BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= AAZ21852.1 pubi0 ribD GIB00256CH01
"5-amino-6-(5-phosphoribosylamino)uracil reductase"
         (351 letters)

Database: 95pdb09Oct16x 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

2b3zD [x.x.x] RIBOFLAVIN BIOSYNTHESIS PROTEIN RIBD                    149   1e-38
2b3zA [x.x.x] RIBOFLAVIN BIOSYNTHESIS PROTEIN RIBD                    149   1e-38
2hxvA [x.x.x] DIAMINOHYDROXYPHOSPHORIBOSYLAMINOPYRIMIDINE              86   2e-19
2o7pA [x.x.x] RIBOFLAVIN BIOSYNTHESIS PROTEIN RIBD                     82   2e-18
2g6vA [x.x.x] RIBOFLAVIN BIOSYNTHESIS PROTEIN RIBD                     81   4e-18
2obcA [x.x.x] RIBOFLAVIN BIOSYNTHESIS PROTEIN RIBD                     79   3e-17
2g6vB [x.x.x] RIBOFLAVIN BIOSYNTHESIS PROTEIN RIBD                     78   4e-17
2obcB [x.x.x] RIBOFLAVIN BIOSYNTHESIS PROTEIN RIBD                     74   6e-16
2o7pB [x.x.x] RIBOFLAVIN BIOSYNTHESIS PROTEIN RIBD                     70   7e-15
2b3jD [x.x.x] TRNA ADENOSINE DEAMINASE                                 42   3e-06
2b3jC [x.x.x] TRNA ADENOSINE DEAMINASE                                 42   3e-06
2b3jA [x.x.x] TRNA ADENOSINE DEAMINASE                                 42   3e-06
1vq2A [c.97.1] DEOXYCYTIDYLATE DEAMINASE                               40   8e-06
3dh1D [x.x.x] TRNA-SPECIFIC ADENOSINE DEAMINASE 2                      40   1e-05
3dh1B [x.x.x] TRNA-SPECIFIC ADENOSINE DEAMINASE 2                      40   1e-05
3dh1A [x.x.x] TRNA-SPECIFIC ADENOSINE DEAMINASE 2                      40   1e-05
2w4lC [x.x.x] DEOXYCYTIDYLATE DEAMINASE                                39   2e-05
1wwrD [x.x.x] TRNA ADENOSINE DEAMINASE TADA                            39   3e-05
1wwrC [x.x.x] TRNA ADENOSINE DEAMINASE TADA                            39   3e-05
1wwrB [x.x.x] TRNA ADENOSINE DEAMINASE TADA                            39   3e-05
1wwrA [x.x.x] TRNA ADENOSINE DEAMINASE TADA                            39   3e-05
1z3aA [x.x.x] TRNA-SPECIFIC ADENOSINE DEAMINASE                        37   7e-05
2w4lD [x.x.x] DEOXYCYTIDYLATE DEAMINASE                                36   2e-04
2w4lE [x.x.x] DEOXYCYTIDYLATE DEAMINASE                                35   3e-04
2w4lB [x.x.x] DEOXYCYTIDYLATE DEAMINASE                                35   3e-04
2nx8A [x.x.x] TRNA-SPECIFIC ADENOSINE DEAMINASE                        35   3e-04
2w4lF [x.x.x] DEOXYCYTIDYLATE DEAMINASE                                34   6e-04
2w4lA [x.x.x] DEOXYCYTIDYLATE DEAMINASE                                34   6e-04
1tiyB [c.97.1] GUANINE DEAMINASE                                       34   6e-04
1tiyA [c.97.1] GUANINE DEAMINASE                                       34   6e-04
1wkqB [c.97.1] GUANINE DEAMINASE                                       34   7e-04
1wkqA [c.97.1] GUANINE DEAMINASE                                       34   7e-04

>2b3zD [x.x.x] RIBOFLAVIN BIOSYNTHESIS PROTEIN RIBD
          Length = 360

 Score =  149 bits (376), Expect = 1e-38
 Identities = 100/313 (31%), Positives = 152/313 (48%), Gaps = 5/313 (1%)

Query: 1   MELALNLAKARHGLTGINPSVGCVIVKNNKILSIGQTGFKGTPHAEFNAIKNSHENIEGS 60
           M+LAL+LAK   G T  NP VG V+VK+ +I+ +G     G  HAE +AI  +  + EG+
Sbjct: 7   MKLALDLAKQGEGQTESNPLVGAVVVKDGQIVGMGAHLKYGEAHAEVHAIHMAGAHAEGA 66

Query: 61  KMYVTLEPCSHYGKTPPCTXXXXXXXXXEVVYGVEDIDKKVKGKTLNILKSKNILVKKDL 120
            +YVTLEPCSHYGKTPPC           V   + D +  V G+ ++++K   I V++ +
Sbjct: 67  DIYVTLEPCSHYGKTPPCAELIINSGIKRVFVAMRDPNPLVAGRGISMMKEAGIEVREGI 126

Query: 121 LKKQINKFYAPYFFNRKKNLPYVTGKIAISKNNLIYSK--DTKRISDIHTDRFTHFLRYK 178
           L  Q  +    +    +  LPYVT K A S +  I +   D+K I+     +     R  
Sbjct: 127 LADQAERLNEKFLHFMRTGLPYVTLKAAASLDGKIATSTGDSKWITSEAARQDAQQYRKT 186

