BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= AAZ21179.1 pubi0 leuS GIB00256CH01 "Leucyl-tRNA synthetase"
         (844 letters)

Database: 95pdb09Oct16x 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

2bteA [x.x.x] LEUCYL-TRNA SYNTHETASE                                  544   e-157
1h3nA [c.26.1 - b.51.1 - a.27.1] LEUCYL-TRNA SYNTHETASE               515   e-148
2v0cA [x.x.x] AMINOACYL-TRNA SYNTHETASE                               513   e-148
1obcA [c.26.1 - b.51.1 - a.27.1] LEUCYL-TRNA SYNTHETASE               513   e-148
1obhA [c.26.1 - b.51.1 - a.27.1] LEUCYL-TRNA SYNTHETASE               460   e-132
1wz2A [x.x.x] LEUCYL-TRNA SYNTHETASE                                  129   3e-32
1wkbA [x.x.x] LEUCYL-TRNA SYNTHETASE                                  129   3e-32
2ajgA [x.x.x] LEUCYL-TRNA SYNTHETASE                                  124   1e-30
1gaxA [c.26.1 - b.51.1 - a.27.1 - a.2.7] VALYL-TRNA SYNTHETASE        120   2e-29
2ajhB [x.x.x] LEUCYL-TRNA SYNTHETASE                                  111   9e-27
2ajgB [x.x.x] LEUCYL-TRNA SYNTHETASE                                  110   1e-26
1qu3A [c.26.1 - b.51.1 - a.27.1] ISOLEUCYL-TRNA SYNTHETASE             83   3e-18
1ffyA [c.26.1 - b.51.1 - a.27.1] ISOLEUCYL-TRNA SYNTHETASE             83   3e-18
1ileA [c.26.1 - b.51.1 - a.27.1 (1jzqA)] ISOLEUCYL-TRNA SYNTHETASE     68   1e-13
2d5bA [x.x.x] METHIONYL-TRNA SYNTHETASE                                61   1e-11
2d54A [x.x.x] METHIONYL-TRNA SYNTHETASE                                61   1e-11
1a8hA [x.x.x] METHIONYL-TRNA SYNTHETASE                                61   1e-11
2ct8A [x.x.x] METHIONYL-TRNA SYNTHETASE                                57   2e-10
2csxA [x.x.x] METHIONYL-TRNA SYNTHETASE                                57   2e-10
1rqgA [c.26.1 - g.41.1 - a.27.1] METHIONYL-TRNA SYNTHETASE             53   3e-09
1qqtA [c.26.1 - g.41.1 - a.27.1] METHIONYL-TRNA SYNTHETASE             52   6e-09
1pfwA [c.26.1 - g.41.1 - a.27.1] METHIONYL-TRNA SYNTHETASE             52   6e-09
1pfuA [c.26.1 - g.41.1 - a.27.1] METHIONYL-TRNA SYNTHETASE             52   6e-09
1f4lA [c.26.1 - g.41.1 - a.27.1] METHIONYL-TRNA SYNTHETASE             52   6e-09
1pg0A [c.26.1 - a.27.1] METHIONYL-TRNA SYNTHETASE                      50   2e-08
1pg2A [c.26.1 - a.27.1] METHIONYL-TRNA SYNTHETASE                      49   4e-08
1irxB [c.26.1 - a.97.1] LYSYL-TRNA SYNTHETASE                          37   3e-04
1irxA [c.26.1 - a.97.1] LYSYL-TRNA SYNTHETASE                          37   3e-04
2zueA [x.x.x] ARGINYL-TRNA SYNTHETASE                                  36   4e-04

>2bteA [x.x.x] LEUCYL-TRNA SYNTHETASE
          Length = 876

 Score =  544 bits (1402), Expect = e-157
 Identities = 318/883 (36%), Positives = 478/883 (54%), Gaps = 46/883 (5%)

Query: 1   MDRYNFKTVEEKWQKFWHKNKVFSSK-LDKTKKKFYCLEMFPYPSGKIHMGHVRNYTIGD 59
           M++YN   +E KWQ+FW +     +K L   + K Y L MFPYPSG +HMGH++NYT+GD
Sbjct: 1   MEKYNPHAIEAKWQRFWEEKGFMKAKDLPGGRGKQYVLVMFPYPSGDLHMGHLKNYTMGD 60

Query: 60  VLARYKTLQGYNVLHPMGWDSFGMPAENAARQNNLDPKTWTESNIKTMRSQLKKLGLSID 119
           VLAR++ +QGY VLHPMGWD+FG+PAENAA +  + PK WT +NI+  +  L+ +G+  D
Sbjct: 61  VLARFRRMQGYEVLHPMGWDAFGLPAENAALKFGVHPKDWTYANIRQAKESLRLMGILYD 120

Query: 120 WDKEISTCSEDYYKHQQEFFLDLYDKGLVYRKENYVNWDPVDETVLANEQVVDGKGWRSG 179
           WD+E++TC  +YY+  Q  FL +++KGL YR +  VNW P  +TVLANEQVV+G+ WR  
Sbjct: 121 WDREVTTCEPEYYRWNQWIFLKMWEKGLAYRAKGLVNWCPKCQTVLANEQVVEGRCWRHE 180

Query: 180 AT-VERKKLNQWFFNISKFSEDLLQGLDALENWPNKVKVMQKNWIGKSFGCEVEFKIESE 238
            T VE+++L QW+  I+ ++E LL+ L+ L NWP KVK MQ+ WIG+S G E+ F +E +
Sbjct: 181 DTPVEKRELEQWYLRITAYAERLLKDLEGL-NWPEKVKAMQRAWIGRSEGAEILFPVEGK 239

Query: 239 KPIESIKCYTTRPDTLFGFSFLALSVDHPLAKYY---EEDKEFQKFREECSKTGTTEESI 295
           +    I  +TTRPDTLFG +FL L+ +HPL       E+ +E   + E   +    E   
Sbjct: 240 E--VRIPVFTTRPDTLFGATFLVLAPEHPLTLELAAPEKREEVLAYVEAAKRKTEIERQA 297

Query: 296 ASAEKLGFKTDMIAVNPLDKNMKVPVYFANFVLMDYGLGAVFGCPAHDQRDLDFAKKYNL 355
              EK G      A+NP     ++P++ A++VL  YG GA+   PAHDQRD +FA+K+ L
Sbjct: 298 EGREKTGVFLGAYALNPA-TGERIPIWTADYVLFGYGTGAIMAVPAHDQRDYEFARKFGL 356

Query: 356 KITPVVKPEKDKDFKINNEAYTGEGYLCNSDFLDGLKVPSQSIIKTIEFLEKNNLGTKKT 415
            I  V+             AY   G + NS   DG +   +   K I +LE+  LG  + 
Sbjct: 357 PIKKVIXXXXXXXXXXXXXAYEEPGIMVNSGPFDGTE-SEEGKRKVIAWLEEKGLGKGRV 415

Query: 416 NYRLKDWGISRQRYWGCPIPIAYDE---NDQPIKIPRDMLPVKLPEIEKLSNTG-NPLDS 471
            YRL+DW ISRQRYWG PIP+ + E                        +   G +PL++
Sbjct: 416 TYRLRDWLISRQRYWGTPIPMVHCEACGXXXXXXXXXXXXXXXXXXXXXIRPKGKSPLEA 475

Query: 472 EDNWKFFILD--GKKYRRETDTLDTFVDSSWYFLRFCSPHNLDRGFTQEEANYWMPVDQY 529
              +        G   +R          SSWY+LR+  PHN    F  E+AN WMPVDQY
Sbjct: 476 HPEFYETTCPKCGGPAKRXXXXXXXXXXSSWYYLRYTDPHNDRLPFDPEKANAWMPVDQY 535

Query: 530 IGGVEHAILHLLYSRFFMQALSYKNDDFKLKEPFDGLFTQGMVCHET------------- 576
           IGGVEHA+LHLLYSRFF + L +     K++EPF GLFTQGMV   T             
Sbjct: 536 IGGVEHAVLHLLYSRFFTKFL-HDLGMVKVEEPFQGLFTQGMVLAWTDFGPVEVEGSVVR 594

Query: 577 -YKDQNNKWLSPDEVTS-EDGKKFYKKDNPSE--KIIVGPTESMSKSKKNTIDPENIIKN 632
             +    +   P+   S ED +K   +  P E   + +     MSKSK N +     +K 
Sbjct: 595 LPEPTRIRLEIPESALSLEDVRKMGAELRPHEDGTLHLWKPAVMSKSKGNGVMVGPFVKE 654

Query: 633 YGADSVRLFILSDSPPEKDVQWSDQGMLASFKFVQKLWTLNSKILDKIKNND-----QGS 687
            GAD  R+ IL  +PPE ++ W+++G+  +++F+ +++   ++  + +         +  
Sbjct: 655 QGADIARITILFAAPPENEMVWTEEGVQGAWRFLNRIYRRVAEDREALLETSGVFQAEAL 714

Query: 688 EGNDLAKF--TNQLINKITQNLEKFHYNVIVANFYEMYNFLXXXXXXXXXXXXXXXNYKK 745
           EG D   +   ++ + K+T++LE   +N  +A   E  N L                 + 
Sbjct: 715 EGKDRELYGKLHETLKKVTEDLEALRFNTAIAALMEFLNALYEYRKDRPVTPVYRTAIRY 774

Query: 746 ILIVMNPFIPHFSNECLSTINENQI---SWPEISKEDLIEEDINFVVQINGKKRAILKIK 802
            L ++ PF PH + E       + +    WPE+ ++ L ++ +   VQ+NG+ R  + I 
Sbjct: 775 YLQMLFPFAPHLAEELWHWFWPDSLFEAGWPELDEKALEKDVVEVAVQVNGRVRGTIHIP 834

Query: 803 RDV-VEKEILEIIKTNLEIEKFLKDKTIKKSIFVPNRLINIIL 844
           +D  +E    E +K    +   L+ K + K I+VP +++N+++
Sbjct: 835 KDAPLEVARAEALKVR-NVRAHLEGKEVVKEIYVPGKILNLVV 876


>1h3nA [c.26.1 - b.51.1 - a.27.1] LEUCYL-TRNA SYNTHETASE
          Length = 814

 Score =  515 bits (1326), Expect = e-148
 Identities = 301/818 (36%), Positives = 442/818 (54%), Gaps = 44/818 (5%)

Query: 1   MDRYNFKTVEEKWQKFWHKNKVFSSK-LDKTKKKFYCLEMFPYPSGKIHMGHVRNYTIGD 59
           M++YN   +E KWQ+FW +     +K L   + K Y L MFPYPSG +HMGH++NYT+GD
Sbjct: 1   MEKYNPHAIEAKWQRFWEEKGFMKAKDLPGGRGKQYVLVMFPYPSGDLHMGHLKNYTMGD 60

Query: 60  VLARYKTLQGYNVLHPMGWDSFGMPAENAARQNNLDPKTWTESNIKTMRSQLKKLGLSID 119
           VLAR++ +QGY VLHPMGWD+FG+PAENAA +  + PK WT +NI+  +  L+ +G+  D
Sbjct: 61  VLARFRRMQGYEVLHPMGWDAFGLPAENAALKFGVHPKDWTYANIRQAKESLRLMGILYD 120

