BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= AAZ21946.1 pubi0 grlA GIB00256CH01 "Glutaredoxin"
         (110 letters)

Database: 95pdb09Oct16x 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

2wemC [x.x.x] GLUTAREDOXIN-RELATED PROTEIN 5                          102   4e-25
2wemA [x.x.x] GLUTAREDOXIN-RELATED PROTEIN 5                          102   4e-25
1wikA [c.47.1] THIOREDOXIN-LIKE PROTEIN 2                              93   4e-22
1ykaA [x.x.x] MONOTHIOL GLUTAREDOXIN YDHD                              92   5e-22
2wciB [x.x.x] GLUTAREDOXIN-4                                           92   5e-22
2wciA [x.x.x] GLUTAREDOXIN-4                                           92   5e-22
1z7pA [x.x.x] GLUTAREDOXIN                                             47   3e-08
2e7pC [x.x.x] GLUTAREDOXIN                                             47   3e-08
2e7pB [x.x.x] GLUTAREDOXIN                                             47   3e-08
2e7pD [x.x.x] GLUTAREDOXIN                                             46   4e-08
2e7pA [x.x.x] GLUTAREDOXIN                                             46   4e-08
3h8qB [x.x.x] THIOREDOXIN REDUCTASE 3                                  44   2e-07
3h8qA [x.x.x] THIOREDOXIN REDUCTASE 3                                  44   2e-07
3h4kA [x.x.x] THIOREDOXIN GLUTATHIONE REDUCTASE                        42   1e-06
2v6oA [x.x.x] THIOREDOXIN GLUTATHIONE REDUCTASE                        41   2e-06
1kteA [x.x.x] THIOLTRANSFERASE                                         41   2e-06
3fz9A [x.x.x] GLUTAREDOXIN                                             40   2e-06
2ht9B [x.x.x] GLUTAREDOXIN-2                                           39   5e-06
2ht9A [x.x.x] GLUTAREDOXIN-2                                           39   5e-06
2flsA [x.x.x] GLUTAREDOXIN-2                                           39   5e-06
2cq9A [x.x.x] GLRX2 PROTEIN                                            39   5e-06
3d5jB [x.x.x] GLUTAREDOXIN-2, MITOCHONDRIAL                            39   7e-06
3d5jA [x.x.x] GLUTAREDOXIN-2, MITOCHONDRIAL                            39   7e-06
3d4mA [x.x.x] GLUTAREDOXIN-2, MITOCHONDRIAL                            38   1e-05
3ctgA [x.x.x] GLUTAREDOXIN-2                                           38   1e-05
2klxA [x.x.x] GLUTAREDOXIN                                             38   2e-05
1jhbA [x.x.x] GLUTAREDOXIN                                             37   3e-05
2khpA [x.x.x] GLUTAREDOXIN                                             35   1e-04
1nm3B [c.47.1 - c.47.1] PROTEIN HI0572                                 34   2e-04
1nm3A [c.47.1 - c.47.1] PROTEIN HI0572                                 33   4e-04
2hzfB [x.x.x] GLUTAREDOXIN-1                                           33   4e-04
2hzeA [x.x.x] GLUTAREDOXIN-1                                           33   4e-04
2hzeB [x.x.x] GLUTAREDOXIN-1                                           33   5e-04
3c1sA [x.x.x] GLUTAREDOXIN-1                                           33   5e-04
3c1rA [x.x.x] GLUTAREDOXIN-1                                           33   5e-04
2jadA [x.x.x] YELLOW FLUORESCENT PROTEIN GLUTAREDOXIN FUSION           32   7e-04
2jacA [x.x.x] GLUTAREDOXIN-1                                           32   7e-04
3dp7B [x.x.x] SAM-DEPENDENT METHYLTRANSFERASE                          32   7e-04
3dp7A [x.x.x] SAM-DEPENDENT METHYLTRANSFERASE                          32   7e-04
1b4qA [c.47.1] PROTEIN (HUMAN THIOLTRANSFERASE)                        32   7e-04

>2wemC [x.x.x] GLUTAREDOXIN-RELATED PROTEIN 5
          Length = 109

 Score =  102 bits (255), Expect = 4e-25
 Identities = 47/85 (55%), Positives = 66/85 (77%), Gaps = 1/85 (1%)

Query: 24  GTPDAPQCGFSMAVSNMLKILEV-NYKGINVLESQSLREGIKEFSDWPTIPQVYIKGEFV 82
           GTP+ PQCGFS AV  +L++  V +Y   NVL+   LR+GIK++S+WPTIPQVY+ GEFV
Sbjct: 21  GTPEQPQCGFSNAVVQILRLHGVRDYAAYNVLDDPELRQGIKDYSNWPTIPQVYLNGEFV 80

Query: 83  GGCDIVKEMYENGELKKVLEDKGIN 107
           GGCDI+ +M++NG+L + L+  GI+
Sbjct: 81  GGCDILLQMHQNGDLVEELKKLGIH 105


>2wemA [x.x.x] GLUTAREDOXIN-RELATED PROTEIN 5
          Length = 109

 Score =  102 bits (255), Expect = 4e-25
 Identities = 47/85 (55%), Positives = 66/85 (77%), Gaps = 1/85 (1%)