Query: 179 NDSLMISSKTLNKDDPKLNCRLEGLSKFSPKRIILDRNLEIKKNSYIFKTANKDNTIIFY 238
           + S+++   T+  D+P L CRL  ++K  P R+ILD  L I +++ +         I   
Sbjct: 187 HQSILVGVGTVKADNPSLTCRLPNVTK-QPVRVILDTVLSIPEDAKVICDQIAPTWIFTT 245

Query: 239 YNAKAEVKLMLKKKGITLIKSKLNKNSFDIKSILMKLYVLGCRNLLVEGGNDLSKHIIKK 298
             A  E K  L   G+ +    L      I  +L  L   G  ++ VEGG+ +    +K+
Sbjct: 246 ARADEEKKKRLSAFGVNIF--TLETERIQIPDVLKILAEEGIMSVYVEGGSAVHGSFVKE 303

Query: 299 KLFNEFYLYKCSK 311
             F E   Y   K
Sbjct: 304 GCFQEIIFYFAPK 316


>2b3zA [x.x.x] RIBOFLAVIN BIOSYNTHESIS PROTEIN RIBD
          Length = 359

 Score =  149 bits (376), Expect = 1e-38
 Identities = 100/313 (31%), Positives = 152/313 (48%), Gaps = 5/313 (1%)

Query: 1   MELALNLAKARHGLTGINPSVGCVIVKNNKILSIGQTGFKGTPHAEFNAIKNSHENIEGS 60
           M+LAL+LAK   G T  NP VG V+VK+ +I+ +G     G  HAE +AI  +  + EG+
Sbjct: 6   MKLALDLAKQGEGQTESNPLVGAVVVKDGQIVGMGAHLKYGEAHAEVHAIHMAGAHAEGA 65

Query: 61  KMYVTLEPCSHYGKTPPCTXXXXXXXXXEVVYGVEDIDKKVKGKTLNILKSKNILVKKDL 120
            +YVTLEPCSHYGKTPPC           V   + D +  V G+ ++++K   I V++ +
Sbjct: 66  DIYVTLEPCSHYGKTPPCAELIINSGIKRVFVAMRDPNPLVAGRGISMMKEAGIEVREGI 125

Query: 121 LKKQINKFYAPYFFNRKKNLPYVTGKIAISKNNLIYSK--DTKRISDIHTDRFTHFLRYK 178
           L  Q  +    +    +  LPYVT K A S +  I +   D+K I+     +     R  
Sbjct: 126 LADQAERLNEKFLHFMRTGLPYVTLKAAASLDGKIATSTGDSKWITSEAARQDAQQYRKT 185

Query: 179 NDSLMISSKTLNKDDPKLNCRLEGLSKFSPKRIILDRNLEIKKNSYIFKTANKDNTIIFY 238
           + S+++   T+  D+P L CRL  ++K  P R+ILD  L I +++ +         I   
Sbjct: 186 HQSILVGVGTVKADNPSLTCRLPNVTK-QPVRVILDTVLSIPEDAKVICDQIAPTWIFTT 244

Query: 239 YNAKAEVKLMLKKKGITLIKSKLNKNSFDIKSILMKLYVLGCRNLLVEGGNDLSKHIIKK 298
             A  E K  L   G+ +    L      I  +L  L   G  ++ VEGG+ +    +K+
Sbjct: 245 ARADEEKKKRLSAFGVNIF--TLETERIQIPDVLKILAEEGIMSVYVEGGSAVHGSFVKE 302

Query: 299 KLFNEFYLYKCSK 311
             F E   Y   K
Sbjct: 303 GCFQEIIFYFAPK 315


>2hxvA [x.x.x] DIAMINOHYDROXYPHOSPHORIBOSYLAMINOPYRIMIDINE
          Length = 344

 Score = 85.9 bits (211), Expect = 2e-19
 Identities = 82/306 (26%), Positives = 135/306 (44%), Gaps = 31/306 (10%)

Query: 4   ALNLAKARHGLTGINPSVGCVIVKNNKILSIGQTGFKGTPHAE--FNAIKNSHENIEGSK 61
           A+ LAK   G             K+ +I++ G   + G PHAE    + +   E++ G+ 
Sbjct: 11  AIELAKKGLGRXXXXXXXXXXXXKDGRIIAEGFHPYFGGPHAERAIESARKKGEDLRGAT 70

Query: 62  MYVTLEPCSHYGKTPPCTXXXXXXXXXEVVYGVEDIDKKVKGKTLNILKSKNILVKKDLL 121
           + VTLEPC H+GKTPPCT          VV G  D    V G  +   ++          
Sbjct: 71  LIVTLEPCDHHGKTPPCTDLIIESGIKTVVIGTRD-PNPVSGNGVEKFRNHXXXXXXXXX 129

Query: 122 KKQINKFYAPYFFNRKKNLPYVTGKIAISKNNLI--YSKDTKRISDIHTDRFTHFLRYKN 179
                     +     K  P+V  K A + +  I  +  D+K I+D    RF    R   
Sbjct: 130 XXXXXXXCEFFITYVTKKRPFVALKYASTLDGKIADHRGDSKWITD--KLRFKVHERNIY 187

Query: 180 DSLMISSKTLNKDDPKLNCRLEGLSKFSPKRIILDRNLEIKKNSYIFKTANKD-NTIIFY 238
            ++++ + T+ KD+P+L CRL+     +P R+ILDR   +  +  +F+   ++   I+F 
Sbjct: 188 SAVLVGAGTVLKDNPQLTCRLK--EGRNPVRVILDRKGVL--SGKVFRVFEENARVIVFT 243