Query: 120 WDKEISTCSEDYYKHQQEFFLDLYDKGLVYRKENYVNWDPVDETVLANEQVVDGKGWRSG 179
           WD+E++TC  +YY+  Q  FL +++KGL YR +  VNW P  +TVLANEQVV+G+ WR  
Sbjct: 121 WDREVTTCEPEYYRWNQWIFLKMWEKGLAYRAKGLVNWCPKCQTVLANEQVVEGRCWRHE 180

Query: 180 AT-VERKKLNQWFFNISKFSEDLLQGLDALENWPNKVKVMQKNWIGKSFGCEVEFKIESE 238
            T VE+++L QW+  I+ ++E LL+ L+ L NWP KVK MQ+ WIG+S G E+ F +E +
Sbjct: 181 DTPVEKRELEQWYLRITAYAERLLKDLEGL-NWPEKVKAMQRAWIGRSEGAEILFPVEGK 239

Query: 239 KPIESIKCYTTRPDTLFGFSFLALSVDHPLAKYY---EEDKEFQKFREECSKTGTTEESI 295
           +    I  +TTRPDTLFG +FL L+ +HPL       E+ +E   + E   +    E   
Sbjct: 240 E--VRIPVFTTRPDTLFGATFLVLAPEHPLTLELAAPEKREEVLAYVEAAKRKTEIERQA 297

Query: 296 ASAEKLGFKTDMIAVNPLDKNMKVPVYFANFVLMDYGLGAVFGCPAHDQRDLDFAKKYNL 355
              EK G      A+NP     ++P++ A++VL  YG GA+   PAHDQRD +FA+K+ L
Sbjct: 298 EGREKTGVFLGAYALNPA-TGERIPIWTADYVLFGYGTGAIMAVPAHDQRDYEFARKFGL 356

Query: 356 KITPVVKPEKDKDFKINNEAYTGEGYLCNSDFLDGLKVPSQSIIKTIEFLEKNNLGTKKT 415
            I  V+             AY   G + NS   DG +   +   K I +LE+  LG  + 
Sbjct: 357 PIKKVIXXXXXXXXXXXXXAYEEPGIMVNSGPFDGTE-SEEGKRKVIAWLEEKGLGKGRV 415

Query: 416 NYRLKDWGISRQRYWGCPIPIAYDE---NDQPIKIPRDMLPVKLPEIEKLSNTG-NPLDS 471
            YRL+DW ISRQRYWG PIP+ + E                        +   G +PL++
Sbjct: 416 TYRLRDWLISRQRYWGTPIPMVHCEACGXXXXXXXXXXXXXXXXXXXXXIRPKGKSPLEA 475

Query: 472 EDNWKFFILD--GKKYRRETDTLDTFVDSSWYFLRFCSPHNLDRGFTQEEANYWMPVDQY 529
              +        G   +R          SSWY+LR+  PHN    F  E+AN WMPVDQY
Sbjct: 476 HPEFYETTCPKCGGPAKRXXXXXXXXXXSSWYYLRYTDPHNDRLPFDPEKANAWMPVDQY 535

Query: 530 IGGVEHAILHLLYSRFFMQALSYKNDDFKLKEPFDGLFTQGMVCHET------------- 576
           IGGVEHA+LHLLYSRFF + L +     K++EPF GLFTQGMV   T             
Sbjct: 536 IGGVEHAVLHLLYSRFFTKFL-HDLGMVKVEEPFQGLFTQGMVLAWTDFGPVEVEGSVVR 594

Query: 577 -YKDQNNKWLSPDEVTS-EDGKKFYKKDNPSE--KIIVGPTESMSKSKKNTIDPENIIKN 632
             +    +   P+   S ED +K   +  P E   + +     MSKSK N +     +K 
Sbjct: 595 LPEPTRIRLEIPESALSLEDVRKMGAELRPHEDGTLHLWKPAVMSKSKGNGVMVGPFVKE 654

Query: 633 YGADSVRLFILSDSPPEKDVQWSDQGMLASFKFVQKLWTLNSKILDKIKNND-----QGS 687
            GAD  R+ IL  +PPE ++ W+++G+  +++F+ +++   ++  + +         +  
Sbjct: 655 QGADIARITILFAAPPENEMVWTEEGVQGAWRFLNRIYRRVAEDREALLETSGVFQAEAL 714

Query: 688 EGNDLAKF--TNQLINKITQNLEKFHYNVIVANFYEMYNFLXXXXXXXXXXXXXXXNYKK 745
           EG D   +   ++ + K+T++LE   +N  +A   E  N L                 + 
Sbjct: 715 EGKDRELYGKLHETLKKVTEDLEALRFNTAIAALMEFLNALYEYRKDRPVTPVYRTAIRY 774

Query: 746 ILIVMNPFIPHFSNECLSTINENQI---SWPEISKEDL 780
            L ++ PF PH + E       + +    WPE+ ++ L
Sbjct: 775 YLQMLFPFAPHLAEELWHWFWPDSLFEAGWPELDEKAL 812


>2v0cA [x.x.x] AMINOACYL-TRNA SYNTHETASE
          Length = 810

 Score =  513 bits (1321), Expect = e-148
 Identities = 300/817 (36%), Positives = 440/817 (53%), Gaps = 45/817 (5%)

Query: 1   MDRYNFKTVEEKWQKFWHKNKVFSSKLDKTKKKFYCLEMFPYPSGKIHMGHVRNYTIGDV 60
           M++YN   +E KWQ+FW +     +K      K Y L MFPYPSG +HMGH++NYT+GDV
Sbjct: 1   MEKYNPHAIEAKWQRFWEEKGFMKAK--DLPGKQYVLVMFPYPSGDLHMGHLKNYTMGDV 58

Query: 61  LARYKTLQGYNVLHPMGWDSFGMPAENAARQNNLDPKTWTESNIKTMRSQLKKLGLSIDW 120
           LAR++ +QGY VLHPMGWD+FG+PAENAA +  + PK WT +NI+  +  L+ +G+  DW
Sbjct: 59  LARFRRMQGYEVLHPMGWDAFGLPAENAALKFGVHPKDWTYANIRQAKESLRLMGILYDW 118

Query: 121 DKEISTCSEDYYKHQQEFFLDLYDKGLVYRKENYVNWDPVDETVLANEQVVDGKGWRSGA 180
           D+E++TC  +YY+  Q  FL +++KGL YR +  VNW P  +TVLANEQVV+G+ WR   
Sbjct: 119 DREVTTCEPEYYRWNQWIFLKMWEKGLAYRAKGLVNWCPKCQTVLANEQVVEGRCWRHED 178

Query: 181 T-VERKKLNQWFFNISKFSEDLLQGLDALENWPNKVKVMQKNWIGKSFGCEVEFKIESEK 239
           T VE+++L QW+  I+ ++E LL+ L+ L NWP KVK MQ+ WIG+S G E+ F +E ++
Sbjct: 179 TPVEKRELEQWYLRITAYAERLLKDLEGL-NWPEKVKAMQRAWIGRSEGAEILFPVEGKE 237

Query: 240 PIESIKCYTTRPDTLFGFSFLALSVDHPLAKYY---EEDKEFQKFREECSKTGTTEESIA 296
               I  +TTRPDTLFG +FL L+ +HPL       E+ +E   + E   +    E    
Sbjct: 238 --VRIPVFTTRPDTLFGATFLVLAPEHPLTLELAAPEKREEVLAYVEAAKRKTEIERQAE 295

Query: 297 SAEKLGFKTDMIAVNPLDKNMKVPVYFANFVLMDYGLGAVFGCPAHDQRDLDFAKKYNLK 356
             EK G      A+NP     ++P++ A++VL  YG GA+   PAHDQRD +FA+K+ L 
Sbjct: 296 GREKTGVFLGAYALNPA-TGERIPIWTADYVLFGYGTGAIMAVPAHDQRDYEFARKFGLP 354

Query: 357 ITPVVKPEKDKDFKINNEAYTGEGYLCNSDFLDGLKVPSQSIIKTIEFLEKNNLGTKKTN 416
           I  V+             AY   G + NS   DG +   +   K I +LE+  LG  +  
Sbjct: 355 IKKVIXXXXXXXXXXXXXAYEEPGIMVNSGPFDGTE-SEEGKRKVIAWLEEKGLGKGRVT 413

Query: 417 YRLKDWGISRQRYWGCPIPIAYDE---NDQPIKIPRDMLPVKLPEIEKLSNTG-NPLDSE 472
           YRL+DW ISRQRYWG PIP+ + E                        +   G +PL++ 
Sbjct: 414 YRLRDWLISRQRYWGTPIPMVHCEACGXXXXXXXXXXXXXXXXXXXXXIRPKGKSPLEAH 473

Query: 473 DNWKFFILD--GKKYRRETDTLDTFVDSSWYFLRFCSPHNLDRGFTQEEANYWMPVDQYI 530
             +        G   +R          SSWY+LR+  PHN    F  E+AN WMPVDQYI
Sbjct: 474 PEFYETTCPKCGGPAKRXXXXXXXXXXSSWYYLRYTDPHNDRLPFDPEKANAWMPVDQYI 533

Query: 531 GGVEHAILHLLYSRFFMQALSYKNDDFKLKEPFDGLFTQGMVCHET-------------- 576
           GGVEHA+LHLLYSRFF + L +     K++EPF GLFTQGMV   T              
Sbjct: 534 GGVEHAVLHLLYSRFFTKFL-HDLGMVKVEEPFQGLFTQGMVLAWTDFGPVEVEGSVVRL 592

Query: 577 YKDQNNKWLSPDEVTS-EDGKKFYKKDNPSE--KIIVGPTESMSKSKKNTIDPENIIKNY 633
            +    +   P+   S ED +K   +  P E   + +     MSKSK N +     +K  
Sbjct: 593 PEPTRIRLEIPESALSLEDVRKMGAELRPHEDGTLHLWKPAVMSKSKGNGVMVGPFVKEQ 652

Query: 634 GADSVRLFILSDSPPEKDVQWSDQGMLASFKFVQKLWTLNSKILDKIKNND-----QGSE 688
           GAD  R+ IL  +PPE ++ W+++G+  +++F+ +++   ++  + +         +  E
Sbjct: 653 GADIARITILFAAPPENEMVWTEEGVQGAWRFLNRIYRRVAEDREALLETSGVFQAEALE 712

Query: 689 GNDLAKF--TNQLINKITQNLEKFHYNVIVANFYEMYNFLXXXXXXXXXXXXXXXNYKKI 746
           G D   +   ++ + K+T++LE   +N  +A   E  N L                 +  
Sbjct: 713 GKDRELYGKLHETLKKVTEDLEALRFNTAIAALMEFLNALYEYRKDRPVTPVYRTAIRYY 772

Query: 747 LIVMNPFIPHFSNECLSTINENQI---SWPEISKEDL 780
           L ++ PF PH + E       + +    WPE+ ++ L
Sbjct: 773 LQMLFPFAPHLAEELWHWFWPDSLFEAGWPELDEKAL 809


>1obcA [c.26.1 - b.51.1 - a.27.1] LEUCYL-TRNA SYNTHETASE
          Length = 811

 Score =  513 bits (1321), Expect = e-148
 Identities = 300/817 (36%), Positives = 440/817 (53%), Gaps = 45/817 (5%)