Query: 24  GTPDAPQCGFSMAVSNMLKILEV-NYKGINVLESQSLREGIKEFSDWPTIPQVYIKGEFV 82
           GTP+ PQCGFS AV  +L++  V +Y   NVL+   LR+GIK++S+WPTIPQVY+ GEFV
Sbjct: 20  GTPEQPQCGFSNAVVQILRLHGVRDYAAYNVLDDPELRQGIKDYSNWPTIPQVYLNGEFV 79

Query: 83  GGCDIVKEMYENGELKKVLEDKGIN 107
           GGCDI+ +M++NG+L + L+  GI+
Sbjct: 80  GGCDILLQMHQNGDLVEELKKLGIH 104


>1wikA [c.47.1] THIOREDOXIN-LIKE PROTEIN 2
          Length = 109

 Score = 92.8 bits (229), Expect = 4e-22
 Identities = 40/85 (47%), Positives = 59/85 (69%)

Query: 18  VCLFMKGTPDAPQCGFSMAVSNMLKILEVNYKGINVLESQSLREGIKEFSDWPTIPQVYI 77
           V LFMKG     +CGFS  +  +L    V Y+  ++LE + +R+G+K FS+WPT PQ+Y+
Sbjct: 17  VMLFMKGNKQEAKCGFSKQILEILNSTGVEYETFDILEDEEVRQGLKTFSNWPTYPQLYV 76

Query: 78  KGEFVGGCDIVKEMYENGELKKVLE 102
           +G+ VGG DIVKE+ +NGEL  +L+
Sbjct: 77  RGDLVGGLDIVKELKDNGELLPILK 101


>1ykaA [x.x.x] MONOTHIOL GLUTAREDOXIN YDHD
          Length = 115

 Score = 92.4 bits (228), Expect = 5e-22
 Identities = 39/106 (36%), Positives = 66/106 (62%)

Query: 4   STKNLIQGHIETNEVCLFMKGTPDAPQCGFSMAVSNMLKILEVNYKGINVLESQSLREGI 63
           +T   IQ  I  N + L+MKG+P  P CGFS      L      +  +++L++  +R  +
Sbjct: 3   TTIEKIQRQIAENPILLYMKGSPKLPSCGFSAQAVQALAACGERFAYVDILQNPDIRAEL 62

Query: 64  KEFSDWPTIPQVYIKGEFVGGCDIVKEMYENGELKKVLEDKGINFK 109
            ++++WPT PQ+++ GE VGGCDIV EMY+ GEL++++++    +K
Sbjct: 63  PKYANWPTFPQLWVDGELVGGCDIVIEMYQRGELQQLIKETAAKYK 108


>2wciB [x.x.x] GLUTAREDOXIN-4
          Length = 112

 Score = 92.4 bits (228), Expect = 5e-22
 Identities = 39/106 (36%), Positives = 66/106 (62%)

Query: 4   STKNLIQGHIETNEVCLFMKGTPDAPQCGFSMAVSNMLKILEVNYKGINVLESQSLREGI 63
           +T   IQ  I  N + L+MKG+P  P CGFS      L      +  +++L++  +R  +
Sbjct: 1   TTIEKIQRQIAENPILLYMKGSPKLPSCGFSAQAVQALAACGERFAYVDILQNPDIRAEL 60

Query: 64  KEFSDWPTIPQVYIKGEFVGGCDIVKEMYENGELKKVLEDKGINFK 109
            ++++WPT PQ+++ GE VGGCDIV EMY+ GEL++++++    +K
Sbjct: 61  PKYANWPTFPQLWVDGELVGGCDIVIEMYQRGELQQLIKETAAKYK 106


>2wciA [x.x.x] GLUTAREDOXIN-4
          Length = 113

 Score = 92.4 bits (228), Expect = 5e-22
 Identities = 39/106 (36%), Positives = 66/106 (62%)

Query: 4   STKNLIQGHIETNEVCLFMKGTPDAPQCGFSMAVSNMLKILEVNYKGINVLESQSLREGI 63
           +T   IQ  I  N + L+MKG+P  P CGFS      L      +  +++L++  +R  +
Sbjct: 3   TTIEKIQRQIAENPILLYMKGSPKLPSCGFSAQAVQALAACGERFAYVDILQNPDIRAEL 62

Query: 64  KEFSDWPTIPQVYIKGEFVGGCDIVKEMYENGELKKVLEDKGINFK 109
            ++++WPT PQ+++ GE VGGCDIV EMY+ GEL++++++    +K
Sbjct: 63  PKYANWPTFPQLWVDGELVGGCDIVIEMYQRGELQQLIKETAAKYK 108


>1z7pA [x.x.x] GLUTAREDOXIN
          Length = 117

 Score = 46.6 bits (109), Expect = 3e-08
 Identities = 24/82 (29%), Positives = 42/82 (51%), Gaps = 3/82 (3%)