Query: 239 YNAKAEVKLMLKKKGITLIKSKLNKNSFDIKSILMKLYVLGCRNLLVEGGNDLSKHIIKK 298
            + +AE    ++K            +   ++SIL  LY     ++LVEGG+         
Sbjct: 244 ESEEAEYPPHVEKA----------LSDCSVESILRNLYERDIDSVLVEGGS--------- 284

Query: 299 KLFNEF 304
           K+F+EF
Sbjct: 285 KVFSEF 290


>2o7pA [x.x.x] RIBOFLAVIN BIOSYNTHESIS PROTEIN RIBD
          Length = 349

 Score = 82.0 bits (201), Expect = 2e-18
 Identities = 66/204 (32%), Positives = 98/204 (48%), Gaps = 15/204 (7%)

Query: 4   ALNLAKARHGLTGINPSVGCVIVKNNKILSIGQTGFKGTPHAEFNAIKNSHENIEGSKMY 63
           AL LA+     T  NP+VGCVIVK+ +I+  G     G PHAE +A++ + E  +G+  Y
Sbjct: 14  ALKLAQRGRFTTHPNPNVGCVIVKDGEIVGEGYHQRAGEPHAEVHALR-AGEKAKGATAY 72

Query: 64  VTLEPCSHYGKTPPCTXXXXXXXXXEVVYGVEDIDKKVKGKTLNILKSKNILVKKDLLK- 122
           VTLEPC      PPC           VV   +    +V G+ L  L+   I V   L + 
Sbjct: 73  VTLEPC------PPCCDALIAAGVARVVASQD--PNQVAGRGLYRLQQAGIDVSHGLSEA 124

Query: 123 KQINKFYAPYFFNRKKNLPYVTGKIAIS-KNNLIYSKDTKRISDIHTDRFTHFLRYKNDS 181
           +Q+NK     F  R+   PY+  K+  S       S +++ I+     R    LR ++ +
Sbjct: 125 EQLNK----GFLKRRTGFPYIQLKLGASLDGRTAASGESQWITSPQARRDVQLLRAQSHA 180

Query: 182 LMISSKTLNKDDPKLNCRLEGLSK 205
           ++ SS T+  DDP L  R   L +
Sbjct: 181 ILTSSATVLADDPALTVRWSELDE 204


>2g6vA [x.x.x] RIBOFLAVIN BIOSYNTHESIS PROTEIN RIBD
          Length = 346

 Score = 81.3 bits (199), Expect = 4e-18
 Identities = 65/203 (32%), Positives = 100/203 (49%), Gaps = 16/203 (7%)

Query: 4   ALNLAKARHGLTGINPSVGCVIVKNNKILSIGQTGFKGTPHAEFNAIKNSHENIEGSKMY 63
           AL LA+     T  NP+VGCVIVK+ +I+  G     G PHAE +A++ + E  +G+  Y
Sbjct: 14  ALKLAQRGRFTTHPNPNVGCVIVKDGEIVGEGYHQRAGEPHAEVHALR-AGEKAKGATAY 72

Query: 64  VTLEPCSHYGKTPPCTXXXXXXXXXEVVYGVEDIDKKVKGKTLNILKSKNILVKKDLLK- 122
           VTLEPC       PC           VV   +D + +V G+ L  L+   I V   L + 
Sbjct: 73  VTLEPC-------PCCDALIAAGVARVV-ASQDPNPQVAGRGLYRLQQAGIDVSHGLSEA 124

Query: 123 KQINKFYAPYFFNRKKNLPYVTGKIAISKNNLIYSKDTKRISDIHTDRFTHFLRYKNDSL 182
           +Q+NK     F  R+   PY+  K+  S +    + +++ I+     R    LR ++ ++
Sbjct: 125 EQLNK----GFLKRRTGFPYIQLKLGASLDG--RTAESQWITSPQARRDVQLLRAQSHAI 178

Query: 183 MISSKTLNKDDPKLNCRLEGLSK 205
           + SS T+  DDP L  R   L +
Sbjct: 179 LTSSATVLADDPALTVRWSELDE 201


>2obcA [x.x.x] RIBOFLAVIN BIOSYNTHESIS PROTEIN RIBD
          Length = 345

 Score = 78.6 bits (192), Expect = 3e-17
 Identities = 64/203 (31%), Positives = 98/203 (48%), Gaps = 17/203 (8%)

Query: 4   ALNLAKARHGLTGINPSVGCVIVKNNKILSIGQTGFKGTPHAEFNAIKNSHENIEGSKMY 63
           AL LA+     T  NP+VGCVIVK+ +I+  G     G PHAE +A++ + E  +G+  Y
Sbjct: 14  ALKLAQRGRFTTHPNPNVGCVIVKDGEIVGEGYHQRAGEPHAEVHALR-AGEKAKGATAY 72

Query: 64  VTLEPCSHYGKTPPCTXXXXXXXXXEVVYGVEDIDKKVKGKTLNILKSKNILVKKDLLK- 122
           VTLEPC       PC           VV   +    +V G+ L  L+   I V   L + 
Sbjct: 73  VTLEPC-------PCCDALIAAGVARVVASQD--PNQVAGRGLYRLQQAGIDVSHGLSEA 123

Query: 123 KQINKFYAPYFFNRKKNLPYVTGKIAISKNNLIYSKDTKRISDIHTDRFTHFLRYKNDSL 182
           +Q+NK     F  R+   PY+  K+  S +    + +++ I+     R    LR ++ ++
Sbjct: 124 EQLNK----GFLKRRTGFPYIQLKLGASLDG--RTAESQWITSPQARRDVQLLRAQSHAI 177