Query: 1   MDRYNFKTVEEKWQKFWHKNKVFSSKLDKTKKKFYCLEMFPYPSGKIHMGHVRNYTIGDV 60
           M++YN   +E KWQ+FW +     +K      K Y L MFPYPSG +HMGH++NYT+GDV
Sbjct: 1   MEKYNPHAIEAKWQRFWEEKGFMKAK--DLPGKQYVLVMFPYPSGDLHMGHLKNYTMGDV 58

Query: 61  LARYKTLQGYNVLHPMGWDSFGMPAENAARQNNLDPKTWTESNIKTMRSQLKKLGLSIDW 120
           LAR++ +QGY VLHPMGWD+FG+PAENAA +  + PK WT +NI+  +  L+ +G+  DW
Sbjct: 59  LARFRRMQGYEVLHPMGWDAFGLPAENAALKFGVHPKDWTYANIRQAKESLRLMGILYDW 118

Query: 121 DKEISTCSEDYYKHQQEFFLDLYDKGLVYRKENYVNWDPVDETVLANEQVVDGKGWRSGA 180
           D+E++TC  +YY+  Q  FL +++KGL YR +  VNW P  +TVLANEQVV+G+ WR   
Sbjct: 119 DREVTTCEPEYYRWNQWIFLKMWEKGLAYRAKGLVNWCPKCQTVLANEQVVEGRCWRHED 178

Query: 181 T-VERKKLNQWFFNISKFSEDLLQGLDALENWPNKVKVMQKNWIGKSFGCEVEFKIESEK 239
           T VE+++L QW+  I+ ++E LL+ L+ L NWP KVK MQ+ WIG+S G E+ F +E ++
Sbjct: 179 TPVEKRELEQWYLRITAYAERLLKDLEGL-NWPEKVKAMQRAWIGRSEGAEILFPVEGKE 237

Query: 240 PIESIKCYTTRPDTLFGFSFLALSVDHPLAKYY---EEDKEFQKFREECSKTGTTEESIA 296
               I  +TTRPDTLFG +FL L+ +HPL       E+ +E   + E   +    E    
Sbjct: 238 --VRIPVFTTRPDTLFGATFLVLAPEHPLTLELAAPEKREEVLAYVEAAKRKTEIERQAE 295

Query: 297 SAEKLGFKTDMIAVNPLDKNMKVPVYFANFVLMDYGLGAVFGCPAHDQRDLDFAKKYNLK 356
             EK G      A+NP     ++P++ A++VL  YG GA+   PAHDQRD +FA+K+ L 
Sbjct: 296 GREKTGVFLGAYALNPA-TGERIPIWTADYVLFGYGTGAIMAVPAHDQRDYEFARKFGLP 354

Query: 357 ITPVVKPEKDKDFKINNEAYTGEGYLCNSDFLDGLKVPSQSIIKTIEFLEKNNLGTKKTN 416
           I  V+             AY   G + NS   DG +   +   K I +LE+  LG  +  
Sbjct: 355 IKKVIXXXXXXXXXXXXXAYEEPGIMVNSGPFDGTE-SEEGKRKVIAWLEEKGLGKGRVT 413

Query: 417 YRLKDWGISRQRYWGCPIPIAYDE---NDQPIKIPRDMLPVKLPEIEKLSNTG-NPLDSE 472
           YRL+DW ISRQRYWG PIP+ + E                        +   G +PL++ 
Sbjct: 414 YRLRDWLISRQRYWGTPIPMVHCEACGXXXXXXXXXXXXXXXXXXXXXIRPKGKSPLEAH 473

Query: 473 DNWKFFILD--GKKYRRETDTLDTFVDSSWYFLRFCSPHNLDRGFTQEEANYWMPVDQYI 530
             +        G   +R          SSWY+LR+  PHN    F  E+AN WMPVDQYI
Sbjct: 474 PEFYETTCPKCGGPAKRXXXXXXXXXXSSWYYLRYTDPHNDRLPFDPEKANAWMPVDQYI 533

Query: 531 GGVEHAILHLLYSRFFMQALSYKNDDFKLKEPFDGLFTQGMVCHET-------------- 576
           GGVEHA+LHLLYSRFF + L +     K++EPF GLFTQGMV   T              
Sbjct: 534 GGVEHAVLHLLYSRFFTKFL-HDLGMVKVEEPFQGLFTQGMVLAWTDFGPVEVEGSVVRL 592

Query: 577 YKDQNNKWLSPDEVTS-EDGKKFYKKDNPSE--KIIVGPTESMSKSKKNTIDPENIIKNY 633
            +    +   P+   S ED +K   +  P E   + +     MSKSK N +     +K  
Sbjct: 593 PEPTRIRLEIPESALSLEDVRKMGAELRPHEDGTLHLWKPAVMSKSKGNGVMVGPFVKEQ 652

Query: 634 GADSVRLFILSDSPPEKDVQWSDQGMLASFKFVQKLWTLNSKILDKIKNND-----QGSE 688
           GAD  R+ IL  +PPE ++ W+++G+  +++F+ +++   ++  + +         +  E
Sbjct: 653 GADIARITILFAAPPENEMVWTEEGVQGAWRFLNRIYRRVAEDREALLETSGVFQAEALE 712

Query: 689 GNDLAKF--TNQLINKITQNLEKFHYNVIVANFYEMYNFLXXXXXXXXXXXXXXXNYKKI 746
           G D   +   ++ + K+T++LE   +N  +A   E  N L                 +  
Sbjct: 713 GKDRELYGKLHETLKKVTEDLEALRFNTAIAALMEFLNALYEYRKDRPVTPVYRTAIRYY 772

Query: 747 LIVMNPFIPHFSNECLSTINENQI---SWPEISKEDL 780
           L ++ PF PH + E       + +    WPE+ ++ L
Sbjct: 773 LQMLFPFAPHLAEELWHWFWPDSLFEAGWPELDEKAL 809


>1obhA [c.26.1 - b.51.1 - a.27.1] LEUCYL-TRNA SYNTHETASE
          Length = 762

 Score =  460 bits (1184), Expect = e-132
 Identities = 277/810 (34%), Positives = 411/810 (50%), Gaps = 80/810 (9%)

Query: 1   MDRYNFKTVEEKWQKFWHKNKVFSSKLDKTKKKFYCLEMFPYPSGKIHMGHVRNYTIGDV 60
           M++YN   +E KWQ+FW +     +K      K Y L MFPYPSG +HMGH++NYT+GDV
Sbjct: 1   MEKYNPHAIEAKWQRFWEEKGFMKAKDLPGGGKQYVLVMFPYPSGDLHMGHLKNYTMGDV 60

Query: 61  LARYKTLQGYNVLHPMGWDSFGMPAENAARQNNLDPKTWTESNIKTMRSQLKKLGLSIDW 120
           LAR++ +QGY VLHPMGWD+FG+PAENAA +  + PK WT +NI+  +  L+ +G+  DW
Sbjct: 61  LARFRRMQGYEVLHPMGWDAFGLPAENAALKFGVHPKDWTYANIRQAKESLRLMGILYDW 120

Query: 121 DKEISTCSEDYYKHQQEFFLDLYDKGLVYRKENYVNWDPVDETVLANEQVVDGKGWRSGA 180
           D+E++TC  +YY+  Q  FL +++KGL YR +                            
Sbjct: 121 DREVTTCEPEYYRWNQWIFLKMWEKGLAYRAKE--------------------------- 153

Query: 181 TVERKKLNQWFFNISKFSEDLLQGLDALENWPNKVKVMQKNWIGKSFGCEVEFKIESEKP 240
                   QW+  I+ ++E LL+ L+ L NWP KVK MQ+ WIG+S G E+ F +E ++ 
Sbjct: 154 --------QWYLRITAYAERLLKDLEGL-NWPEKVKAMQRAWIGRSEGAEILFPVEGKEV 204

Query: 241 IESIKCYTTRPDTLFGFSFLALSVDHPLAKYY---EEDKEFQKFREECSKTGTTEESIAS 297
              I  +TTRPDTLFG +FL L+ +HPL       E+ +E   + E   +    E     
Sbjct: 205 --RIPVFTTRPDTLFGATFLVLAPEHPLTLELAAPEKREEVLAYVEAAKRKTEIERQAEG 262

Query: 298 AEKLGFKTDMIAVNPLDKNMKVPVYFANFVLMDYGLGAVFGCPAHDQRDLDFAKKYNLKI 357
            EK G      A+NP     ++P++ A++VL  YG GA+   PAHDQRD +FA+K+ L I
Sbjct: 263 REKTGVFLGAYALNPATGE-RIPIWTADYVLFGYGTGAIMAVPAHDQRDYEFARKFGLPI 321

Query: 358 TPVVKPEKDKDFKINNEAYTGEGYLCNSDFLDGLKVPSQSIIKTIEFLEKNNLGTKKTNY 417
             V+             AY   G + NS   DG +   +   K I +LE+  LG  +  Y
Sbjct: 322 KKVIXXXXXXXXXXXXXAYEEPGIMVNSGPFDGTE-SEEGKRKVIAWLEEKGLGKGRVTY 380

Query: 418 RLKDWGISRQRYWGCPIPIAYDENDQPIKIPRDMLPVKLPEIEKLSNTGNPLDSEDNWKF 477
           RL+DW ISRQRYWG PIP+ +                            +PL++   +  
Sbjct: 381 RLRDWLISRQRYWGTPIPMVHCXXXXXXXXXXXXXXXXXXXXXI-----SPLEAHPEF-- 433

Query: 478 FILDGKKYRRETDTLDTFVDSSWYFLRFCSPHNLDRGFTQEEANYWMPVDQYIGGVEHAI 537
              +    +R          SSWY+LR+  PHN    F  E+AN WMPVDQYIGGVEHA+
Sbjct: 434 --YETTCPKRXXXXXXXXXXSSWYYLRYTDPHNDRLPFDPEKANAWMPVDQYIGGVEHAV 491

Query: 538 LHLLYSRFFMQALSYKNDDFKLKEPFDGLFTQGMVCHET--------------YKDQNNK 583
           LHLLYSRFF + L +     K++EPF GLFTQGMV   T               +    +
Sbjct: 492 LHLLYSRFFTKFL-HDLGMVKVEEPFQGLFTQGMVLAWTDFGPVEVEGSVVRLPEPTRIR 550

Query: 584 WLSPDEVTS-EDGKKFYKKDNPSE--KIIVGPTESMSKSKKNTIDPENIIKNYGADSVRL 640
              P+   S ED +K   +  P E   + +     MSKSK N +     +K  GAD  R+
Sbjct: 551 LEIPESALSLEDVRKMGAELRPHEDGTLHLWKPAVMSKSKGNGVMVGPFVKEQGADIARI 610

Query: 641 FILSDSPPEKDVQWSDQGMLASFKFVQKLWTLNSKILDKIKNND-----QGSEGNDLAKF 695
            IL  +PPE ++ W+++G+  +++F+ +++   ++  + +         +  EG D   +
Sbjct: 611 TILFAAPPENEMVWTEEGVQGAWRFLNRIYRRVAEDREALLETSGVFQAEALEGKDRELY 670

Query: 696 --TNQLINKITQNLEKFHYNVIVANFYEMYNFLXXXXXXXXXXXXXXXNYKKILIVMNPF 753
              ++ + K+T++LE   +N  +A   E  N L                 +  L ++ PF
Sbjct: 671 GKLHETLKKVTEDLEALRFNTAIAALMEFLNALYEYRKDRPVTPVYRTAIRYYLQMLFPF 730