Query: 31  CGFSMAVSNMLKILEVNYKGINVLE---SQSLREGIKEFSDWPTIPQVYIKGEFVGGCDI 87
           CG+   V  +L  +  +YK + + E      L+  +  ++   T+P V+I G+ +GGCD 
Sbjct: 31  CGYCNRVKQLLTQVGASYKVVELDELSDGSQLQSALAHWTGRGTVPNVFIGGKQIGGCDT 90

Query: 88  VKEMYENGELKKVLEDKGINFK 109
           V E ++  EL  +L+D     K
Sbjct: 91  VVEKHQRNELLPLLQDAAATAK 112


>2e7pC [x.x.x] GLUTAREDOXIN
          Length = 115

 Score = 46.6 bits (109), Expect = 3e-08
 Identities = 24/82 (29%), Positives = 42/82 (51%), Gaps = 3/82 (3%)

Query: 31  CGFSMAVSNMLKILEVNYKGINVLE---SQSLREGIKEFSDWPTIPQVYIKGEFVGGCDI 87
           CG+   V  +L  +  +YK + + E      L+  +  ++   T+P V+I G+ +GGCD 
Sbjct: 29  CGYCNRVKQLLTQVGASYKVVELDELSDGSQLQSALAHWTGRGTVPNVFIGGKQIGGCDT 88

Query: 88  VKEMYENGELKKVLEDKGINFK 109
           V E ++  EL  +L+D     K
Sbjct: 89  VVEKHQRNELLPLLQDAAATAK 110


>2e7pB [x.x.x] GLUTAREDOXIN
          Length = 111

 Score = 46.6 bits (109), Expect = 3e-08
 Identities = 24/82 (29%), Positives = 42/82 (51%), Gaps = 3/82 (3%)

Query: 31  CGFSMAVSNMLKILEVNYKGINVLE---SQSLREGIKEFSDWPTIPQVYIKGEFVGGCDI 87
           CG+   V  +L  +  +YK + + E      L+  +  ++   T+P V+I G+ +GGCD 
Sbjct: 28  CGYCNRVKQLLTQVGASYKVVELDELSDGSQLQSALAHWTGRGTVPNVFIGGKQIGGCDT 87

Query: 88  VKEMYENGELKKVLEDKGINFK 109
           V E ++  EL  +L+D     K
Sbjct: 88  VVEKHQRNELLPLLQDAAATAK 109


>2e7pD [x.x.x] GLUTAREDOXIN
          Length = 101

 Score = 46.2 bits (108), Expect = 4e-08
 Identities = 23/76 (30%), Positives = 41/76 (53%), Gaps = 3/76 (3%)

Query: 31  CGFSMAVSNMLKILEVNYKGINVLE---SQSLREGIKEFSDWPTIPQVYIKGEFVGGCDI 87
           CG+   V  +L  +  +YK + + E      L+  +  ++   T+P V+I G+ +GGCD 
Sbjct: 24  CGYCNRVKQLLTQVGASYKVVELDELSDGSQLQSALAHWTGRGTVPNVFIGGKQIGGCDT 83

Query: 88  VKEMYENGELKKVLED 103
           V E ++  EL  +L+D
Sbjct: 84  VVEKHQRNELLPLLQD 99


>2e7pA [x.x.x] GLUTAREDOXIN
          Length = 107

 Score = 46.2 bits (108), Expect = 4e-08
 Identities = 23/76 (30%), Positives = 41/76 (53%), Gaps = 3/76 (3%)

Query: 31  CGFSMAVSNMLKILEVNYKGINVLE---SQSLREGIKEFSDWPTIPQVYIKGEFVGGCDI 87
           CG+   V  +L  +  +YK + + E      L+  +  ++   T+P V+I G+ +GGCD 
Sbjct: 29  CGYCNRVKQLLTQVGASYKVVELDELSDGSQLQSALAHWTGRGTVPNVFIGGKQIGGCDT 88

Query: 88  VKEMYENGELKKVLED 103
           V E ++  EL  +L+D
Sbjct: 89  VVEKHQRNELLPLLQD 104


>3h8qB [x.x.x] THIOREDOXIN REDUCTASE 3
          Length = 106

 Score = 44.3 bits (103), Expect = 2e-07
 Identities = 29/99 (29%), Positives = 48/99 (48%), Gaps = 14/99 (14%)

Query: 11  GHIETNEVCLFMKGTPDAPQCGFSMAVSNMLKILEVNYKGINVLESQSLREG------IK 64
           G IE + V +F K       C  S  V  +   L V     NVLE   + +G      + 
Sbjct: 10  GLIERSRVVIFSKS-----YCPHSTRVKELFSSLGVE---CNVLELDQVDDGARVQEVLS 61

Query: 65  EFSDWPTIPQVYIKGEFVGGCDIVKEMYENGELKKVLED 103
           E ++  T+P +++    VGGCD   + Y++G L+K+L++
Sbjct: 62  EITNQKTVPNIFVNKVHVGGCDQTFQAYQSGLLQKLLQE 100


