GF KK  YR++ I+   
Sbjct: 3   KEALEELMKLLNMKDFPYRIEGIDISHLQGKYTVASLVVF-EDGFPKKGDYRRYKIEQ-- 59

Query: 437 NEQDDFAMLKEVLTRRFKRAMLEKGNYLTLPDLILIDGGKGQYSSAKEVLDEFGLHDLPM 496
           +  DD+  ++ V+ RR+ +          LP+L+ +DGG GQ ++A E L E G  D P+
Sbjct: 60  DHPDDYESIRTVVKRRYSKH--------PLPNLLFVDGGIGQVNAAIEALKEIG-KDCPV 110

Query: 497 IAIAKGKLRNSGDETFFYKGKSFKFDKNDPTLFFMQRLRDEAHRFAITSHRAKRAKGITK 556
           + +A        +ET  ++ +      + P L  + ++RDE HRFA++ HR+ R      
Sbjct: 111 VGLA--------EETVVFENREIHLPHDHPVLRLLVQIRDETHRFAVSYHRSLR------ 156

Query: 557 SLLDQIDGIGSIRKRALLNHFGSARAVESASFDEIKSVEGVEEKVAKKI 605
           S+LD + GIG IRK+ L+ HFGS   + SAS +EI  V G  E +A+++
Sbjct: 157 SVLDNVPGIGPIRKKKLIEHFGSLENIRSASLEEIARVIGSTE-IARRV 204


>2nrwA [x.x.x] UVRABC SYSTEM PROTEIN C
          Length = 204

 Score =  114 bits (286), Expect = 6e-28
 Identities = 77/229 (33%), Positives = 124/229 (54%), Gaps = 33/229 (14%)

Query: 378 KNLFEGVAKKFDLKNGLNLVEVYDNSHISGTNSVGAMITFGNEGFVKKR-YRKFDIKTKG 436
           K   E + K  ++K+    +E  D SH     +V +++ F  +GF KK  YR++ I    
Sbjct: 4   KEALEELMKLLNMKDFPYRIEGIDISH-----TVASLVVF-EDGFPKKGDYRRYKI---- 53

Query: 437 NEQDDFAMLKEVLTRRFKRAMLEKGNYLTLPDLILIDGGKGQYSSAKEVLDEFGLHDLPM 496
            EQDD+  ++ V+ RR+ +          LP+L+ +DGG GQ ++A E L E G  D P+
Sbjct: 54  -EQDDYESIRTVVKRRYSKH--------PLPNLLFVDGGIGQVNAAIEALKEIG-KDCPV 103

Query: 497 IAIAKGKLRNSGDETFFYKGKSFKFDKNDPTLFFMQRLRDEAHRFAITSHRAKRAKGITK 556
           + +AK       +ET  ++ +      + P L  + ++RDE HRFA++ HR        +
Sbjct: 104 VGLAKK------EETVVFENREIHLPHDHPVLRLLVQIRDETHRFAVSYHRES-----LR 152

Query: 557 SLLDQIDGIGSIRKRALLNHFGSARAVESASFDEIKSVEGVEEKVAKKI 605
           S+LD + GIG IRK+ L+ HFGS   + SAS +EI  V G  E +A+++
Sbjct: 153 SVLDNVPGIGPIRKKKLIEHFGSLENIRSASLEEIARVIGSTE-IARRV 200


>3c65A [x.x.x] UVRABC SYSTEM PROTEIN C
          Length = 149

 Score = 75.9 bits (185), Expect = 3e-16
 Identities = 49/148 (33%), Positives = 77/148 (52%), Gaps = 15/148 (10%)

Query: 397 VEVYDNSHISGTNSVGAMITFGNEGFVKKRYRKFDIKTKGNEQDDFAMLKEVLTRRFKRA 456
           +E +DNS+I G + V A++ F +    KK YRK+ +KT     D                
Sbjct: 16  IEAFDNSNIYGADPVSALVVFLDGKPAKKEYRKYKVKTVAGPND---XXXXXXXXXXXXX 72

