BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= AAZ21331.1 pubi0 recR GIB00256CH01 "recR-like protein"
         (203 letters)

Database: 95pdb09Oct16x 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

1vddC [e.49.1] RECOMBINATION PROTEIN RECR                              98   2e-23
1vddB [e.49.1] RECOMBINATION PROTEIN RECR                              98   2e-23
1vddA [e.49.1] RECOMBINATION PROTEIN RECR                              98   2e-23

>1vddC [e.49.1] RECOMBINATION PROTEIN RECR
          Length = 196

 Score = 98.2 bits (243), Expect = 2e-23
 Identities = 61/179 (34%), Positives = 93/179 (51%), Gaps = 4/179 (2%)

Query: 18  PGLGPKSAKRIVLKLINNRDELVKPMANTLAQVYKNVIRCQSCGTLKSNSLGCNNCENSK 77
           PG+GPKSA+R+   L     E ++ +A+ L +  +++  C  C  + +++  C+ C +  
Sbjct: 17  PGIGPKSAQRLAFHLFEQPREDIERLASALLEAKRDLHVCPICFNI-TDAEKCDVCADPS 75

Query: 78  EKYNKICVVEDIADQWSIENSNIYKGYFHILGGTISSA-GQRKEDLLINSLVERVSRENI 136
                ICVVE+  D  ++E S  Y+G +H+L G +S   G   + L I  L+ RV +   
Sbjct: 76  RDQRTICVVEEPGDVIALERSGEYRGLYHVLHGVLSPMNGVGPDKLHIKPLLPRVGQGM- 134

Query: 137 EEVILATSATVEGQTTAYYIEDXXXXXXXXXXXXAQGLPVGGEIESLDDGTLYSAFKNR 195
            EVILAT  TVEG  TA Y++             A G+PVGG +E  D+ TL  A   R
Sbjct: 135 -EVILATGTTVEGDATALYLQRLLEPLGAAISRIAYGVPVGGSLEYTDEVTLGRALTGR 192


>1vddB [e.49.1] RECOMBINATION PROTEIN RECR
          Length = 198

 Score = 98.2 bits (243), Expect = 2e-23
 Identities = 61/179 (34%), Positives = 93/179 (51%), Gaps = 4/179 (2%)

Query: 18  PGLGPKSAKRIVLKLINNRDELVKPMANTLAQVYKNVIRCQSCGTLKSNSLGCNNCENSK 77
           PG+GPKSA+R+   L     E ++ +A+ L +  +++  C  C  + +++  C+ C +  
Sbjct: 17  PGIGPKSAQRLAFHLFEQPREDIERLASALLEAKRDLHVCPICFNI-TDAEKCDVCADPS 75

Query: 78  EKYNKICVVEDIADQWSIENSNIYKGYFHILGGTISSA-GQRKEDLLINSLVERVSRENI 136
                ICVVE+  D  ++E S  Y+G +H+L G +S   G   + L I  L+ RV +   
Sbjct: 76  RDQRTICVVEEPGDVIALERSGEYRGLYHVLHGVLSPMNGVGPDKLHIKPLLPRVGQGM- 134

Query: 137 EEVILATSATVEGQTTAYYIEDXXXXXXXXXXXXAQGLPVGGEIESLDDGTLYSAFKNR 195
            EVILAT  TVEG  TA Y++             A G+PVGG +E  D+ TL  A   R
Sbjct: 135 -EVILATGTTVEGDATALYLQRLLEPLGAAISRIAYGVPVGGSLEYTDEVTLGRALTGR 192


>1vddA [e.49.1] RECOMBINATION PROTEIN RECR
          Length = 199

 Score = 98.2 bits (243), Expect = 2e-23
 Identities = 61/179 (34%), Positives = 93/179 (51%), Gaps = 4/179 (2%)

Query: 18  PGLGPKSAKRIVLKLINNRDELVKPMANTLAQVYKNVIRCQSCGTLKSNSLGCNNCENSK 77
           PG+GPKSA+R+   L     E ++ +A+ L +  +++  C  C  + +++  C+ C +  
Sbjct: 18  PGIGPKSAQRLAFHLFEQPREDIERLASALLEAKRDLHVCPICFNI-TDAEKCDVCADPS 76

Query: 78  EKYNKICVVEDIADQWSIENSNIYKGYFHILGGTISSA-GQRKEDLLINSLVERVSRENI 136
                ICVVE+  D  ++E S  Y+G +H+L G +S   G   + L I  L+ RV +   
Sbjct: 77  RDQRTICVVEEPGDVIALERSGEYRGLYHVLHGVLSPMNGVGPDKLHIKPLLPRVGQGM- 135

Query: 137 EEVILATSATVEGQTTAYYIEDXXXXXXXXXXXXAQGLPVGGEIESLDDGTLYSAFKNR 195
            EVILAT  TVEG  TA Y++             A G+PVGG +E  D+ TL  A   R
Sbjct: 136 -EVILATGTTVEGDATALYLQRLLEPLGAAISRIAYGVPVGGSLEYTDEVTLGRALTGR 193


  Database: 95pdb09Oct16x
    Posted date:  Nov 2, 2009  3:15 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.324    0.141    0.416 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 818,892,213
Number of extensions: 32295812
Number of successful extensions: 83830
Number of sequences better than 1.0e-03: 1977
Number of HSP's gapped: 82197
Number of HSP's successfully gapped: 2414
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)