Query: 183 MISSKTLNKDDPKLNCRLEGLSK 205
           + SS T+  DDP L  R   L +
Sbjct: 178 LTSSATVLADDPALTVRWSELDE 200


>2g6vB [x.x.x] RIBOFLAVIN BIOSYNTHESIS PROTEIN RIBD
          Length = 354

 Score = 77.8 bits (190), Expect = 4e-17
 Identities = 64/204 (31%), Positives = 97/204 (47%), Gaps = 17/204 (8%)

Query: 4   ALNLAKARHGLTGINPSVGCVIVKNNKILSIGQTGFKGTPHAEFNAIKNSHENIEGSKMY 63
           AL LA+     T  NP+VGCVIVK+ +I+  G     G PHAE +A++ + E  +G+  Y
Sbjct: 14  ALKLAQRGRFTTHPNPNVGCVIVKDGEIVGEGYHQRAGEPHAEVHALR-AGEKAKGATAY 72

Query: 64  VTLEPCSHYGKTPPCTXXXXXXXXXEVVYGVEDIDKKVKGKTLNILKSKNILVKKDLLK- 122
           VTLEPCS                    V   +D + +V G+ L  L+   I V   L + 
Sbjct: 73  VTLEPCS----------DALIAAGVARVVASQDPNPQVAGRGLYRLQQAGIDVSHGLSEA 122

Query: 123 KQINKFYAPYFFNRKKNLPYVTGKIAIS-KNNLIYSKDTKRISDIHTDRFTHFLRYKNDS 181
           +Q+NK     F  R+   PY+  K+  S       S +++ I+     R    LR ++ +
Sbjct: 123 EQLNK----GFLKRRTGFPYIQLKLGASLDGRTAASGESQWITSPQARRDVQLLRAQSHA 178

Query: 182 LMISSKTLNKDDPKLNCRLEGLSK 205
           ++ SS T+  DDP L  R   L +
Sbjct: 179 ILTSSATVLADDPALTVRWSELDE 202


>2obcB [x.x.x] RIBOFLAVIN BIOSYNTHESIS PROTEIN RIBD
          Length = 353

 Score = 73.9 bits (180), Expect = 6e-16
 Identities = 64/204 (31%), Positives = 96/204 (47%), Gaps = 18/204 (8%)

Query: 4   ALNLAKARHGLTGINPSVGCVIVKNNKILSIGQTGFKGTPHAEFNAIKNSHENIEGSKMY 63
           AL LA+     T  NP+VGCVIVK+ +I+  G     G PHAE +A++ + E  +G+  Y
Sbjct: 14  ALKLAQRGRFTTHPNPNVGCVIVKDGEIVGEGYHQRAGEPHAEVHALR-AGEKAKGATAY 72

Query: 64  VTLEPCSHYGKTPPCTXXXXXXXXXEVVYGVEDIDKKVKGKTLNILKSKNILVKKDLLK- 122
           VTLEPCS                   VV   +    +V G+ L  L+   I V   L + 
Sbjct: 73  VTLEPCS---------DALIAAGVARVVASQD--PNQVAGRGLYRLQQAGIDVSHGLSEA 121

Query: 123 KQINKFYAPYFFNRKKNLPYVTGKIAIS-KNNLIYSKDTKRISDIHTDRFTHFLRYKNDS 181
           +Q+NK     F  R+   PY+  K+  S       S +++ I+     R    LR ++ +
Sbjct: 122 EQLNK----GFLKRRTGFPYIQLKLGASLDGRTAASGESQWITSPQARRDVQLLRAQSHA 177

Query: 182 LMISSKTLNKDDPKLNCRLEGLSK 205
           ++ SS T+  DDP L  R   L +
Sbjct: 178 ILTSSATVLADDPALTVRWSELDE 201


>2o7pB [x.x.x] RIBOFLAVIN BIOSYNTHESIS PROTEIN RIBD
          Length = 345

 Score = 70.5 bits (171), Expect = 7e-15
 Identities = 62/203 (30%), Positives = 93/203 (45%), Gaps = 24/203 (11%)

Query: 4   ALNLAKARHGLTGINPSVGCVIVKNNKILSIGQTGFKGTPHAEFNAIKNSHENIEGSKMY 63
           AL LA+     T  NP+VGCVIVK+ +I+  G     G PHAE +A++ + E  +G+  Y
Sbjct: 14  ALKLAQRGRFTTHPNPNVGCVIVKDGEIVGEGYHQRAGEPHAEVHALR-AGEKAKGATAY 72

Query: 64  VTLEPCSHYGKTPPCTXXXXXXXXXEVVYGVEDIDKKVKGKTLNILKSKNILVKKDLLK- 122
           VTLEPC                    VV   +    +V G+ L  L+   I V   L + 
Sbjct: 73  VTLEPCD----------ALIAAGVARVVASQD--PNQVAGRGLYRLQQAGIDVSHGLSEA 120

Query: 123 KQINKFYAPYFFNRKKNLPYVTGKIAISKNNLIYSKDTKRISDIHTDRFTHFLRYKNDSL 182
           +Q+NK     F  R+   PY+  K+  S +   +      I+     R    LR ++ ++
Sbjct: 121 EQLNK----GFLKRRTGFPYIQLKLGASLDGRTW------ITSPQARRDVQLLRAQSHAI 170