Query: 754 IPHFSNECLSTINENQI---SWPEISKEDL 780
            PH + E       + +    WPE+ ++ L
Sbjct: 731 APHLAEELWHWFWPDSLFEAGWPELDEKAL 760


>1wz2A [x.x.x] LEUCYL-TRNA SYNTHETASE
          Length = 948

 Score =  129 bits (324), Expect = 3e-32
 Identities = 77/198 (38%), Positives = 103/198 (52%), Gaps = 28/198 (14%)

Query: 5   NFKTVEEKWQKFWHKNKVFSSKL-DKTK-KKFYCLEMFPYPSGKIHMGHVRNYTIGDVLA 62
           NFK +EEKWQK W + K+F   + DK K KKFY    FPY SG +H+GH R YTI DV+A
Sbjct: 2   NFKAIEEKWQKRWLEAKIFEPNIRDKPKEKKFYITVAFPYLSGHLHVGHARTYTIPDVIA 61

Query: 63  RYKTLQGYNVLHPMGWDSFGMPAEN-AARQNNLDPKT---------------WTESN--- 103
           R+K +QGYNVL PM W   G P    A R  N DPKT               WT  +   
Sbjct: 62  RFKRMQGYNVLFPMAWHITGSPIVGIAERIKNRDPKTIWIYRDVYKVPEEILWTFEDPIN 121

Query: 104 -----IKTMRSQLKKLGLSIDWDKEISTCS--EDYYKHQQEFFLDLYDKGLVYRKENYVN 156
                +K  +    + G S+DW +E  T S    + K  +  F  L +KG + +  + V 
Sbjct: 122 IVKYFMKAAKETFIRAGFSVDWSREFYTTSLFPPFSKFIEWQFWKLKEKGYIVKGAHRVR 181

Query: 157 WDPVDETVLANEQVVDGK 174
           WDPV  T L +  +++G+
Sbjct: 182 WDPVVGTPLGDHDLMEGE 199



 Score = 48.5 bits (114), Expect = 7e-08
 Identities = 62/254 (24%), Positives = 105/254 (41%), Gaps = 40/254 (15%)

Query: 614 ESMSKSKKNTIDPENIIKNYGADSVRLFILSDSPPEKDVQWSDQGMLASFKFVQKLWTLN 673
           + MSKSK N ++  + I+  GAD VRL+I+S +  + D  W  + +    K +++ + L 
Sbjct: 630 QKMSKSKGNVLNFIDAIEENGADVVRLYIMSLAEHDSDFDWRRKEVGKLRKQIERFYELI 689

Query: 674 SKILD-KIKNNDQGSEGNDLAKF----TNQLINKITQNLEKFHYNVIVA-NFYEMYNFLX 727
           S+  + ++K N    E  D+ ++     N+ I + T  LE+F     V   FY + N L 
Sbjct: 690 SQFAEYEVKGN---VELKDIDRWMLHRLNKAIKETTNALEEFRTRTAVQWAFYSIMNDLR 746

Query: 728 XXXXXXXXXXXXXXNYKKILI------VMNPFIPHFSNECLSTI-NENQIS---WPEISK 777
                          Y    +      +M PF PH   E    +  E  +S   WPE   
Sbjct: 747 WYLRRTEGRDDEAKRYVLRTLADVWVRLMAPFTPHICEELWEKLGGEGFVSLAKWPEPVX 806

Query: 778 EDL-------------IEEDINFVVQ---INGKKRAILKIKRDVVEKEILEIIKTNLE-- 819
                           + EDI  +++   I   KRA +    D   K + E++    +  
Sbjct: 807 XXXXXXXXXXXXFIRSVMEDIKEIIEVAKIENAKRAYIYTAEDWKWK-VAEVVSEKRDFK 865

Query: 820 --IEKFLKDKTIKK 831
             +E+ +KD  I+K
Sbjct: 866 SSMEELMKDSEIRK 879


>1wkbA [x.x.x] LEUCYL-TRNA SYNTHETASE
          Length = 791

 Score =  129 bits (324), Expect = 3e-32
 Identities = 77/198 (38%), Positives = 103/198 (52%), Gaps = 28/198 (14%)

Query: 5   NFKTVEEKWQKFWHKNKVFSSKL-DKTK-KKFYCLEMFPYPSGKIHMGHVRNYTIGDVLA 62
           NFK +EEKWQK W + K+F   + DK K KKFY    FPY SG +H+GH R YTI DV+A
Sbjct: 2   NFKAIEEKWQKRWLEAKIFEPNIRDKPKEKKFYITVAFPYLSGHLHVGHARTYTIPDVIA 61

Query: 63  RYKTLQGYNVLHPMGWDSFGMPAEN-AARQNNLDPKT---------------WTESN--- 103
           R+K +QGYNVL PM W   G P    A R  N DPKT               WT  +   
Sbjct: 62  RFKRMQGYNVLFPMAWHITGSPIVGIAERIKNRDPKTIWIYRDVYKVPEEILWTFEDPIN 121

Query: 104 -----IKTMRSQLKKLGLSIDWDKEISTCS--EDYYKHQQEFFLDLYDKGLVYRKENYVN 156
                +K  +    + G S+DW +E  T S    + K  +  F  L +KG + +  + V 
Sbjct: 122 IVKYFMKAAKETFIRAGFSVDWSREFYTTSLFPPFSKFIEWQFWKLKEKGYIVKGAHRVR 181

Query: 157 WDPVDETVLANEQVVDGK 174
           WDPV  T L +  +++G+
Sbjct: 182 WDPVVGTPLGDHDLMEGE 199



 Score = 44.7 bits (104), Expect = 1e-06
 Identities = 42/159 (26%), Positives = 70/159 (44%), Gaps = 15/159 (9%)

Query: 614 ESMSKSKKNTIDPENIIKNYGADSVRLFILSDSPPEKDVQWSDQGMLASFKFVQKLWTLN 673
           + MSKSK N ++  + I+  GAD VRL+I+S +  + D  W  + +    K +++ + L 
Sbjct: 630 QKMSKSKGNVLNFIDAIEENGADVVRLYIMSLAEHDSDFDWRRKEVGKLRKQIERFYELI 689

Query: 674 SKILD-KIKNNDQGSEGNDLAKF----TNQLINKITQNLEKFHYNVIVA-NFYEMYNFLX 727
           S+  + ++K N    E  D+ ++     N+ I + T  LE+F     V   FY + N L 
Sbjct: 690 SQFAEYEVKGN---VELKDIDRWMLHRLNKAIKETTNALEEFRTRTAVQWAFYSIMNDLR 746

Query: 728 XXXXXXXXXXXXXXNYKKILI------VMNPFIPHFSNE 760
                          Y    +      +M PF PH   E
Sbjct: 747 WYLRRTEGRDDEAKRYVLRTLADVWVRLMAPFTPHICEE 785


>2ajgA [x.x.x] LEUCYL-TRNA SYNTHETASE
          Length = 186

 Score =  124 bits (310), Expect = 1e-30
 Identities = 69/165 (41%), Positives = 94/165 (56%), Gaps = 4/165 (2%)

Query: 228 GCEVEFKIESEKPIESIKCYTTRPDTLFGFSFLALSVDHPLA-KYYEEDKEFQKFREECS 286
           G E+ F +       ++  YTTRPDT  G ++LA++  HPLA K  E + E   F +EC 
Sbjct: 2   GVEITFNVNDYD--NTLTVYTTRPDTFMGCTYLAVAAGHPLAQKAAENNPELAAFIDECR 59

Query: 287 KTGTTEESIASAEKLGFKTDMIAVNPLDKNMKVPVYFANFVLMDYGLGAVFGCPAHDQRD 346
            T   E  +A+ EK G  T   AV+PL    ++PV+ ANFVLM+YG GAV   P HDQRD
Sbjct: 60  NTKVAEAEMATMEKKGVDTGFKAVHPLTGE-EIPVWAANFVLMEYGTGAVMAVPGHDQRD 118

Query: 347 LDFAKKYNLKITPVVKPEKDKDFKINNEAYTGEGYLCNSDFLDGL 391
            +FA KY L I PV+      +  ++ +A T +G L NS   +GL
Sbjct: 119 YEFASKYGLNIKPVILAADGSEPDLSQQALTEKGVLFNSGEFNGL 163


>1gaxA [c.26.1 - b.51.1 - a.27.1 - a.2.7] VALYL-TRNA SYNTHETASE
          Length = 862

 Score =  120 bits (300), Expect = 2e-29
 Identities = 166/728 (22%), Positives = 266/728 (36%), Gaps = 212/728 (29%)

Query: 4   YNFKTVEEKWQKFWHKNKVFSSKLDKTKKKFYCLEMFPYPSGKIHMGHVRNYTIGDVLAR 63
           Y+ K+VE KW + W KN  F +     K  F      P  +G +HMGH  + ++ D L R
Sbjct: 7   YDPKSVEPKWAEKWAKNP-FVANPKSGKPPFVIFMPPPNVTGSLHMGHALDNSLQDALIR 65

Query: 64  YKTLQGYNVLHPMGWDSFGMPAENAARQNNL-DPKT---------------WTESNIKTM 107
           YK ++G+  +   G D  G+  +    +  L + KT               W E +  T+
Sbjct: 66  YKRMRGFEAVWLPGTDHAGIATQVVVERLLLKEGKTRHDLGREKFLERVWQWKEESGGTI 125

Query: 108 RSQLKKLGLSIDWDKEISTCSEDYYKHQQEFFLDLYDKGLVYRKENYVNWDPVDETVLAN 167
             QLK+LG S DW +E  T  E   +  +  F   Y +GL YR    VNW P  ET L++
Sbjct: 126 LKQLKRLGASADWSREAFTMDEKRSRAVRYAFSRYYHEGLAYRAPRLVNWCPRCETTLSD 185

Query: 168 EQVVDGKGWRSGATVERKKLNQWFFNISKFSEDLLQGLDALENWPNKVKVMQKNWIGKSF 227
            +V                                      E  P K+  ++    G  F
Sbjct: 186 LEV------------------------------------ETEPTPGKLYTLRYEVEGGGF 209

Query: 228 GCEVEFKIESEKPIESIKCYTTRPDTLFGFSFLALSVDHPLAKYYEEDKEFQKFREECSK 287
                           I+  T RP+T+F    +A+   HP      ED+ ++    + ++
Sbjct: 210 ----------------IEIATVRPETVFADQAIAV---HP------EDERYRHLLGKRAR 244

Query: 288 TGTTEESIASAEKLGFKTDMIAVNPLDKNMKVPVYFANFVLMDYGLGAVFGCPAHDQRDL 347
              TE                        + +P+     V  D+G GA+   PAHD  D 
Sbjct: 245 IPLTE------------------------VWIPILADPAVEKDFGTGALKVTPAHDPLDY 280

Query: 348 DFAKKYNLKITPVVKPEKDKDFKINNEAYTG----------------EGYLC-NSDFLDG 390
           +  +++ LK   V+  E   + +   EA  G                 G+L    D+   
Sbjct: 281 EIGERHGLKPVSVINLEGRMEGERVPEALRGLDRFEARRKAVELFREAGHLVKEEDYTIA 340