Query: 457 MLEKGNYLTLPDLILIDGGKGQYSSAKEVLD-EFGLHDLPMIAIAKGKLRNSGDETFFYK 515
            L++G  L LPDLI+IDGGKG  S+ ++VL+ E GL D+P+  +++    +  D      
Sbjct: 73  XLKEG--LPLPDLIIIDGGKGHLSAVRDVLENELGL-DVPLAGLSELLAGDPPDVV---- 125

Query: 516 GKSFKFDKNDPTLFFMQRLRDEAHRFAI 543
                 D+     + +QR++DE HRFA+
Sbjct: 126 ----PLDRQSQEFYLLQRIQDEVHRFAV 149


>1yd6D [x.x.x] UVRC
          Length = 96

 Score = 66.6 bits (161), Expect = 2e-13
 Identities = 33/94 (35%), Positives = 52/94 (55%), Gaps = 1/94 (1%)

Query: 11  IRKELPLIPKSPGVYRMLDHKDVILYVGKAKNLPNRLKSYVAEKNHIIRTARMLSQTFKL 70
           ++++L ++P+ PG Y M D    ++YVGKAK+L  R++SY     H  +T R++ +    
Sbjct: 4   LKEKLAVLPEQPGCYLMKDKHGTVIYVGKAKSLKERVRSYFT-GTHDGKTQRLVEEIADF 62

Query: 71  EIXXXXXXXXXXXXXXXXIKKHKPKFNILLKDDK 104
           E                 IKKH PK+N++LKDDK
Sbjct: 63  EYIVTSSNAEALILEMNLIKKHDPKYNVMLKDDK 96


>2nrrA [x.x.x] UVRABC SYSTEM PROTEIN C
          Length = 139

 Score = 63.9 bits (154), Expect = 1e-12
 Identities = 47/164 (28%), Positives = 83/164 (50%), Gaps = 31/164 (18%)

Query: 382 EGVAKKFDLKNGLNLVEVYDNSHISGTNSVGAMITFGNEGFVKKR-YRKFDIKTKGNEQD 440
           E + K  ++K+    +E  D SH+    +V +++ F  +GF KK  YR++ I       D
Sbjct: 5   EELMKLLNMKDFPYRIEGIDISHLY---TVASLVVF-EDGFPKKGDYRRYKI-------D 53

Query: 441 DFAMLKEVLTRRFKRAMLEKGNYLTLPDLILIDGGKGQYSSAKEVLDEFGLHDLPMIAIA 500
           D+  ++ V+ RR+ +          LP+L+ +DGG GQ ++A E L E G  D P++ +A
Sbjct: 54  DYESIRTVVKRRYSKH--------PLPNLLFVDGGIGQVNAAIEALKEIG-KDCPVVGLA 104

Query: 501 KGKLRNSGDETFFYKGKSFKFDKNDPTLFFMQRLRDEAHRFAIT 544
                     T  ++ +      + P L  + ++RDE HRFA++
Sbjct: 105 ----------TVVFENREIHLPHDHPVLRLLVQIRDETHRFAVS 138


>1yd6A [x.x.x] UVRC
          Length = 95

 Score = 62.4 bits (150), Expect = 3e-12
 Identities = 31/92 (33%), Positives = 50/92 (54%), Gaps = 1/92 (1%)

Query: 11  IRKELPLIPKSPGVYRMLDHKDVILYVGKAKNLPNRLKSYVAEKNHIIRTARMLSQTFKL 70
           ++++L ++P+ PG Y M D    ++YVGKAK+L  R++SY     H  +T R++ +    
Sbjct: 5   LKEKLAVLPEQPGCYLMKDKHGTVIYVGKAKSLKERVRSYFT-GTHDGKTQRLVEEIADF 63

Query: 71  EIXXXXXXXXXXXXXXXXIKKHKPKFNILLKD 102
           E                 IKKH PK+N++LKD
Sbjct: 64  EYIVTSSNAEALILEMNLIKKHDPKYNVMLKD 95