Query: 183 MISSKTLNKDDPKLNCRLEGLSK 205
           + SS T+  DDP L  R   L +
Sbjct: 171 LTSSATVLADDPALTVRWSELDE 193


>2b3jD [x.x.x] TRNA ADENOSINE DEAMINASE
          Length = 150

 Score = 42.0 bits (97), Expect = 3e-06
 Identities = 26/87 (29%), Positives = 38/87 (43%), Gaps = 10/87 (11%)

Query: 57  IEGSKMYVTLEPCSHYGKTPPCTXXXXXXXXXEVVYGVEDIDKKVKGKTLNILKSKNI-- 114
           +EG  +YVTLEPC        C           VVYG +D      G  +N+L+  N   
Sbjct: 69  LEGCTLYVTLEPC------VMCAGTIVMSRIPRVVYGADDPKGGCSGSLMNLLQQSNFNH 122

Query: 115 --LVKKDLLKKQINKFYAPYFFNRKKN 139
             +V K +LK+  +     +F N + N
Sbjct: 123 RAIVDKGVLKEACSTLLTTFFKNLRAN 149


>2b3jC [x.x.x] TRNA ADENOSINE DEAMINASE
          Length = 152

 Score = 42.0 bits (97), Expect = 3e-06
 Identities = 26/87 (29%), Positives = 38/87 (43%), Gaps = 10/87 (11%)

Query: 57  IEGSKMYVTLEPCSHYGKTPPCTXXXXXXXXXEVVYGVEDIDKKVKGKTLNILKSKNI-- 114
           +EG  +YVTLEPC        C           VVYG +D      G  +N+L+  N   
Sbjct: 71  LEGCTLYVTLEPC------VMCAGTIVMSRIPRVVYGADDPKGGCSGSLMNLLQQSNFNH 124

Query: 115 --LVKKDLLKKQINKFYAPYFFNRKKN 139
             +V K +LK+  +     +F N + N
Sbjct: 125 RAIVDKGVLKEACSTLLTTFFKNLRAN 151


>2b3jA [x.x.x] TRNA ADENOSINE DEAMINASE
          Length = 151

 Score = 42.0 bits (97), Expect = 3e-06
 Identities = 26/87 (29%), Positives = 38/87 (43%), Gaps = 10/87 (11%)

Query: 57  IEGSKMYVTLEPCSHYGKTPPCTXXXXXXXXXEVVYGVEDIDKKVKGKTLNILKSKNI-- 114
           +EG  +YVTLEPC        C           VVYG +D      G  +N+L+  N   
Sbjct: 71  LEGCTLYVTLEPC------VMCAGTIVMSRIPRVVYGADDPKGGCSGSLMNLLQQSNFNH 124

Query: 115 --LVKKDLLKKQINKFYAPYFFNRKKN 139
             +V K +LK+  +     +F N + N
Sbjct: 125 RAIVDKGVLKEACSTLLTTFFKNLRAN 151


>1vq2A [c.97.1] DEOXYCYTIDYLATE DEAMINASE
          Length = 173

 Score = 40.4 bits (93), Expect = 8e-06
 Identities = 46/150 (30%), Positives = 60/150 (40%), Gaps = 55/150 (36%)

Query: 21  VGCVIVKNNKILSIGQTGFKGTP------------------------------------- 43
           VG VI KN +I+S   TG+ G+P                                     
Sbjct: 24  VGAVIEKNGRIIS---TGYNGSPAGGVNCCDYAAEQGWLLNKRFVLAKEHRSAHSEWSSK 80

Query: 44  ---HAEFNAIKNSHEN---IEGSKMYVTLEPCSHYGKTPPCTXXXXXXXXXEVVYGVEDI 97
              HAE NAI  + EN   IEG+ MYVTL PC      P C          ++VY  E  
Sbjct: 81  NEIHAELNAILFAAENGSSIEGATMYVTLSPC------PDCAKAIAQSGIKKLVY-CETY 133

Query: 98  DKKVKGKTLNILKSKNILVKKDLLKKQINK 127
           DK   G   +IL++  I V  ++ KK +NK
Sbjct: 134 DKNKPGWD-DILRNAGIEV-FNVPKKNLNK 161


>3dh1D [x.x.x] TRNA-SPECIFIC ADENOSINE DEAMINASE 2
          Length = 161

 Score = 39.7 bits (91), Expect = 1e-05
 Identities = 37/123 (30%), Positives = 52/123 (42%), Gaps = 23/123 (18%)

Query: 1   MELALNLAKARHGLTGINPSVGCVIVKNNKILSIGQTGF----KGTPHAEFNAI------ 50
           ME A+++AK    L      VGC++V NN+++  G+         T HAE  AI      
Sbjct: 14  MEEAMHMAK--EALENTEVPVGCLMVYNNEVVGKGRNEVNQTKNATRHAEMVAIDQVLDW 71

Query: 51  -----KNSHENIEGSKMYVTLEPCSHYGKTPPCTXXXXXXXXXEVVYGVEDIDKKVKGKT 105
                K+  E  E + +YVT+EPC        C           VVYG ++      G  
Sbjct: 72  CRQSGKSPSEVFEHTVLYVTVEPCI------MCAAALRLMKIPLVVYGCQNERFGGCGSV 125

Query: 106 LNI 108
           LNI
Sbjct: 126 LNI 128


>3dh1B [x.x.x] TRNA-SPECIFIC ADENOSINE DEAMINASE 2
          Length = 160

 Score = 39.7 bits (91), Expect = 1e-05
 Identities = 37/123 (30%), Positives = 52/123 (42%), Gaps = 23/123 (18%)