Query: 391 LKVPSQS-------------------IIKTIEFLEKNNLG-----TKKTNY----RLKDW 422
           L   S+                      + ++ L + ++       KK N      +KDW
Sbjct: 341 LATCSRCGTPIEYAIFPQWWLRMRPLAEEVLKGLRRGDIAFVPERWKKVNMDWLENVKDW 400

Query: 423 GISRQRYWGCPIPIAYDENDQPIKIPRDMLPVKLPEIEKLSNTGNPLDSEDNWKFFILDG 482
            ISRQ +WG  IP  Y E+ Q + +PR    ++ P        G+P              
Sbjct: 401 NISRQLWWGHQIPAWYCEDCQAVNVPRPERYLEDP--TSCEACGSP-------------- 444

Query: 483 KKYRRETDTLDTFVDSSWYFLRFCSPHNLDRGFTQEEANYWMPVDQYIGGVEHAILHLLY 542
            + +R+ D  DT+  S+ + L       L      E+   + P D  + G +  IL L  
Sbjct: 445 -RLKRDEDVFDTWFSSALWPL-----STLGWPEETEDLKAFYPGDVLVTGYD--ILFLWV 496

Query: 543 SRFFMQALSYKNDDFKLKEPFDGLFTQGMVCHETYKDQNNKWLSPDEVTSEDGKKFYKKD 602
           SR  M+   Y    F  + PF  +   G+                  V  E G+K     
Sbjct: 497 SR--MEVSGY---HFMGERPFKTVLLHGL------------------VLDEKGQK----- 528

Query: 603 NPSEKIIVGPTESMSKSKKNTIDPENIIKNYGADSVRLFILSDSPPEKDVQWSDQGMLAS 662
                        MSKSK N IDP  +++ YGAD++R  ++  +   +D++   + +  +
Sbjct: 529 -------------MSKSKGNVIDPLEMVERYGADALRFALIYLATGGQDIRLDLRWLEMA 575

Query: 663 FKFVQKLW 670
             F  KL+
Sbjct: 576 RNFANKLY 583


>2ajhB [x.x.x] LEUCYL-TRNA SYNTHETASE
          Length = 175

 Score =  111 bits (277), Expect = 9e-27
 Identities = 66/165 (40%), Positives = 90/165 (54%), Gaps = 14/165 (8%)

Query: 228 GCEVEFKIESEKPIESIKCYTTRPDTLFGFSFLALSVDHPLA-KYYEEDKEFQKFREECS 286
           G E+ F +       ++  YTTRPDT  G ++LA++  HPLA K  E + E   F +EC 
Sbjct: 2   GVEITFNVNDYD--NTLTVYTTRPDTFMGCTYLAVAAGHPLAQKAAENNPELAAFIDECR 59

Query: 287 KTGTTEESIASAEKLGFKTDMIAVNPLDKNMKVPVYFANFVLMDYGLGAVFGCPAHDQRD 346
                     + EK G  T   AV+PL    ++PV+ ANFVLM+YG GAV   P HDQRD
Sbjct: 60  ----------TMEKKGVDTGFKAVHPLTGE-EIPVWAANFVLMEYGTGAVMAVPGHDQRD 108

Query: 347 LDFAKKYNLKITPVVKPEKDKDFKINNEAYTGEGYLCNSDFLDGL 391
            +FA KY L I PV+      +  ++ +A T +G L NS   +GL
Sbjct: 109 YEFASKYGLNIKPVILAADGSEPDLSQQALTEKGVLFNSGEFNGL 153


>2ajgB [x.x.x] LEUCYL-TRNA SYNTHETASE
          Length = 174

 Score =  110 bits (276), Expect = 1e-26
 Identities = 66/165 (40%), Positives = 89/165 (53%), Gaps = 15/165 (9%)

Query: 228 GCEVEFKIESEKPIESIKCYTTRPDTLFGFSFLALSVDHPLA-KYYEEDKEFQKFREECS 286
           G E+ F +       ++  YTTRPDT  G ++LA++  HPLA K  E + E   F +EC 
Sbjct: 2   GVEITFNVNDYD--NTLTVYTTRPDTFMGCTYLAVAAGHPLAQKAAENNPELAAFIDECR 59

Query: 287 KTGTTEESIASAEKLGFKTDMIAVNPLDKNMKVPVYFANFVLMDYGLGAVFGCPAHDQRD 346
                       EK G  T   AV+PL    ++PV+ ANFVLM+YG GAV   P HDQRD
Sbjct: 60  N-----------EKKGVDTGFKAVHPLTGE-EIPVWAANFVLMEYGTGAVMAVPGHDQRD 107

Query: 347 LDFAKKYNLKITPVVKPEKDKDFKINNEAYTGEGYLCNSDFLDGL 391
            +FA KY L I PV+      +  ++ +A T +G L NS   +GL
Sbjct: 108 YEFASKYGLNIKPVILAADGSEPDLSQQALTEKGVLFNSGEFNGL 152


>1qu3A [c.26.1 - b.51.1 - a.27.1] ISOLEUCYL-TRNA SYNTHETASE
          Length = 880

 Score = 83.2 bits (204), Expect = 3e-18
 Identities = 46/162 (28%), Positives = 78/162 (48%), Gaps = 14/162 (8%)

Query: 10  EEKWQKFWHKNKVFSSKLDKTK--KKFYCLEMFPYPSGKIHMGHVRNYTIGDVLARYKTL 67
           E + Q+ W     +   L+K K  + F   +  PY +G +HMGH  N  + D + RYKT+
Sbjct: 23  EPQIQEKWDAEDQYHKALEKNKGNETFILHDGPPYANGNLHMGHALNKILKDFIVRYKTM 82

Query: 68  QGYNVLHPMGWDSFGMPAENAARQNNLDPKTWTES------------NIKTMRSQLKKLG 115
           QG+   +  GWD+ G+P E A  +  +D K  + +             I+  +   ++LG
Sbjct: 83  QGFYAPYVPGWDTHGLPIEQALTKKGVDRKKMSTAEFREKCKEFALEQIELQKKDFRRLG 142

Query: 116 LSIDWDKEISTCSEDYYKHQQEFFLDLYDKGLVYRKENYVNW 157
           +  D++    T   +Y   Q   F ++ DKGL+Y+ +  V W
Sbjct: 143 VRGDFNDPYITLKPEYEAAQIRIFGEMADKGLIYKGKKPVYW 184



 Score = 64.7 bits (156), Expect = 9e-13
 Identities = 133/580 (22%), Positives = 211/580 (36%), Gaps = 145/580 (25%)

Query: 327 VLMDYGLGAVFGCPAHDQRDLDFAKKYNLKITPVVKPEKDKDF----------------- 369
           V  D G G V   P H + D    ++Y L   PV+ P  DK                   
Sbjct: 314 VTTDAGTGCVHTAPGHGEDDYIVGQQYEL---PVISPIDDKGVFTEEGGQFEGMFYDKAN 370

Query: 370 KINNEAYTGEGYLCNSDFLD-----------------------GLKVPSQSIIKTIEFLE 406
           K   +  T +G L   DF+                         +    Q I+  IE   
Sbjct: 371 KAVTDLLTEKGALLKLDFITHSYPHDWRTKKPVIFRATPQWFASISKVRQDILDAIENTN 430

Query: 407 -KNNLGTKKTNYRLKD---WGISRQRYWGCPIPIAYDENDQPIKIPRDMLPVKLPEIEKL 462
            K N G  +    ++D   W ISRQR WG P+P+ Y EN + I     +  V     E  
Sbjct: 431 FKVNWGKTRIYNMVRDRGEWVISRQRVWGVPLPVFYAENGEIIMTKETVNHVADLFAEHG 490

Query: 463 SNTGNPLDSEDNW-KFFILDGK---KYRRETDTLDTFVDSSWYFLRFCSPHNLDRGFTQE 518
           SN     +++D   + F   G     + +ETD +D + DS        S H   RG  + 
Sbjct: 491 SNIWFEREAKDLLPEGFTHPGSPNGTFTKETDIMDVWFDSG-------SSH---RGVLET 540

Query: 519 EANYWMPVDQYIGGVEHAILHLLYSRFFMQALSYKNDDFKLKEPFDGLFTQGMVCHETYK 578
                 P D Y+ G +       Y  +F  +++              + T+G+     YK
Sbjct: 541 RPELSFPADMYLEGSDQ------YRGWFNSSIT------------TSVATRGV---SPYK 579

Query: 579 DQNNKWLSPDEVTSEDGKKFYKKDNPSEKIIVGPTESMSKSKKNTIDPENIIKNYGADSV 638
                 LS   V   +GKK                  MSKS  N I P+ ++K  GAD  
Sbjct: 580 ----FLLSHGFVMDGEGKK------------------MSKSLGNVIVPDQVVKQKGADIA 617

Query: 639 RLFILSDSPPEKDVQWSDQGMLASFKFVQKLWTLNSKILDKIKNNDQGSEG---NDLAKF 695
           RL++ S +    DV+ SD+ +  +    +K+      +L  I + +  ++    ++L + 
Sbjct: 618 RLWV-SSTDYLADVRISDEILKQTSDDYRKIRNTLRFMLGNINDFNPDTDSIPESELLEV 676

Query: 696 TNQLINKITQ-------NLEKFHY-----------NVIVANFYEMY--NFLXXXXXXXXX 735
              L+N++ +       N E F Y           NV ++NFY  Y  + L         
Sbjct: 677 DRYLLNRLREFTASTINNYENFDYLNIYQEVQNFINVELSNFYLDYGKDILYIEQRDSHI 736

Query: 736 XXXXXXNYKKILIVMN----PFIPHFSNECLSTINENQISWPEISKEDLIEEDINFVVQI 791
                    +IL+ M     P + H + E  S         P + +E +   D+  VV++
Sbjct: 737 RRSMQTVLYQILVDMTKLLAPILVHTAEEVWS-------HTPHVKEESVHLADMPKVVEV 789

Query: 792 N----GKKRAILKIKRDVVEKEILEIIKTNLEIEKFLKDK 827
           +     K R  + ++ DV     LE  +    I K L+ K
Sbjct: 790 DQALLDKWRTFMNLRDDV--NRALETARNEKVIGKSLEAK 827


>1ffyA [c.26.1 - b.51.1 - a.27.1] ISOLEUCYL-TRNA SYNTHETASE
          Length = 917

 Score = 83.2 bits (204), Expect = 3e-18
 Identities = 46/162 (28%), Positives = 78/162 (48%), Gaps = 14/162 (8%)

Query: 10  EEKWQKFWHKNKVFSSKLDKTK--KKFYCLEMFPYPSGKIHMGHVRNYTIGDVLARYKTL 67
           E + Q+ W     +   L+K K  + F   +  PY +G +HMGH  N  + D + RYKT+
Sbjct: 24  EPQIQEKWDAEDQYHKALEKNKGNETFILHDGPPYANGNLHMGHALNKILKDFIVRYKTM 83

Query: 68  QGYNVLHPMGWDSFGMPAENAARQNNLDPKTWTES------------NIKTMRSQLKKLG 115
           QG+   +  GWD+ G+P E A  +  +D K  + +             I+  +   ++LG
Sbjct: 84  QGFYAPYVPGWDTHGLPIEQALTKKGVDRKKMSTAEFREKCKEFALEQIELQKKDFRRLG 143