>3h8qA [x.x.x] THIOREDOXIN REDUCTASE 3
          Length = 108

 Score = 44.3 bits (103), Expect = 2e-07
 Identities = 29/99 (29%), Positives = 48/99 (48%), Gaps = 14/99 (14%)

Query: 11  GHIETNEVCLFMKGTPDAPQCGFSMAVSNMLKILEVNYKGINVLESQSLREG------IK 64
           G IE + V +F K       C  S  V  +   L V     NVLE   + +G      + 
Sbjct: 12  GLIERSRVVIFSKS-----YCPHSTRVKELFSSLGVE---CNVLELDQVDDGARVQEVLS 63

Query: 65  EFSDWPTIPQVYIKGEFVGGCDIVKEMYENGELKKVLED 103
           E ++  T+P +++    VGGCD   + Y++G L+K+L++
Sbjct: 64  EITNQKTVPNIFVNKVHVGGCDQTFQAYQSGLLQKLLQE 102


>3h4kA [x.x.x] THIOREDOXIN GLUTATHIONE REDUCTASE
          Length = 588

 Score = 41.6 bits (96), Expect = 1e-06
 Identities = 23/107 (21%), Positives = 54/107 (50%), Gaps = 8/107 (7%)

Query: 5   TKNLIQGHIETNEVCLFMKGTPDAPQCGFSMAVSNMLKILEVNYKGINVLE---SQSLRE 61
           T   ++  +++  V LF K T     C +   V ++L   ++ +  I + +     ++++
Sbjct: 2   TSQWLRKTVDSAAVILFSKTT-----CPYCKKVKDVLAEAKIKHATIELDQLSNGSAIQK 56

Query: 62  GIKEFSDWPTIPQVYIKGEFVGGCDIVKEMYENGELKKVLEDKGINF 108
            +  FS   T+PQ++++G+F+G    V + Y N EL  ++ +   ++
Sbjct: 57  CLASFSKIETVPQMFVRGKFIGDSQTVLKYYSNDELAGIVNESKYDY 103


>2v6oA [x.x.x] THIOREDOXIN GLUTATHIONE REDUCTASE
          Length = 586

 Score = 40.8 bits (94), Expect = 2e-06
 Identities = 22/99 (22%), Positives = 51/99 (51%), Gaps = 8/99 (8%)

Query: 13  IETNEVCLFMKGTPDAPQCGFSMAVSNMLKILEVNYKGINVLE---SQSLREGIKEFSDW 69
           +++  V LF K T     C +   V ++L   ++ +  I + +     ++++ +  FS  
Sbjct: 8   VDSAAVILFSKTT-----CPYCKKVKDVLAEAKIKHATIELDQLSNGSAIQKCLASFSKI 62

Query: 70  PTIPQVYIKGEFVGGCDIVKEMYENGELKKVLEDKGINF 108
            T+PQ++++G+F+G    V + Y N EL  ++ +   ++
Sbjct: 63  ETVPQMFVRGKFIGDSQTVLKYYSNDELAGIVNESKYDY 101


>1kteA [x.x.x] THIOLTRANSFERASE
          Length = 105

 Score = 40.8 bits (94), Expect = 2e-06
 Identities = 23/100 (23%), Positives = 53/100 (53%), Gaps = 5/100 (5%)

Query: 9   IQGHIETNEVCLFMKGTPDAPQCGFSMAVSNMLKILEVNYKGINVL---ESQSLREGIKE 65
           +   I+  +V +F+K  P  P C  +  + + L   E   + +++    ++  +++ +++
Sbjct: 5   VNSKIQPGKVVVFIK--PTCPFCRKTQELLSQLPFKEGLLEFVDITATSDTNEIQDYLQQ 62

Query: 66  FSDWPTIPQVYIKGEFVGGCDIVKEMYENGELKKVLEDKG 105
            +   T+P+V+I  E +GGC  ++ M++ GEL   L+  G
Sbjct: 63  LTGARTVPRVFIGKECIGGCTDLESMHKRGELLTRLQQVG 102


>3fz9A [x.x.x] GLUTAREDOXIN
          Length = 106

 Score = 40.4 bits (93), Expect = 2e-06
 Identities = 20/77 (25%), Positives = 41/77 (53%), Gaps = 4/77 (5%)

Query: 31  CGFSMAVSNMLKILEVNYKGINVLE----SQSLREGIKEFSDWPTIPQVYIKGEFVGGCD 86
           C +S  V ++ K L V+   + + E       +++ ++  +   T+P V+I G+ +GGC 
Sbjct: 25  CSYSSEVKSLFKRLNVDPLVVELDELGAQGPQIQKVLERLTGQHTVPNVFIGGKHIGGCT 84