Query: 1   MELALNLAKARHGLTGINPSVGCVIVKNNKILSIGQTGF----KGTPHAEFNAI------ 50
           ME A+++AK    L      VGC++V NN+++  G+         T HAE  AI      
Sbjct: 14  MEEAMHMAK--EALENTEVPVGCLMVYNNEVVGKGRNEVNQTKNATRHAEMVAIDQVLDW 71

Query: 51  -----KNSHENIEGSKMYVTLEPCSHYGKTPPCTXXXXXXXXXEVVYGVEDIDKKVKGKT 105
                K+  E  E + +YVT+EPC        C           VVYG ++      G  
Sbjct: 72  CRQSGKSPSEVFEHTVLYVTVEPCI------MCAAALRLMKIPLVVYGCQNERFGGCGSV 125

Query: 106 LNI 108
           LNI
Sbjct: 126 LNI 128


>3dh1A [x.x.x] TRNA-SPECIFIC ADENOSINE DEAMINASE 2
          Length = 162

 Score = 39.7 bits (91), Expect = 1e-05
 Identities = 37/123 (30%), Positives = 52/123 (42%), Gaps = 23/123 (18%)

Query: 1   MELALNLAKARHGLTGINPSVGCVIVKNNKILSIGQTGF----KGTPHAEFNAI------ 50
           ME A+++AK    L      VGC++V NN+++  G+         T HAE  AI      
Sbjct: 15  MEEAMHMAK--EALENTEVPVGCLMVYNNEVVGKGRNEVNQTKNATRHAEMVAIDQVLDW 72

Query: 51  -----KNSHENIEGSKMYVTLEPCSHYGKTPPCTXXXXXXXXXEVVYGVEDIDKKVKGKT 105
                K+  E  E + +YVT+EPC        C           VVYG ++      G  
Sbjct: 73  CRQSGKSPSEVFEHTVLYVTVEPCI------MCAAALRLMKIPLVVYGCQNERFGGCGSV 126

Query: 106 LNI 108
           LNI
Sbjct: 127 LNI 129


>2w4lC [x.x.x] DEOXYCYTIDYLATE DEAMINASE
          Length = 142

 Score = 38.9 bits (89), Expect = 2e-05
 Identities = 25/68 (36%), Positives = 31/68 (45%), Gaps = 14/68 (20%)

Query: 18 NPSVG-CVIVKNNKILSIGQTGFKG----------TPHAEFNAIKNSHENIEGSKMYVTL 66
          N  VG C++   NKI+ IG  G               HAE NAI N    ++G  MYV L
Sbjct: 24 NSQVGACIVNSENKIVGIGYNGMPNGCSDDVLPPYVCHAELNAIMNK---VKGCSMYVAL 80

Query: 67 EPCSHYGK 74
           PC+   K
Sbjct: 81 FPCNECAK 88


>1wwrD [x.x.x] TRNA ADENOSINE DEAMINASE TADA
          Length = 151

 Score = 38.5 bits (88), Expect = 3e-05
 Identities = 26/76 (34%), Positives = 37/76 (48%), Gaps = 9/76 (11%)

Query: 3  LALNLAKARHGLTGINPSVGCVIVKNNKILSIGQTGFKG----TPHAEFNAIKNSHENI- 57
          L + L +A+         VG +IVK  +I+S      +     T HAE  AIK +   + 
Sbjct: 7  LKVALREAKRAFEKGEVPVGAIIVKEGEIISKAHNSVEELKDPTAHAEMLAIKEACRRLN 66

Query: 58 ----EGSKMYVTLEPC 69
              EG ++YVTLEPC
Sbjct: 67 TKYLEGCELYVTLEPC 82


>1wwrC [x.x.x] TRNA ADENOSINE DEAMINASE TADA
          Length = 160

 Score = 38.5 bits (88), Expect = 3e-05
 Identities = 26/76 (34%), Positives = 37/76 (48%), Gaps = 9/76 (11%)

Query: 3  LALNLAKARHGLTGINPSVGCVIVKNNKILSIGQTGFKG----TPHAEFNAIKNSHENI- 57
          L + L +A+         VG +IVK  +I+S      +     T HAE  AIK +   + 
Sbjct: 16 LKVALREAKRAFEKGEVPVGAIIVKEGEIISKAHNSVEELKDPTAHAEMLAIKEACRRLN 75

Query: 58 ----EGSKMYVTLEPC 69
              EG ++YVTLEPC
Sbjct: 76 TKYLEGCELYVTLEPC 91


>1wwrB [x.x.x] TRNA ADENOSINE DEAMINASE TADA
          Length = 157

 Score = 38.5 bits (88), Expect = 3e-05
 Identities = 26/76 (34%), Positives = 37/76 (48%), Gaps = 9/76 (11%)

Query: 3  LALNLAKARHGLTGINPSVGCVIVKNNKILSIGQTGFKG----TPHAEFNAIKNSHENI- 57
          L + L +A+         VG +IVK  +I+S      +     T HAE  AIK +   + 
Sbjct: 15 LKVALREAKRAFEKGEVPVGAIIVKEGEIISKAHNSVEELKDPTAHAEMLAIKEACRRLN 74

Query: 58 ----EGSKMYVTLEPC 69
              EG ++YVTLEPC
Sbjct: 75 TKYLEGCELYVTLEPC 90


>1wwrA [x.x.x] TRNA ADENOSINE DEAMINASE TADA
          Length = 154

 Score = 38.5 bits (88), Expect = 3e-05
 Identities = 26/76 (34%), Positives = 37/76 (48%), Gaps = 9/76 (11%)