Query: 116 LSIDWDKEISTCSEDYYKHQQEFFLDLYDKGLVYRKENYVNW 157
           +  D++    T   +Y   Q   F ++ DKGL+Y+ +  V W
Sbjct: 144 VRGDFNDPYITLKPEYEAAQIRIFGEMADKGLIYKGKKPVYW 185



 Score = 64.7 bits (156), Expect = 9e-13
 Identities = 133/580 (22%), Positives = 211/580 (36%), Gaps = 145/580 (25%)

Query: 327 VLMDYGLGAVFGCPAHDQRDLDFAKKYNLKITPVVKPEKDKDF----------------- 369
           V  D G G V   P H + D    ++Y L   PV+ P  DK                   
Sbjct: 315 VTTDAGTGCVHTAPGHGEDDYIVGQQYEL---PVISPIDDKGVFTEEGGQFEGMFYDKAN 371

Query: 370 KINNEAYTGEGYLCNSDFLD-----------------------GLKVPSQSIIKTIEFLE 406
           K   +  T +G L   DF+                         +    Q I+  IE   
Sbjct: 372 KAVTDLLTEKGALLKLDFITHSYPHDWRTKKPVIFRATPQWFASISKVRQDILDAIENTN 431

Query: 407 -KNNLGTKKTNYRLKD---WGISRQRYWGCPIPIAYDENDQPIKIPRDMLPVKLPEIEKL 462
            K N G  +    ++D   W ISRQR WG P+P+ Y EN + I     +  V     E  
Sbjct: 432 FKVNWGKTRIYNMVRDRGEWVISRQRVWGVPLPVFYAENGEIIMTKETVNHVADLFAEHG 491

Query: 463 SNTGNPLDSEDNW-KFFILDGK---KYRRETDTLDTFVDSSWYFLRFCSPHNLDRGFTQE 518
           SN     +++D   + F   G     + +ETD +D + DS        S H   RG  + 
Sbjct: 492 SNIWFEREAKDLLPEGFTHPGSPNGTFTKETDIMDVWFDSG-------SSH---RGVLET 541

Query: 519 EANYWMPVDQYIGGVEHAILHLLYSRFFMQALSYKNDDFKLKEPFDGLFTQGMVCHETYK 578
                 P D Y+ G +       Y  +F  +++              + T+G+     YK
Sbjct: 542 RPELSFPADMYLEGSDQ------YRGWFNSSIT------------TSVATRGV---SPYK 580

Query: 579 DQNNKWLSPDEVTSEDGKKFYKKDNPSEKIIVGPTESMSKSKKNTIDPENIIKNYGADSV 638
                 LS   V   +GKK                  MSKS  N I P+ ++K  GAD  
Sbjct: 581 ----FLLSHGFVMDGEGKK------------------MSKSLGNVIVPDQVVKQKGADIA 618

Query: 639 RLFILSDSPPEKDVQWSDQGMLASFKFVQKLWTLNSKILDKIKNNDQGSEG---NDLAKF 695
           RL++ S +    DV+ SD+ +  +    +K+      +L  I + +  ++    ++L + 
Sbjct: 619 RLWV-SSTDYLADVRISDEILKQTSDDYRKIRNTLRFMLGNINDFNPDTDSIPESELLEV 677

Query: 696 TNQLINKITQ-------NLEKFHY-----------NVIVANFYEMY--NFLXXXXXXXXX 735
              L+N++ +       N E F Y           NV ++NFY  Y  + L         
Sbjct: 678 DRYLLNRLREFTASTINNYENFDYLNIYQEVQNFINVELSNFYLDYGKDILYIEQRDSHI 737

Query: 736 XXXXXXNYKKILIVMN----PFIPHFSNECLSTINENQISWPEISKEDLIEEDINFVVQI 791
                    +IL+ M     P + H + E  S         P + +E +   D+  VV++
Sbjct: 738 RRSMQTVLYQILVDMTKLLAPILVHTAEEVWS-------HTPHVKEESVHLADMPKVVEV 790

Query: 792 N----GKKRAILKIKRDVVEKEILEIIKTNLEIEKFLKDK 827
           +     K R  + ++ DV     LE  +    I K L+ K
Sbjct: 791 DQALLDKWRTFMNLRDDV--NRALETARNEKVIGKSLEAK 828


>1ileA [c.26.1 - b.51.1 - a.27.1 (1jzqA)] ISOLEUCYL-TRNA SYNTHETASE
          Length = 821

 Score = 67.8 bits (164), Expect = 1e-13
 Identities = 47/188 (25%), Positives = 83/188 (44%), Gaps = 19/188 (10%)

Query: 5   NFKTVEEKWQKFWHKNKVFSSKLDKTK--KKFYCLEMFPYPSGKIHMGHVRNYTIGDVLA 62
           NF  +EE+   FW + K+F   ++  K   ++   E  P  +G  H+GH +  +  D+  
Sbjct: 9   NFPKLEEEVLAFWKREKIFQKSVENRKGGPRYTVYEGPPTANGLPHVGHAQARSYKDLFP 68

Query: 63  RYKTLQGYNVLHPMGWDSFGMPAE-NAARQNNLDPKTWTE----------------SNIK 105
           RYKT++GY      GWD+ G+P E    ++  L  K   E                +  K
Sbjct: 69  RYKTMRGYYAPRRAGWDTHGLPVELEVEKKLGLKSKREIEAYGIERFNQACRESVFTYEK 128

Query: 106 TMRSQLKKLGLSIDWDKEISTCSEDYYKHQQEFFLDLYDKGLVYRKENYVNWDPVDETVL 165
              +  +++   +D +   +T    Y +       +L+D+GL+YR    V + P   T L
Sbjct: 129 EWEAFTERIAYWVDLEDAYATLEPTYIESIWWSLKNLFDRGLLYRDHKVVPYCPRCGTPL 188

Query: 166 ANEQVVDG 173
           ++ +V  G
Sbjct: 189 SSHEVALG 196



 Score = 58.5 bits (140), Expect = 7e-11
 Identities = 105/451 (23%), Positives = 166/451 (36%), Gaps = 116/451 (25%)

Query: 321 VYFANFVLMDYGLGAVFGCPAHDQRDLDFAKKYNLKITP--------VVKPEKDKDFKIN 372
           V  A++V  + G G V   PA    DL+ A+ Y L +          +V+P K   F+  
Sbjct: 303 VVLADYVSQEDGTGIVHQAPAFGAEDLETARVYGLPLLKTVDEEGKLLVEPFKGLYFREA 362

Query: 373 NEA-----------YTGEGYL--------C---------------NSDFLDGLKVPSQSI 398
           N A           +  E YL        C               N+ F D L   +Q I
Sbjct: 363 NRAILRDLRGRGLLFKEESYLHSYPHCWRCSTPLMYYATESWFIKNTLFKDELIRNNQEI 422

Query: 399 IKTIEFLEKNNLGTKKTNYRLKDWGISRQRYWGCPIPIAYDENDQPIKIPRDMLPVKLPE 458
                 +++   G    N  L DW +SR RYWG P+PI   +     +       +K   
Sbjct: 423 HWVPPHIKEGRYGEWLKN--LVDWALSRNRYWGTPLPIWVCQACGKEEAIGSFQELKARA 480

Query: 459 IEKLSNTGNP-LDSEDNWKFFILDGKKYRRETDTLDTFVDSSWYFLRFCSPHNLDRGFTQ 517
            + L    +P     D  +     G   RR    +D + DS    + F S H     F  
Sbjct: 481 TKPLPEPFDPHRPYVDQVELACACGGTMRRVPYVIDVWYDSG--AMPFASLHY---PFEH 535

Query: 518 EEA-NYWMPVDQYIGGVEHA-----ILHLLYSRFFMQALSYKNDDFKLKEPFDGLFTQGM 571
           EE      P D    G++        LH L    F  ++++KN                +
Sbjct: 536 EEVFRESFPADFIAEGIDQTRGWFNSLHQLGVMLF-GSIAFKN----------------V 578

Query: 572 VCHETYKDQNNKWLSPDEVTSEDGKKFYKKDNPSEKIIVGPTESMSKSKKNTIDPENIIK 631
           +CH    D             E G+K                  MSKSK N +DP +II+
Sbjct: 579 ICHGLILD-------------EKGQK------------------MSKSKGNVVDPWDIIR 607

Query: 632 NYGADSVRLFILSDSPPEKDVQWSDQGMLASFK-FVQKLWTLNSKI-----LDK--IKNN 683
            +GAD++R +I   +PPE D ++    +  + + +   LW + S       LD+  +KN 
Sbjct: 608 KFGADALRWYIYVSAPPEADRRFGPNLVRETVRDYFLTLWNVYSFFVTYANLDRPDLKNP 667

Query: 684 DQGSEGNDLAKF----TNQLINKITQNLEKF 710
               +  ++ ++       LI ++T+ LE +
Sbjct: 668 PPPEKRPEMDRWLLARMQDLIQRVTEALEAY 698


>2d5bA [x.x.x] METHIONYL-TRNA SYNTHETASE
          Length = 500

 Score = 60.8 bits (146), Expect = 1e-11
 Identities = 51/200 (25%), Positives = 81/200 (40%), Gaps = 8/200 (4%)

Query: 31  KKKFYCLEMFPYPSGKIHMGHVRNYTIGDVLARYKTLQGYNVLHPMGWDSFGMPAENAAR 90
           +K FY      Y + + H+GH     + D LAR+  L GY      G D  G     AA+
Sbjct: 2   EKVFYVTTPIYYVNAEPHLGHAYTTVVADFLARWHRLDGYRTFFLTGTDEHGETVYRAAQ 61

Query: 91  QNNLDPKTWTESNIKTMRSQLKKLGLSIDWDKEISTCSEDYYKHQQEFFLDLYDKGLVYR 150
               DPK + +      +     LG++  +D  I T  E +           Y+ G +Y 
Sbjct: 62  AAGEDPKAFVDRVSGRFKRAWDLLGIA--YDDFIRTTEERHXXXXXXXXXXXYEAGDIYY 119

Query: 151 KENYVNWDPVDETVLANEQVVDGKGWRSGATVERKKLNQWFFNISKF----SEDLLQGLD 206
            E    +    E     +++V+G     G  VER+K   +FF + K+     E + +  D
Sbjct: 120 GEYEGLYCVSCERFYTEKELVEGLCPIHGRPVERRKEGNYFFRMEKYRPWLQEYIQENPD 179

Query: 207 AL--ENWPNKVKVMQKNWIG 224
            +  E + N+V  M    IG
Sbjct: 180 LIRPEGYRNEVLAMLAEPIG 199



 Score = 37.0 bits (84), Expect = 2e-04
 Identities = 16/57 (28%), Positives = 34/57 (59%), Gaps = 1/57 (1%)

Query: 609 IVGPT-ESMSKSKKNTIDPENIIKNYGADSVRLFILSDSPPEKDVQWSDQGMLASFK 664
           ++GP    MSK+  N +DP  +++ YG D++R ++L + P  +D   S++ +   ++
Sbjct: 290 LLGPDGRKMSKTLGNVVDPFALLEKYGRDALRYYLLREIPYGQDTPVSEEALRTRYE 346


>2d54A [x.x.x] METHIONYL-TRNA SYNTHETASE
          Length = 500

 Score = 60.8 bits (146), Expect = 1e-11
 Identities = 51/200 (25%), Positives = 81/200 (40%), Gaps = 8/200 (4%)