>1yd6B [x.x.x] UVRC
          Length = 88

 Score = 60.5 bits (145), Expect = 1e-11
 Identities = 31/89 (34%), Positives = 47/89 (52%), Gaps = 1/89 (1%)

Query: 14  ELPLIPKSPGVYRMLDHKDVILYVGKAKNLPNRLKSYVAEKNHIIRTARMLSQTFKLEIX 73
           +L ++P+ PG Y M D    ++YVGKAK+L  R++SY     H  +T R++ +    E  
Sbjct: 1   KLAVLPEQPGCYLMKDKHGTVIYVGKAKSLKERVRSYFT-GTHDGKTQRLVEEIADFEYI 59

Query: 74  XXXXXXXXXXXXXXXIKKHKPKFNILLKD 102
                          IKKH PK+N++LKD
Sbjct: 60  VTSSNAEALILEMNLIKKHDPKYNVMLKD 88


>1yd6C [x.x.x] UVRC
          Length = 94

 Score = 60.1 bits (144), Expect = 2e-11
 Identities = 30/91 (32%), Positives = 49/91 (53%), Gaps = 1/91 (1%)

Query: 11  IRKELPLIPKSPGVYRMLDHKDVILYVGKAKNLPNRLKSYVAEKNHIIRTARMLSQTFKL 70
           ++++L ++P+ PG Y M D    ++YVGKAK+L  R++SY     H  +T R++ +    
Sbjct: 5   LKEKLAVLPEQPGCYLMKDKHGTVIYVGKAKSLKERVRSYFT-GTHDGKTQRLVEEIADF 63

Query: 71  EIXXXXXXXXXXXXXXXXIKKHKPKFNILLK 101
           E                 IKKH PK+N++LK
Sbjct: 64  EYIVTSSNAEALILEMNLIKKHDPKYNVMLK 94


>1yczA [x.x.x] UVRABC SYSTEM PROTEIN C
          Length = 89

 Score = 55.8 bits (133), Expect = 3e-10
 Identities = 32/91 (35%), Positives = 51/91 (56%), Gaps = 3/91 (3%)

Query: 8  KDVIRKELPLIPKSPGVYRMLDHKDVILYVGKAKNLPNRLKSYVAEKNHIIRTARMLSQT 67
          K+ IRK++ L P+ PGVY +  +K V +Y+GKAK L NRL+SY+  +    +  R+  + 
Sbjct: 2  KEKIRKKILLAPEEPGVY-IFKNKGVPIYIGKAKRLSNRLRSYLNPQTE--KVFRIGEEA 58

Query: 68 FKLEIXXXXXXXXXXXXXXXXIKKHKPKFNI 98
           +LE                 IKK++PK+N+
Sbjct: 59 DELETIVVMNEREAFILEANLIKKYRPKYNV 89


>1yd4A [x.x.x] UVRABC SYSTEM PROTEIN C
          Length = 89

 Score = 54.3 bits (129), Expect = 9e-10
 Identities = 31/91 (34%), Positives = 51/91 (56%), Gaps = 3/91 (3%)

Query: 8  KDVIRKELPLIPKSPGVYRMLDHKDVILYVGKAKNLPNRLKSYVAEKNHIIRTARMLSQT 67
          K+ IRK++ L P+ PGVY +  +K V +++GKAK L NRL+SY+  +    +  R+  + 
Sbjct: 2  KEKIRKKILLAPEEPGVY-IFKNKGVPIFIGKAKRLSNRLRSYLNPQTE--KVFRIGEEA 58

Query: 68 FKLEIXXXXXXXXXXXXXXXXIKKHKPKFNI 98
           +LE                 IKK++PK+N+
Sbjct: 59 DELETIVVMNEREAFILEANLIKKYRPKYNV 89


>1yd3A [x.x.x] UVRABC SYSTEM PROTEIN C
          Length = 90

 Score = 54.3 bits (129), Expect = 9e-10
 Identities = 31/91 (34%), Positives = 51/91 (56%), Gaps = 3/91 (3%)