Query: 3  LALNLAKARHGLTGINPSVGCVIVKNNKILSIGQTGFKG----TPHAEFNAIKNSHENI- 57
          L + L +A+         VG +IVK  +I+S      +     T HAE  AIK +   + 
Sbjct: 10 LKVALREAKRAFEKGEVPVGAIIVKEGEIISKAHNSVEELKDPTAHAEMLAIKEACRRLN 69

Query: 58 ----EGSKMYVTLEPC 69
              EG ++YVTLEPC
Sbjct: 70 TKYLEGCELYVTLEPC 85


>1z3aA [x.x.x] TRNA-SPECIFIC ADENOSINE DEAMINASE
          Length = 156

 Score = 37.4 bits (85), Expect = 7e-05
 Identities = 36/153 (23%), Positives = 62/153 (40%), Gaps = 21/153 (13%)

Query: 1   MELALNLAKARHGLTGINPSVGCVIVKNNKILSIGQTGFKG----TPHAEFNAIKNS--- 53
           M  AL LAK       +   VG V+V NN+++  G     G    T HAE  A++     
Sbjct: 11  MRHALTLAKRAWDEREV--PVGAVLVHNNRVIGEGWNRPIGRHDPTAHAEIMALRQGGLV 68

Query: 54  --HENIEGSKMYVTLEPCSHYGKTPPCTXXXXXXXXXEVVYGVEDIDKKVKGKTLNIL-- 109
             +  +  + +YVTLEPC        C           VV+G  D      G  +++L  
Sbjct: 69  MQNYRLIDATLYVTLEPC------VMCAGAMIHSRIGRVVFGARDAKTGAAGSLMDVLHH 122

Query: 110 --KSKNILVKKDLLKKQINKFYAPYFFNRKKNL 140
              +  + + + +L  +     + +F  R++ +
Sbjct: 123 PGMNHRVEITEGILADECAALLSDFFRMRRQEI 155


>2w4lD [x.x.x] DEOXYCYTIDYLATE DEAMINASE
          Length = 150

 Score = 35.8 bits (81), Expect = 2e-04
 Identities = 25/76 (32%), Positives = 31/76 (40%), Gaps = 22/76 (28%)

Query: 18 NPSVG-CVIVKNNKILSIGQTGFKG------------------TPHAEFNAIKNSHENIE 58
          N  VG C++   NKI+ IG  G                       HAE NAI N    ++
Sbjct: 24 NSQVGACIVNSENKIVGIGYNGMPNGCVLPWRRTAENKTKYPYVCHAELNAIMNK---VK 80

Query: 59 GSKMYVTLEPCSHYGK 74
          G  MYV L PC+   K
Sbjct: 81 GCSMYVALFPCNECAK 96


>2w4lE [x.x.x] DEOXYCYTIDYLATE DEAMINASE
          Length = 162

 Score = 35.0 bits (79), Expect = 3e-04
 Identities = 25/82 (30%), Positives = 33/82 (40%), Gaps = 25/82 (30%)

Query: 18  NPSVG-CVIVKNNKILSIGQTGFKG-----------------------TPHAEFNAIKNS 53
           N  VG C++   NKI+ IG  G                            HAE NAI N 
Sbjct: 23  NSQVGACIVNSENKIVGIGYNGMPNGCSDDVLPWRRTAENKLDTKYPYVCHAELNAIMNK 82

Query: 54  H-ENIEGSKMYVTLEPCSHYGK 74
           +  +++G  MYV L PC+   K
Sbjct: 83  NLTDVKGCSMYVALFPCNECAK 104


>2w4lB [x.x.x] DEOXYCYTIDYLATE DEAMINASE
          Length = 157

 Score = 35.0 bits (79), Expect = 3e-04
 Identities = 25/81 (30%), Positives = 33/81 (40%), Gaps = 26/81 (32%)

Query: 18  NPSVG-CVIVKNNKILSIGQTGFKG-----------------------TPHAEFNAIKNS 53
           N  VG C++   NKI+ IG  G                            HAE NAI N 
Sbjct: 24  NSQVGACIVNSENKIVGIGYNGMPNGCSDDVLPWRRTAENKLDTKYPYVCHAELNAIMN- 82

Query: 54  HENIEGSKMYVTLEPCSHYGK 74
            ++++G  MYV L PC+   K
Sbjct: 83  -KDVKGCSMYVALFPCNECAK 102


>2nx8A [x.x.x] TRNA-SPECIFIC ADENOSINE DEAMINASE
          Length = 168

 Score = 35.0 bits (79), Expect = 3e-04
 Identities = 25/85 (29%), Positives = 40/85 (47%), Gaps = 15/85 (17%)

Query: 21  VGCVIVKNNKILSIG----QTGFKGTPHAEFNAIK--NSHE---NIEGSKMYVTLEPCSH 71
           +GCVIVK+ +I+  G    +   +   HAE  AI   N+HE    +  + ++VT+EPC  
Sbjct: 33  IGCVIVKDGEIIGRGHNAREESNQAIMHAEMMAINEANAHEGNWRLLDTTLFVTIEPC-- 90

Query: 72  YGKTPPCTXXXXXXXXXEVVYGVED 96
                 C+          V+YG  +
Sbjct: 91  ----VMCSGAIGLARIPHVIYGASN 111


>2w4lF [x.x.x] DEOXYCYTIDYLATE DEAMINASE
          Length = 159

 Score = 34.3 bits (77), Expect = 6e-04
 Identities = 25/81 (30%), Positives = 32/81 (39%), Gaps = 27/81 (33%)