Query: 31  KKKFYCLEMFPYPSGKIHMGHVRNYTIGDVLARYKTLQGYNVLHPMGWDSFGMPAENAAR 90
           +K FY      Y + + H+GH     + D LAR+  L GY      G D  G     AA+
Sbjct: 2   EKVFYVTTPIYYVNAEPHLGHAYTTVVADFLARWHRLDGYRTFFLTGTDEHGETVYRAAQ 61

Query: 91  QNNLDPKTWTESNIKTMRSQLKKLGLSIDWDKEISTCSEDYYKHQQEFFLDLYDKGLVYR 150
               DPK + +      +     LG++  +D  I T  E +           Y+ G +Y 
Sbjct: 62  AAGEDPKAFVDRVSGRFKRAWDLLGIA--YDDFIRTTEERHXXXXXXXXXXXYEAGDIYY 119

Query: 151 KENYVNWDPVDETVLANEQVVDGKGWRSGATVERKKLNQWFFNISKF----SEDLLQGLD 206
            E    +    E     +++V+G     G  VER+K   +FF + K+     E + +  D
Sbjct: 120 GEYEGLYCVSCERFYTEKELVEGLCPIHGRPVERRKEGNYFFRMEKYRPWLQEYIQENPD 179

Query: 207 AL--ENWPNKVKVMQKNWIG 224
            +  E + N+V  M    IG
Sbjct: 180 LIRPEGYRNEVLAMLAEPIG 199



 Score = 37.0 bits (84), Expect = 2e-04
 Identities = 16/57 (28%), Positives = 34/57 (59%), Gaps = 1/57 (1%)

Query: 609 IVGPT-ESMSKSKKNTIDPENIIKNYGADSVRLFILSDSPPEKDVQWSDQGMLASFK 664
           ++GP    MSK+  N +DP  +++ YG D++R ++L + P  +D   S++ +   ++
Sbjct: 290 LLGPDGRKMSKTLGNVVDPFALLEKYGRDALRYYLLREIPYGQDTPVSEEALRTRYE 346


>1a8hA [x.x.x] METHIONYL-TRNA SYNTHETASE
          Length = 500

 Score = 60.8 bits (146), Expect = 1e-11
 Identities = 51/200 (25%), Positives = 81/200 (40%), Gaps = 8/200 (4%)

Query: 31  KKKFYCLEMFPYPSGKIHMGHVRNYTIGDVLARYKTLQGYNVLHPMGWDSFGMPAENAAR 90
           +K FY      Y + + H+GH     + D LAR+  L GY      G D  G     AA+
Sbjct: 2   EKVFYVTTPIYYVNAEPHLGHAYTTVVADFLARWHRLDGYRTFFLTGTDEHGETVYRAAQ 61

Query: 91  QNNLDPKTWTESNIKTMRSQLKKLGLSIDWDKEISTCSEDYYKHQQEFFLDLYDKGLVYR 150
               DPK + +      +     LG++  +D  I T  E +           Y+ G +Y 
Sbjct: 62  AAGEDPKAFVDRVSGRFKRAWDLLGIA--YDDFIRTTEERHXXXXXXXXXXXYEAGDIYY 119

Query: 151 KENYVNWDPVDETVLANEQVVDGKGWRSGATVERKKLNQWFFNISKF----SEDLLQGLD 206
            E    +    E     +++V+G     G  VER+K   +FF + K+     E + +  D
Sbjct: 120 GEYEGLYCVSCERFYTEKELVEGLCPIHGRPVERRKEGNYFFRMEKYRPWLQEYIQENPD 179

Query: 207 AL--ENWPNKVKVMQKNWIG 224
            +  E + N+V  M    IG
Sbjct: 180 LIRPEGYRNEVLAMLAEPIG 199



 Score = 37.0 bits (84), Expect = 2e-04
 Identities = 16/57 (28%), Positives = 34/57 (59%), Gaps = 1/57 (1%)

Query: 609 IVGPT-ESMSKSKKNTIDPENIIKNYGADSVRLFILSDSPPEKDVQWSDQGMLASFK 664
           ++GP    MSK+  N +DP  +++ YG D++R ++L + P  +D   S++ +   ++
Sbjct: 290 LLGPDGRKMSKTLGNVVDPFALLEKYGRDALRYYLLREIPYGQDTPVSEEALRTRYE 346


>2ct8A [x.x.x] METHIONYL-TRNA SYNTHETASE
          Length = 465

 Score = 57.0 bits (136), Expect = 2e-10
 Identities = 37/123 (30%), Positives = 56/123 (45%), Gaps = 6/123 (4%)

Query: 32  KKFYCLEMFPYPSGKIHMGHVRNYTIGDVLARYKTLQGYNVLHPMGWDSFGMPAENAARQ 91
           KKFY      Y +   H+GH       D +ARY  L+ Y+V    G D  G+  +  A +
Sbjct: 5   KKFYVTTPIYYVNDVPHLGHAYTTIAADTIARYYRLRDYDVFFLTGTDEHGLKIQKKAEE 64

Query: 92  NNLDPKTWTESNIKTMRSQLKKLG--LSIDWDKEISTCSEDYYKHQQEFFLDLYDKGLVY 149
             + PK   + N +    + KKL   L I++ K I T    + K  Q+ F + Y +G +Y
Sbjct: 65  LGISPKELVDRNAE----RFKKLWEFLKIEYTKFIRTTDPYHVKFVQKVFEECYKRGDIY 120

Query: 150 RKE 152
             E
Sbjct: 121 LGE 123



 Score = 45.1 bits (105), Expect = 8e-07
 Identities = 26/119 (21%), Positives = 57/119 (47%), Gaps = 6/119 (5%)

Query: 614 ESMSKSKKNTIDPENIIKNYGADSVRLFILSDSPPEKDVQWSDQGML--ASFKFVQKLWT 671
           + MSK+  N +DP  +++ YG D VR F+L + P  +D  +S + +L   + +   ++  
Sbjct: 262 KKMSKTLGNVVDPYEVVQEYGLDEVRYFLLREVPFGQDGDFSKKAILNRINGELANEIGN 321

Query: 672 LNSKILDK----IKNNDQGSEGNDLAKFTNQLINKITQNLEKFHYNVIVANFYEMYNFL 726
           L S++++     +     G+   + AK   + I      +EK ++   +    +  ++L
Sbjct: 322 LYSRVVNMAHKFLGGEVSGARDEEYAKIAQESIKNYENYMEKVNFYKAIEEILKFTSYL 380


>2csxA [x.x.x] METHIONYL-TRNA SYNTHETASE
          Length = 464

 Score = 57.0 bits (136), Expect = 2e-10
 Identities = 37/123 (30%), Positives = 56/123 (45%), Gaps = 6/123 (4%)

Query: 32  KKFYCLEMFPYPSGKIHMGHVRNYTIGDVLARYKTLQGYNVLHPMGWDSFGMPAENAARQ 91
           KKFY      Y +   H+GH       D +ARY  L+ Y+V    G D  G+  +  A +
Sbjct: 5   KKFYVTTPIYYVNDVPHLGHAYTTIAADTIARYYRLRDYDVFFLTGTDEHGLKIQKKAEE 64

Query: 92  NNLDPKTWTESNIKTMRSQLKKLG--LSIDWDKEISTCSEDYYKHQQEFFLDLYDKGLVY 149
             + PK   + N +    + KKL   L I++ K I T    + K  Q+ F + Y +G +Y
Sbjct: 65  LGISPKELVDRNAE----RFKKLWEFLKIEYTKFIRTTDPYHVKFVQKVFEECYKRGDIY 120

Query: 150 RKE 152
             E
Sbjct: 121 LGE 123



 Score = 45.1 bits (105), Expect = 8e-07
 Identities = 26/119 (21%), Positives = 57/119 (47%), Gaps = 6/119 (5%)

Query: 614 ESMSKSKKNTIDPENIIKNYGADSVRLFILSDSPPEKDVQWSDQGML--ASFKFVQKLWT 671
           + MSK+  N +DP  +++ YG D VR F+L + P  +D  +S + +L   + +   ++  
Sbjct: 261 KKMSKTLGNVVDPYEVVQEYGLDEVRYFLLREVPFGQDGDFSKKAILNRINGELANEIGN 320

Query: 672 LNSKILDK----IKNNDQGSEGNDLAKFTNQLINKITQNLEKFHYNVIVANFYEMYNFL 726
           L S++++     +     G+   + AK   + I      +EK ++   +    +  ++L
Sbjct: 321 LYSRVVNMAHKFLGGEVSGARDEEYAKIAQESIKNYENYMEKVNFYKAIEEILKFTSYL 379


>1rqgA [c.26.1 - g.41.1 - a.27.1] METHIONYL-TRNA SYNTHETASE
          Length = 606

 Score = 53.1 bits (126), Expect = 3e-09
 Identities = 33/120 (27%), Positives = 55/120 (45%), Gaps = 3/120 (2%)

Query: 33  KFYCLEMFPYPSGKIHMGHVRN-YTIGDVLARYKTLQGYNVLHPMGWDSFGMPAENAARQ 91
           ++      PY +G IH GH+   Y   D+  RY  L+G +V+   G D  G P    A +
Sbjct: 3   RYMVTSALPYANGPIHAGHLAGAYLPADIFVRYLRLKGEDVVFICGTDEHGTPISFRALK 62

Query: 92  NNLDPKTWTESNIKTMRSQLKKLGLSIDWDKEISTCSEDYYKHQQEFFLDLYDKGLVYRK 151
               P+   +   + ++   ++  +S D+     T    +YK  QEFFL  Y+ G + +K
Sbjct: 63  EGRSPREIVDEFHEQIKITFQRAKISFDFFGR--TELPIHYKLSQEFFLKAYENGHLVKK 120


>1qqtA [c.26.1 - g.41.1 - a.27.1] METHIONYL-TRNA SYNTHETASE
          Length = 546

 Score = 52.0 bits (123), Expect = 6e-09
 Identities = 45/199 (22%), Positives = 77/199 (38%), Gaps = 31/199 (15%)

Query: 32  KKFYCLEMFPYPSGKIHMGHVRNYTIGDVLARYKTLQGYNVLHPMGWDSFGMPAENAARQ 91
           KK       PY +G IH+GH+  +   DV  RY+ ++G+ V      D+ G P    A+Q
Sbjct: 3   KKILVTCALPYANGSIHLGHMLEHIQADVWVRYQRMRGHEVNFICADDAHGTPIMLKAQQ 62

Query: 92  NNLDPKTWTESNIKTMRSQLKKLGLSIDWDKEISTCSEDYYKHQQEFFLDLYDKGLVYRK 151
             + P+        +   Q    G +I +D   ST SE+  +  +  +  L + G +  +
Sbjct: 63  LGITPEQMIGE--MSQEHQTDFAGFNISYDNYHSTHSEENRQLSELIYSRLKENGFIKNR 120

Query: 152 ENYVNWDPVDETVLANE-----------------------------QVVDGKGWRSGATV 182
                +DP     L +                              ++++ K   SGAT 
Sbjct: 121 TISQLYDPEKGMFLPDRFVKGTCPKCKSPDQYGDNCEVCGATYSPTELIEPKSVVSGATP 180