Query: 87  IVKEMYENGELKKVLED 103
              ++Y  GEL+ +L +
Sbjct: 85  DTVKLYRKGELEPLLSE 101


>2ht9B [x.x.x] GLUTAREDOXIN-2
          Length = 111

 Score = 39.3 bits (90), Expect = 5e-06
 Identities = 23/94 (24%), Positives = 46/94 (48%), Gaps = 8/94 (8%)

Query: 7  NLIQGHIETNEVCLFMKGTPDAPQCGFSMAVSNMLKILEVNYKGI--NVLE-SQSLREGI 63
          N IQ  I  N V +F K +     C +      +   + VNYK +  ++LE     ++ +
Sbjct: 5  NQIQETISDNCVVIFSKTS-----CSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDAL 59

Query: 64 KEFSDWPTIPQVYIKGEFVGGCDIVKEMYENGEL 97
           + +   T+P++++ G F+GG      +++ G+L
Sbjct: 60 YKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKL 93


>2ht9A [x.x.x] GLUTAREDOXIN-2
          Length = 104

 Score = 39.3 bits (90), Expect = 5e-06
 Identities = 23/94 (24%), Positives = 46/94 (48%), Gaps = 8/94 (8%)

Query: 7  NLIQGHIETNEVCLFMKGTPDAPQCGFSMAVSNMLKILEVNYKGI--NVLE-SQSLREGI 63
          N IQ  I  N V +F K +     C +      +   + VNYK +  ++LE     ++ +
Sbjct: 7  NQIQETISDNCVVIFSKTS-----CSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDAL 61

Query: 64 KEFSDWPTIPQVYIKGEFVGGCDIVKEMYENGEL 97
           + +   T+P++++ G F+GG      +++ G+L
Sbjct: 62 YKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKL 95


>2flsA [x.x.x] GLUTAREDOXIN-2
          Length = 101

 Score = 39.3 bits (90), Expect = 5e-06
 Identities = 23/94 (24%), Positives = 46/94 (48%), Gaps = 8/94 (8%)

Query: 7  NLIQGHIETNEVCLFMKGTPDAPQCGFSMAVSNMLKILEVNYKGI--NVLE-SQSLREGI 63
          N IQ  I  N V +F K +     C +      +   + VNYK +  ++LE     ++ +
Sbjct: 4  NQIQETISDNCVVIFSKTS-----CSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDAL 58

Query: 64 KEFSDWPTIPQVYIKGEFVGGCDIVKEMYENGEL 97
           + +   T+P++++ G F+GG      +++ G+L
Sbjct: 59 YKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKL 92


>2cq9A [x.x.x] GLRX2 PROTEIN
          Length = 130

 Score = 39.3 bits (90), Expect = 5e-06
 Identities = 23/94 (24%), Positives = 46/94 (48%), Gaps = 8/94 (8%)

Query: 7   NLIQGHIETNEVCLFMKGTPDAPQCGFSMAVSNMLKILEVNYKGI--NVLE-SQSLREGI 63
           N IQ  I  N V +F K +     C +      +   + VNYK +  ++LE     ++ +
Sbjct: 18  NQIQETISDNCVVIFSKTS-----CSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDAL 72

Query: 64  KEFSDWPTIPQVYIKGEFVGGCDIVKEMYENGEL 97
            + +   T+P++++ G F+GG      +++ G+L
Sbjct: 73  YKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKL 106


>3d5jB [x.x.x] GLUTAREDOXIN-2, MITOCHONDRIAL
          Length = 107

 Score = 38.9 bits (89), Expect = 7e-06
 Identities = 24/79 (30%), Positives = 42/79 (53%), Gaps = 7/79 (8%)

Query: 31  CGFSMA-VSNMLKILEVNYKGINVLESQSLREG------IKEFSDWPTIPQVYIKGEFVG 83
           C +S A +S + + L V      VLE   +  G      ++E S   T+P VYI G+ +G
Sbjct: 26  CPYSKATLSTLFQELNVPKSKALVLELDEMSNGSEIQDALEEISGQKTVPNVYINGKHIG 85

Query: 84  GCDIVKEMYENGELKKVLE 102
           G   ++ + +NG+L ++L+
Sbjct: 86  GNSDLETLKKNGKLAEILK 104


>3d5jA [x.x.x] GLUTAREDOXIN-2, MITOCHONDRIAL
          Length = 112

 Score = 38.9 bits (89), Expect = 7e-06
 Identities = 24/79 (30%), Positives = 42/79 (53%), Gaps = 7/79 (8%)

Query: 31  CGFSMA-VSNMLKILEVNYKGINVLESQSLREG------IKEFSDWPTIPQVYIKGEFVG 83
           C +S A +S + + L V      VLE   +  G      ++E S   T+P VYI G+ +G
Sbjct: 30  CPYSKATLSTLFQELNVPKSKALVLELDEMSNGSEIQDALEEISGQKTVPNVYINGKHIG 89

Query: 84  GCDIVKEMYENGELKKVLE 102
           G   ++ + +NG+L ++L+
Sbjct: 90  GNSDLETLKKNGKLAEILK 108


>3d4mA [x.x.x] GLUTAREDOXIN-2, MITOCHONDRIAL
          Length = 109

 Score = 38.1 bits (87), Expect = 1e-05
 Identities = 24/89 (26%), Positives = 43/89 (48%), Gaps = 8/89 (8%)