Query: 18  NPSVG-CVIVKNNKILSIGQTGFKG-----------------------TPHAEFNAIKNS 53
           N  VG C++   NKI+ IG  G                            HAE NAI N 
Sbjct: 27  NSQVGACIVNSENKIVGIGYNGMPNGCSDDVLPWRRTAENKLDTKYPYVCHAELNAIMN- 85

Query: 54  HENIEGSKMYVTLEPCSHYGK 74
             +++G  MYV L PC+   K
Sbjct: 86  --DVKGCSMYVALFPCNECAK 104


>2w4lA [x.x.x] DEOXYCYTIDYLATE DEAMINASE
          Length = 160

 Score = 34.3 bits (77), Expect = 6e-04
 Identities = 25/81 (30%), Positives = 32/81 (39%), Gaps = 27/81 (33%)

Query: 18  NPSVG-CVIVKNNKILSIGQTGFKG-----------------------TPHAEFNAIKNS 53
           N  VG C++   NKI+ IG  G                            HAE NAI N 
Sbjct: 29  NSQVGACIVNSENKIVGIGYNGMPNGCSDDVLPWRRTAENKLDTKYPYVCHAELNAIMN- 87

Query: 54  HENIEGSKMYVTLEPCSHYGK 74
             +++G  MYV L PC+   K
Sbjct: 88  --DVKGCSMYVALFPCNECAK 106


>1tiyB [c.97.1] GUANINE DEAMINASE
          Length = 148

 Score = 34.3 bits (77), Expect = 6e-04
 Identities = 28/97 (28%), Positives = 38/97 (39%), Gaps = 16/97 (16%)

Query: 16  GINPSVGCVIVKNNKILSIGQ----TGFKGTPHAEFNAIKNSHE-----NIEGSKMYVTL 66
           GI    G VIVK+  I++ GQ    T    T HAE  AI+ + +      ++   +Y + 
Sbjct: 20  GIGGPFGAVIVKDGAIIAEGQNNVTTSNDPTAHAEVTAIRKACKVLGAYQLDDCILYTSC 79

Query: 67  EPCSHYGKTPPCTXXXXXXXXXEVVYGVEDIDKKVKG 103
           EPC       PC           V Y  E  D    G
Sbjct: 80  EPC-------PCLGAIYWARPKAVFYAAEHTDAAEAG 109


>1tiyA [c.97.1] GUANINE DEAMINASE
          Length = 155

 Score = 34.3 bits (77), Expect = 6e-04
 Identities = 28/97 (28%), Positives = 38/97 (39%), Gaps = 16/97 (16%)

Query: 16  GINPSVGCVIVKNNKILSIGQ----TGFKGTPHAEFNAIKNSHE-----NIEGSKMYVTL 66
           GI    G VIVK+  I++ GQ    T    T HAE  AI+ + +      ++   +Y + 
Sbjct: 20  GIGGPFGAVIVKDGAIIAEGQNNVTTSNDPTAHAEVTAIRKACKVLGAYQLDDCILYTSC 79

Query: 67  EPCSHYGKTPPCTXXXXXXXXXEVVYGVEDIDKKVKG 103
           EPC       PC           V Y  E  D    G
Sbjct: 80  EPC-------PCLGAIYWARPKAVFYAAEHTDAAEAG 109


>1wkqB [c.97.1] GUANINE DEAMINASE
          Length = 155

 Score = 33.9 bits (76), Expect = 7e-04
 Identities = 28/97 (28%), Positives = 38/97 (39%), Gaps = 15/97 (15%)

Query: 16  GINPSVGCVIVKNNKILSIGQ----TGFKGTPHAEFNAIKNSHE-----NIEGSKMYVTL 66
           GI    G VIVK+  I++ GQ    T    T HAE  AI+ + +      ++   +Y + 
Sbjct: 20  GIGGPFGAVIVKDGAIIAEGQNNVTTSNDPTAHAEVTAIRKACKVLGAYQLDDCILYTSC 79

Query: 67  EPCSHYGKTPPCTXXXXXXXXXEVVYGVEDIDKKVKG 103
           EPC      P C           V Y  E  D    G
Sbjct: 80  EPC------PMCLGAIYWARPKAVFYAAEHTDAAEAG 110


>1wkqA [c.97.1] GUANINE DEAMINASE
          Length = 158

 Score = 33.9 bits (76), Expect = 7e-04
 Identities = 28/97 (28%), Positives = 38/97 (39%), Gaps = 15/97 (15%)

Query: 16  GINPSVGCVIVKNNKILSIGQ----TGFKGTPHAEFNAIKNSHE-----NIEGSKMYVTL 66
           GI    G VIVK+  I++ GQ    T    T HAE  AI+ + +      ++   +Y + 
Sbjct: 23  GIGGPFGAVIVKDGAIIAEGQNNVTTSNDPTAHAEVTAIRKACKVLGAYQLDDCILYTSC 82

Query: 67  EPCSHYGKTPPCTXXXXXXXXXEVVYGVEDIDKKVKG 103
           EPC      P C           V Y  E  D    G
Sbjct: 83  EPC------PMCLGAIYWARPKAVFYAAEHTDAAEAG 113


  Database: 95pdb09Oct16x
    Posted date:  Nov 2, 2009  3:15 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.325    0.142    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 788,092,905
Number of extensions: 31691792
Number of successful extensions: 77122
Number of sequences better than 1.0e-03: 1441
Number of HSP's gapped: 75845
Number of HSP's successfully gapped: 1564
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)