Query: 183 ERKKLNQWFFNISKFSEDL 201
             +    +FF++  FSE L
Sbjct: 181 VMRDSEHFFFDLPSFSEML 199


>1pfwA [c.26.1 - g.41.1 - a.27.1] METHIONYL-TRNA SYNTHETASE
          Length = 546

 Score = 52.0 bits (123), Expect = 6e-09
 Identities = 45/199 (22%), Positives = 77/199 (38%), Gaps = 31/199 (15%)

Query: 32  KKFYCLEMFPYPSGKIHMGHVRNYTIGDVLARYKTLQGYNVLHPMGWDSFGMPAENAARQ 91
           KK       PY +G IH+GH+  +   DV  RY+ ++G+ V      D+ G P    A+Q
Sbjct: 2   KKILVTCALPYANGSIHLGHMLEHIQADVWVRYQRMRGHEVNFICADDAHGTPIMLKAQQ 61

Query: 92  NNLDPKTWTESNIKTMRSQLKKLGLSIDWDKEISTCSEDYYKHQQEFFLDLYDKGLVYRK 151
             + P+        +   Q    G +I +D   ST SE+  +  +  +  L + G +  +
Sbjct: 62  LGITPEQMIGE--MSQEHQTDFAGFNISYDNYHSTHSEENRQLSELIYSRLKENGFIKNR 119

Query: 152 ENYVNWDPVDETVLANE-----------------------------QVVDGKGWRSGATV 182
                +DP     L +                              ++++ K   SGAT 
Sbjct: 120 TISQLYDPEKGMFLPDRFVKGTCPKCKSPDQYGDNCEVCGATYSPTELIEPKSVVSGATP 179

Query: 183 ERKKLNQWFFNISKFSEDL 201
             +    +FF++  FSE L
Sbjct: 180 VMRDSEHFFFDLPSFSEML 198


>1pfuA [c.26.1 - g.41.1 - a.27.1] METHIONYL-TRNA SYNTHETASE
          Length = 547

 Score = 52.0 bits (123), Expect = 6e-09
 Identities = 45/199 (22%), Positives = 77/199 (38%), Gaps = 31/199 (15%)

Query: 32  KKFYCLEMFPYPSGKIHMGHVRNYTIGDVLARYKTLQGYNVLHPMGWDSFGMPAENAARQ 91
           KK       PY +G IH+GH+  +   DV  RY+ ++G+ V      D+ G P    A+Q
Sbjct: 2   KKILVTCALPYANGSIHLGHMLEHIQADVWVRYQRMRGHEVNFICADDAHGTPIMLKAQQ 61

Query: 92  NNLDPKTWTESNIKTMRSQLKKLGLSIDWDKEISTCSEDYYKHQQEFFLDLYDKGLVYRK 151
             + P+        +   Q    G +I +D   ST SE+  +  +  +  L + G +  +
Sbjct: 62  LGITPEQMIGE--MSQEHQTDFAGFNISYDNYHSTHSEENRQLSELIYSRLKENGFIKNR 119

Query: 152 ENYVNWDPVDETVLANE-----------------------------QVVDGKGWRSGATV 182
                +DP     L +                              ++++ K   SGAT 
Sbjct: 120 TISQLYDPEKGMFLPDRFVKGTCPKCKSPDQYGDNCEVCGATYSPTELIEPKSVVSGATP 179

Query: 183 ERKKLNQWFFNISKFSEDL 201
             +    +FF++  FSE L
Sbjct: 180 VMRDSEHFFFDLPSFSEML 198


>1f4lA [c.26.1 - g.41.1 - a.27.1] METHIONYL-TRNA SYNTHETASE
          Length = 545

 Score = 52.0 bits (123), Expect = 6e-09
 Identities = 45/199 (22%), Positives = 77/199 (38%), Gaps = 31/199 (15%)

Query: 32  KKFYCLEMFPYPSGKIHMGHVRNYTIGDVLARYKTLQGYNVLHPMGWDSFGMPAENAARQ 91
           KK       PY +G IH+GH+  +   DV  RY+ ++G+ V      D+ G P    A+Q
Sbjct: 2   KKILVTCALPYANGSIHLGHMLEHIQADVWVRYQRMRGHEVNFICADDAHGTPIMLKAQQ 61

Query: 92  NNLDPKTWTESNIKTMRSQLKKLGLSIDWDKEISTCSEDYYKHQQEFFLDLYDKGLVYRK 151
             + P+        +   Q    G +I +D   ST SE+  +  +  +  L + G +  +
Sbjct: 62  LGITPEQMIGE--MSQEHQTDFAGFNISYDNYHSTHSEENRQLSELIYSRLKENGFIKNR 119

Query: 152 ENYVNWDPVDETVLANE-----------------------------QVVDGKGWRSGATV 182
                +DP     L +                              ++++ K   SGAT 
Sbjct: 120 TISQLYDPEKGMFLPDRFVKGTCPKCKSPDQYGDNCEVCGATYSPTELIEPKSVVSGATP 179

Query: 183 ERKKLNQWFFNISKFSEDL 201
             +    +FF++  FSE L
Sbjct: 180 VMRDSEHFFFDLPSFSEML 198


>1pg0A [c.26.1 - a.27.1] METHIONYL-TRNA SYNTHETASE
          Length = 492

 Score = 50.4 bits (119), Expect = 2e-08
 Identities = 42/165 (25%), Positives = 70/165 (42%), Gaps = 7/165 (4%)

Query: 32  KKFYCLEMFPYPSGKIHMGHVRNYTIGDVLARYKTLQGYNVLHPMGWDSFGMPAENAARQ 91
           KK       PY +G IH+GH+  +   DV  RY+ ++G+ V      D+ G P    A+Q
Sbjct: 2   KKILVTCALPYANGSIHLGHMLEHIQADVWVRYQRMRGHEVNFICADDAHGTPIMLKAQQ 61

Query: 92  NNLDPKTWTESNIKTMRSQLKKLGLSIDWDKEISTCSEDYYKHQQEFFLDLYDKGLVYRK 151
             + P+        +   Q    G +I +D   ST SE+  +  +  +  L + G +  +
Sbjct: 62  LGITPEQMIGE--MSQEHQTDFAGFNISYDNYHSTHSEENRQLSELIYSRLKENGFIKNR 119

Query: 152 ENYVNWDPVDETVLANEQVVDG--KGW-RSGATVER--KKLNQWF 191
                +D   E    +        + W RSGA  E+   K+ +WF
Sbjct: 120 TISQLYDRDSEHFFFDLPSFSEMLQAWTRSGALQEQVANKMQEWF 164


>1pg2A [c.26.1 - a.27.1] METHIONYL-TRNA SYNTHETASE
          Length = 488

 Score = 49.3 bits (116), Expect = 4e-08
 Identities = 40/163 (24%), Positives = 73/163 (44%), Gaps = 7/163 (4%)

Query: 32  KKFYCLEMFPYPSGKIHMGHVRNYTIGDVLARYKTLQGYNVLHPMGWDSFGMPAENAARQ 91
           KK       PY +G IH+GH+  +   DV  RY+ ++G+ V      D+ G P    A+Q
Sbjct: 2   KKILVTCALPYANGSIHLGHMLEHIQADVWVRYQRMRGHEVNFICADDAHGTPIMLKAQQ 61

Query: 92  NNLDPKTWTESNIKTMRSQLKKLGLSIDWDKEISTCSEDYYKHQQEFFLDLYDKGLVYRK 151
             + P+        +   Q    G +I +D   ST SE+  +  +  +  L + G +  +
Sbjct: 62  LGITPEQMIGE--MSQEHQTDFAGFNISYDNYHSTHSEENRQLSELIYSRLKENGFIKNR 119

Query: 152 ENYVNWDPVDETVLANEQVVDGKGW-RSGATVER--KKLNQWF 191
               + +     + +  +++  + W RSGA  E+   K+ +WF
Sbjct: 120 TISRDSEHFFFDLPSFSEML--QAWTRSGALQEQVANKMQEWF 160


>1irxB [c.26.1 - a.97.1] LYSYL-TRNA SYNTHETASE
          Length = 508

 Score = 36.6 bits (83), Expect = 3e-04
 Identities = 34/147 (23%), Positives = 59/147 (40%), Gaps = 20/147 (13%)

Query: 28  DKTKKKFYCLEMFPYPSGKIHMGHVRNYTIGDVLARYKTLQGYNVLHPMGWDSFGMPAEN 87
           ++ +K+ Y +E    PSG +H+G+ R      ++      +GY V H   WD +    + 
Sbjct: 13  ERGEKEKYVVESGITPSGYVHVGNFRELFTAYIVGHALRDKGYEVRHIHMWDDY----DR 68

Query: 88  AARQNNLDPKTWTESNIKTMRSQLKKLGLSIDWDKEISTCSEDYYKHQQEFFLDLYDK-- 145
             +     P+ W +            LG+ I    +   C E Y +H    F +  +K  
Sbjct: 69  FRKVPRNVPQEWKD-----------YLGMPISEVPDPWGCHESYAEHFMRKFEEEVEKLG 117

Query: 146 ---GLVYRKENYVNWDPVDETVLANEQ 169
               L+Y  E Y   +  +E  LA E+
Sbjct: 118 IEVDLLYASELYKRGEYSEEIRLAFEK 144


>1irxA [c.26.1 - a.97.1] LYSYL-TRNA SYNTHETASE
          Length = 507

 Score = 36.6 bits (83), Expect = 3e-04
 Identities = 34/147 (23%), Positives = 59/147 (40%), Gaps = 20/147 (13%)

Query: 28  DKTKKKFYCLEMFPYPSGKIHMGHVRNYTIGDVLARYKTLQGYNVLHPMGWDSFGMPAEN 87
           ++ +K+ Y +E    PSG +H+G+ R      ++      +GY V H   WD +    + 
Sbjct: 13  ERGEKEKYVVESGITPSGYVHVGNFRELFTAYIVGHALRDKGYEVRHIHMWDDY----DR 68

Query: 88  AARQNNLDPKTWTESNIKTMRSQLKKLGLSIDWDKEISTCSEDYYKHQQEFFLDLYDK-- 145
             +     P+ W +            LG+ I    +   C E Y +H    F +  +K  
Sbjct: 69  FRKVPRNVPQEWKD-----------YLGMPISEVPDPWGCHESYAEHFMRKFEEEVEKLG 117

Query: 146 ---GLVYRKENYVNWDPVDETVLANEQ 169
               L+Y  E Y   +  +E  LA E+
Sbjct: 118 IEVDLLYASELYKRGEYSEEIRLAFEK 144


>2zueA [x.x.x] ARGINYL-TRNA SYNTHETASE
          Length = 628

 Score = 36.2 bits (82), Expect = 4e-04
 Identities = 15/30 (50%), Positives = 19/30 (63%)

Query: 43  PSGKIHMGHVRNYTIGDVLARYKTLQGYNV 72
           P+  +HMGH RN  +GDV+AR     GY V
Sbjct: 129 PTKPLHMGHARNAILGDVMARILRFLGYEV 158


  Database: 95pdb09Oct16x
    Posted date:  Nov 2, 2009  3:15 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.314    0.132    0.383 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 803,187,096
Number of extensions: 33215411
Number of successful extensions: 84818
Number of sequences better than 1.0e-03: 1582
Number of HSP's gapped: 83699
Number of HSP's successfully gapped: 1703
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.8 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.0 bits)