Query: 20  LFMKGTPDAPQCGFSMAVSNMLKILEVNYKGINVLESQSLREG------IKEFSDWPTIP 73
           +F+      P C     +S + + L V      VLE   +  G      ++E S   T+P
Sbjct: 19  VFVAAKTYCPYC--KATLSTLFQELNVPKSKALVLELDEMSNGSEIQDALEEISGQKTVP 76

Query: 74  QVYIKGEFVGGCDIVKEMYENGELKKVLE 102
            VYI G+ +GG   ++ + +NG+L ++L+
Sbjct: 77  NVYINGKHIGGNSDLETLKKNGKLAEILK 105


>3ctgA [x.x.x] GLUTAREDOXIN-2
          Length = 108

 Score = 38.1 bits (87), Expect = 1e-05
 Identities = 24/89 (26%), Positives = 43/89 (48%), Gaps = 8/89 (8%)

Query: 20  LFMKGTPDAPQCGFSMAVSNMLKILEVNYKGINVLESQSLREG------IKEFSDWPTIP 73
           +F+      P C     +S + + L V      VLE   +  G      ++E S   T+P
Sbjct: 18  VFVAAKTYCPYC--KATLSTLFQELNVPKSKALVLELDEMSNGSEIQDALEEISGQKTVP 75

Query: 74  QVYIKGEFVGGCDIVKEMYENGELKKVLE 102
            VYI G+ +GG   ++ + +NG+L ++L+
Sbjct: 76  NVYINGKHIGGNSDLETLKKNGKLAEILK 104


>2klxA [x.x.x] GLUTAREDOXIN
          Length = 89

 Score = 37.7 bits (86), Expect = 2e-05
 Identities = 24/76 (31%), Positives = 38/76 (50%), Gaps = 3/76 (3%)

Query: 29  PQCGFSMAVSNMLKILEVNYKGINVLESQSLR-EGIKEFSDWPTIPQVYIKGEFVGGCDI 87
           P C +     ++L    V Y  I+   S SLR E ++  +   T PQ++I    VGGCD 
Sbjct: 14  PNCPYCKRARDLLDKKGVKYTDIDA--STSLRQEMVQRANGRNTFPQIFIGDYHVGGCDD 71

Query: 88  VKEMYENGELKKVLED 103
           +  +   G+L  +L+D
Sbjct: 72  LYALENKGKLDSLLQD 87


>1jhbA [x.x.x] GLUTAREDOXIN
          Length = 105

 Score = 37.0 bits (84), Expect = 3e-05
 Identities = 21/96 (21%), Positives = 51/96 (53%), Gaps = 5/96 (5%)

Query: 13  IETNEVCLFMKGTPDAPQCGFSMAVSNMLKILEVNYKGINVL---ESQSLREGIKEFSDW 69
           I+  +V +F+K  P  P C  +  + + L I +   + +++     +  +++ +++ +  
Sbjct: 9   IQPGKVVVFIK--PTCPYCRRAQEILSQLPIKQGLLEFVDITATNHTNEIQDYLQQLTGA 66

Query: 70  PTIPQVYIKGEFVGGCDIVKEMYENGELKKVLEDKG 105
            T+P+V+I  + +GGC  +  + ++GEL   L+  G
Sbjct: 67  RTVPRVFIGKDCIGGCSDLVSLQQSGELLTRLKQIG 102


>2khpA [x.x.x] GLUTAREDOXIN
          Length = 92

 Score = 35.0 bits (79), Expect = 1e-04
 Identities = 19/74 (25%), Positives = 33/74 (44%)

Query: 29  PQCGFSMAVSNMLKILEVNYKGINVLESQSLREGIKEFSDWPTIPQVYIKGEFVGGCDIV 88
           P C +              +  I+   +  LR  ++E S   T PQ++I    VGGCD +
Sbjct: 14  PGCPYCXXXXXXXXXXGAEFNEIDASATPELRAEMQERSGRNTFPQIFIGSVHVGGCDDL 73

Query: 89  KEMYENGELKKVLE 102
             + + G+L  +L+
Sbjct: 74  YALEDEGKLDSLLK 87


>1nm3B [c.47.1 - c.47.1] PROTEIN HI0572
          Length = 232

 Score = 33.9 bits (76), Expect = 2e-04
 Identities = 22/90 (24%), Positives = 42/90 (46%), Gaps = 6/90 (6%)

Query: 3   DSTKNLIQGHIETNEVCLFMKGTPDAPQCGFSMAVSNMLKILEVNYKGINVLESQSLREG 62
           D+ K L   H     + +F K     P C F      +L    ++++ I +L   +    
Sbjct: 148 DTLKYLAPQHQVQESISIFTK-----PGCPFCAKAKQLLHDKGLSFEEI-ILGHDATIVS 201