Query: 8  KDVIRKELPLIPKSPGVYRMLDHKDVILYVGKAKNLPNRLKSYVAEKNHIIRTARMLSQT 67
          K+ IRK++ L P+ PGVY +  +K V +Y+GKAK L NRL+S++  +    +  R+  + 
Sbjct: 2  KEKIRKKILLAPEEPGVY-IFKNKGVPIYIGKAKRLSNRLRSFLNPQTE--KVFRIGEEA 58

Query: 68 FKLEIXXXXXXXXXXXXXXXXIKKHKPKFNI 98
           +LE                 IKK++PK+N+
Sbjct: 59 DELETIVVMNEREAFILEANLIKKYRPKYNV 89


>1yd2A [x.x.x] UVRABC SYSTEM PROTEIN C
          Length = 90

 Score = 54.3 bits (129), Expect = 9e-10
 Identities = 31/91 (34%), Positives = 51/91 (56%), Gaps = 3/91 (3%)

Query: 8  KDVIRKELPLIPKSPGVYRMLDHKDVILYVGKAKNLPNRLKSYVAEKNHIIRTARMLSQT 67
          K+ IRK++ L P+ PGV+ +  +K V +Y+GKAK L NRL+SY+  +    +  R+  + 
Sbjct: 2  KEKIRKKILLAPEEPGVF-IFKNKGVPIYIGKAKRLSNRLRSYLNPQTE--KVFRIGEEA 58

Query: 68 FKLEIXXXXXXXXXXXXXXXXIKKHKPKFNI 98
           +LE                 IKK++PK+N+
Sbjct: 59 DELETIVVMNEREAFILEANLIKKYRPKYNV 89


>1yd5A [x.x.x] UVRABC SYSTEM PROTEIN C
          Length = 90

 Score = 52.8 bits (125), Expect = 3e-09
 Identities = 31/91 (34%), Positives = 50/91 (54%), Gaps = 3/91 (3%)

Query: 8  KDVIRKELPLIPKSPGVYRMLDHKDVILYVGKAKNLPNRLKSYVAEKNHIIRTARMLSQT 67
          K+ IRK++ L P+ PGVY +  +K V +Y+GKAK L NRL+SY+  +    +  R+  + 
Sbjct: 2  KEKIRKKILLAPEEPGVY-IFKNKGVPIYIGKAKRLSNRLRSYLNPQTE--KVFRIGEEA 58

Query: 68 FKLEIXXXXXXXXXXXXXXXXIKKHKPKFNI 98
           +LE                 IKK++PK+ +
Sbjct: 59 DELETIVVMNEREAFILEANLIKKYRPKYAV 89


>1kftA [a.60.2] EXCINUCLEASE ABC SUBUNIT C
          Length = 56

 Score = 41.6 bits (96), Expect = 6e-06
 Identities = 18/50 (36%), Positives = 33/50 (66%)

Query: 557 SLLDQIDGIGSIRKRALLNHFGSARAVESASFDEIKSVEGVEEKVAKKIY 606
           S L+ I+G+G  R++ LL + G  + + +AS +EI  V G+ + +A+KI+
Sbjct: 2   SSLETIEGVGPKRRQMLLKYMGGLQGLRNASVEEIAKVPGISQGLAEKIF 51


>1x2iA [x.x.x] HEF HELICASE/NUCLEASE
          Length = 68

 Score = 40.4 bits (93), Expect = 1e-05
 Identities = 19/48 (39%), Positives = 30/48 (62%)

Query: 558 LLDQIDGIGSIRKRALLNHFGSARAVESASFDEIKSVEGVEEKVAKKI 605
           +++ +  + +   R LL HFGS   V +AS  E+  VEG+ EK+AK+I
Sbjct: 11  IVEGLPHVSATLARRLLKHFGSVERVFTASVAELMKVEGIGEKIAKEI 58


  Database: 95pdb09Oct16x
    Posted date:  Nov 2, 2009  3:15 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.300    0.123    0.301 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 832,035,224
Number of extensions: 34251117
Number of successful extensions: 89486
Number of sequences better than 1.0e-03: 2112
Number of HSP's gapped: 88184
Number of HSP's successfully gapped: 2239
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (19.9 bits)