Query: 63  IKEFSDWPTIPQVYIKGEFVGGCDIVKEMY 92
           ++  S   T+PQV+I G+ +GG D +++ +
Sbjct: 202 VRAVSGRTTVPQVFIGGKHIGGSDDLEKYF 231


>1nm3A [c.47.1 - c.47.1] PROTEIN HI0572
          Length = 230

 Score = 33.1 bits (74), Expect = 4e-04
 Identities = 22/84 (26%), Positives = 38/84 (45%), Gaps = 6/84 (7%)

Query: 3   DSTKNLIQGHIETNEVCLFMKGTPDAPQCGFSMAVSNMLKILEVNYKGINVLESQSLREG 62
           D+ K L   H     + +F K     P C F      +L    ++++ I +L   +    
Sbjct: 148 DTLKYLAPQHQVQESISIFTK-----PGCPFCAKAKQLLHDKGLSFEEI-ILGHDATIVS 201

Query: 63  IKEFSDWPTIPQVYIKGEFVGGCD 86
           ++  S   T+PQV+I G+ +GG D
Sbjct: 202 VRAVSGRTTVPQVFIGGKHIGGSD 225


>2hzfB [x.x.x] GLUTAREDOXIN-1
          Length = 109

 Score = 33.1 bits (74), Expect = 4e-04
 Identities = 21/104 (20%), Positives = 47/104 (45%), Gaps = 5/104 (4%)

Query: 6   KNLIQGHIETNEVCLFMKGTPDAPQCGFSMAVSNMLKILEVNYKGINVLE---SQSLREG 62
           +  +Q  +  N+V +F+K T   P C  ++ + N        Y+ +++ E      LR+ 
Sbjct: 5   EEFVQQRLANNKVTIFVKYT--CPFCRNALDILNKFSFKRGAYEIVDIKEFKPENELRDY 62

Query: 63  IKEFSDWPTIPQVYIKGEFVGGCDIVKEMYENGELKKVLEDKGI 106
            ++ +   T+P+++     +GG   + E+     L  +L   G+
Sbjct: 63  FEQITGGKTVPRIFFGKTSIGGYSDLLEIDNMDALGDILSSIGV 106


>2hzeA [x.x.x] GLUTAREDOXIN-1
          Length = 110

 Score = 33.1 bits (74), Expect = 4e-04
 Identities = 21/104 (20%), Positives = 47/104 (45%), Gaps = 5/104 (4%)

Query: 6   KNLIQGHIETNEVCLFMKGTPDAPQCGFSMAVSNMLKILEVNYKGINVLE---SQSLREG 62
           +  +Q  +  N+V +F+K T   P C  ++ + N        Y+ +++ E      LR+ 
Sbjct: 6   EEFVQQRLANNKVTIFVKYT--CPFCRNALDILNKFSFKRGAYEIVDIKEFKPENELRDY 63

Query: 63  IKEFSDWPTIPQVYIKGEFVGGCDIVKEMYENGELKKVLEDKGI 106
            ++ +   T+P+++     +GG   + E+     L  +L   G+
Sbjct: 64  FEQITGGKTVPRIFFGKTSIGGYSDLLEIDNMDALGDILSSIGV 107


>2hzeB [x.x.x] GLUTAREDOXIN-1
          Length = 108

 Score = 32.7 bits (73), Expect = 5e-04
 Identities = 21/104 (20%), Positives = 47/104 (45%), Gaps = 6/104 (5%)

Query: 6   KNLIQGHIETNEVCLFMKGTPDAPQCGFSMAVSNMLKILEVNYKGINVLE---SQSLREG 62
           +  +Q  +  N+V +F+K TP    C  ++ + N        Y+ +++ E      LR+ 
Sbjct: 5   EEFVQQRLANNKVTIFVKYTPF---CRNALDILNKFSFKRGAYEIVDIKEFKPENELRDY 61

Query: 63  IKEFSDWPTIPQVYIKGEFVGGCDIVKEMYENGELKKVLEDKGI 106
            ++ +   T+P+++     +GG   + E+     L  +L   G+
Sbjct: 62  FEQITGGKTVPRIFFGKTSIGGYSDLLEIDNMDALGDILSSIGV 105


>3c1sA [x.x.x] GLUTAREDOXIN-1
          Length = 107

 Score = 32.7 bits (73), Expect = 5e-04
 Identities = 22/80 (27%), Positives = 39/80 (48%), Gaps = 10/80 (12%)

Query: 13 IETNEVCLFMKGTPDAPQCGFSMAVSNMLKILEVNYKGINVLESQSLREG------IKEF 66
          I  NE+  F+      P C    A++ + + L+V    + VL+   ++EG      + E 
Sbjct: 13 IAENEI--FVASKTYCPYC--HAALNTLFEKLKVPRSKVLVLQLNDMKEGADIQAALYEI 68

Query: 67 SDWPTIPQVYIKGEFVGGCD 86
          +   T+P +YI G+ +GG D
Sbjct: 69 NGQRTVPNIYINGKHIGGND 88


>3c1rA [x.x.x] GLUTAREDOXIN-1
          Length = 110

 Score = 32.7 bits (73), Expect = 5e-04
 Identities = 22/80 (27%), Positives = 39/80 (48%), Gaps = 10/80 (12%)

Query: 13 IETNEVCLFMKGTPDAPQCGFSMAVSNMLKILEVNYKGINVLESQSLREG------IKEF 66
          I  NE+  F+      P C    A++ + + L+V    + VL+   ++EG      + E 
Sbjct: 15 IAENEI--FVASKTYCPYC--HAALNTLFEKLKVPRSKVLVLQLNDMKEGADIQAALYEI 70

Query: 67 SDWPTIPQVYIKGEFVGGCD 86
          +   T+P +YI G+ +GG D
Sbjct: 71 NGQRTVPNIYINGKHIGGND 90


>2jadA [x.x.x] YELLOW FLUORESCENT PROTEIN GLUTAREDOXIN FUSION
          Length = 346

 Score = 32.3 bits (72), Expect = 7e-04
 Identities = 20/63 (31%), Positives = 33/63 (52%), Gaps = 7/63 (11%)

Query: 31  CGFSMAVSNML-KILEVNYKGINVLESQSLREG------IKEFSDWPTIPQVYIKGEFVG 83
           C +S A  N L + L+V    + VL+   ++EG      + E +   T+P +YI G+ +G
Sbjct: 265 CPYSHAALNTLFEKLKVPRSKVLVLQLNDMKEGADIQAALYEINGQRTVPNIYINGKHIG 324

Query: 84  GCD 86
           G D
Sbjct: 325 GND 327


>2jacA [x.x.x] GLUTAREDOXIN-1
          Length = 108

 Score = 32.3 bits (72), Expect = 7e-04
 Identities = 20/63 (31%), Positives = 33/63 (52%), Gaps = 7/63 (11%)

Query: 31 CGFSMAVSNML-KILEVNYKGINVLESQSLREG------IKEFSDWPTIPQVYIKGEFVG 83
          C +S A  N L + L+V    + VL+   ++EG      + E +   T+P +YI G+ +G
Sbjct: 27 CPYSHAALNTLFEKLKVPRSKVLVLQLNDMKEGADIQAALYEINGQRTVPNIYINGKHIG 86

Query: 84 GCD 86
          G D
Sbjct: 87 GND 89


>3dp7B [x.x.x] SAM-DEPENDENT METHYLTRANSFERASE
          Length = 350

 Score = 32.3 bits (72), Expect = 7e-04
 Identities = 19/41 (46%), Positives = 24/41 (58%), Gaps = 3/41 (7%)

Query: 35  MAVSNMLKILEVNYKGINVLESQSLR---EGIKEFSDWPTI 72
           MA  NM    +VNY+G+  LE   L    EG+K F +WPTI
Sbjct: 96  MARVNMEFNHDVNYQGLFHLEEALLNGRPEGLKVFGEWPTI 136


>3dp7A [x.x.x] SAM-DEPENDENT METHYLTRANSFERASE
          Length = 351

 Score = 32.3 bits (72), Expect = 7e-04
 Identities = 19/41 (46%), Positives = 24/41 (58%), Gaps = 3/41 (7%)

Query: 35  MAVSNMLKILEVNYKGINVLESQSLR---EGIKEFSDWPTI 72
           MA  NM    +VNY+G+  LE   L    EG+K F +WPTI
Sbjct: 97  MARVNMEFNHDVNYQGLFHLEEALLNGRPEGLKVFGEWPTI 137


>1b4qA [c.47.1] PROTEIN (HUMAN THIOLTRANSFERASE)
          Length = 105

 Score = 32.3 bits (72), Expect = 7e-04
 Identities = 20/106 (18%), Positives = 50/106 (47%), Gaps = 11/106 (10%)

Query: 6   KNLIQGHIETNEVCLFMKGTPDAPQCGFSMAVSNMLKILEVNYKGINVLE------SQSL 59
           +  +   I+  +V +F+K     P C +S     +L  L +    +  ++      +  +
Sbjct: 2   QEFVNSKIQPGKVVVFIK-----PTCPYSRRAQEILSQLPIKQGLLEFVDITATNHTNEI 56

Query: 60  REGIKEFSDWPTIPQVYIKGEFVGGCDIVKEMYENGELKKVLEDKG 105
           ++ +++ +   T+P+V+I  + +GG   +  + ++GEL   L+  G
Sbjct: 57  QDYLQQLTGARTVPRVFIGKDSIGGSSDLVSLQQSGELLTRLKQIG 102


  Database: 95pdb09Oct16x
    Posted date:  Nov 2, 2009  3:15 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.318    0.136    0.412 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 764,000,630
Number of extensions: 31682205
Number of successful extensions: 79577
Number of sequences better than 1.0e-03: 1613
Number of HSP's gapped: 77956
Number of HSP's successfully gapped: 2121
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (20.8 bits)