BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= AAZ22048.1 pubi0 yhdH GIB00256CH01 "zinc-binding alcohol
dehydrogenase"
         (333 letters)

Database: 95pdb09Oct16x 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

1o8cC [b.35.1 - c.2.1] YHDH                                           227   4e-62
1o8cA [b.35.1 - c.2.1] YHDH                                           227   4e-62
1xa0A [b.35.1 - c.2.1] PUTATIVE NADPH DEPENDENT OXIDOREDUCTASES       223   8e-61
1o89A [b.35.1 - c.2.1] YHDH                                           220   5e-60
1xa0B [b.35.1 - c.2.1] PUTATIVE NADPH DEPENDENT OXIDOREDUCTASES       217   3e-59
1tt7A [b.35.1 - c.2.1] YHFP                                           186   8e-50
1yb5A [b.35.1 - c.2.1] QUINONE OXIDOREDUCTASE                          70   7e-15
2vn8B [x.x.x] RETICULON-4-INTERACTING PROTEIN 1                        67   7e-14
2vn8A [x.x.x] RETICULON-4-INTERACTING PROTEIN 1                        67   7e-14
3fbgB [x.x.x] PUTATIVE ARGINATE LYASE                                  61   5e-12
3fbgA [x.x.x] PUTATIVE ARGINATE LYASE                                  60   7e-12
1rjwA [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE                           60   1e-11
1v3vB [b.35.1 - c.2.1] LEUKOTRIENE B4 12-                              53   1e-09
1v3uB [b.35.1 - c.2.1] LEUKOTRIENE B4 12-                              53   1e-09
1v3tB [b.35.1 - c.2.1] LEUKOTRIENE B4 12-                              53   1e-09
1v3tA [b.35.1 - c.2.1] LEUKOTRIENE B4 12-                              53   1e-09
2dm6A [x.x.x] NADP-DEPENDENT LEUKOTRIENE B4 12-                        53   1e-09
1wlyA [x.x.x] 2-HALOACRYLATE REDUCTASE                                 50   7e-09
1lluA [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE                           50   7e-09
1v3uA [b.35.1 - c.2.1] LEUKOTRIENE B4 12-                              49   2e-08
2hcyA [x.x.x] ALCOHOL DEHYDROGENASE 1                                  47   8e-08
3gmsA [x.x.x] PUTATIVE NADPH:QUINONE REDUCTASE                         47   1e-07
1zsvA [x.x.x] NADP-DEPENDENT LEUKOTRIENE B4 12-                        45   4e-07
2j3hB [x.x.x] NADP-DEPENDENT OXIDOREDUCTASE P1                         44   5e-07
2j3hA [x.x.x] NADP-DEPENDENT OXIDOREDUCTASE P1                         44   5e-07
1qorA [b.35.1 - c.2.1] QUINONE OXIDOREDUCTASE                          42   3e-06
1h2bB [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE                           41   4e-06
1h2bA [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE                           41   4e-06
2c0cB [x.x.x] ZINC BINDING ALCOHOL DEHYDROGENASE, DOMAIN               40   8e-06
2c0cA [x.x.x] ZINC BINDING ALCOHOL DEHYDROGENASE, DOMAIN               40   8e-06
2eihA [x.x.x] ALCOHOL DEHYDROGENASE                                    38   4e-05
2j8zA [x.x.x] QUINONE OXIDOREDUCTASE                                   37   6e-05
2obyA [x.x.x] PUTATIVE QUINONE OXIDOREDUCTASE                          37   8e-05
2zb3A [x.x.x] PROSTAGLANDIN REDUCTASE 2                                36   1e-04
3gqvA [x.x.x] ENOYL REDUCTASE                                          36   1e-04
3b70A [x.x.x] ENOYL REDUCTASE                                          36   1e-04
3b6zA [x.x.x] ENOYL REDUCTASE                                          36   1e-04
2iodB [x.x.x] DIHYDROFLAVONOL 4-REDUCTASE                              34   5e-04
3f9iB [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] REDUCTASE               34   5e-04
3f9iA [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] REDUCTASE               34   5e-04

>1o8cC [b.35.1 - c.2.1] YHDH
          Length = 323

 Score =  227 bits (578), Expect = 4e-62
 Identities = 122/327 (37%), Positives = 192/327 (58%), Gaps = 4/327 (1%)

Query: 6   KALVVNQESENFTREVKSIDKSFLKHGDVLVQVDYSDLNYKDALILNNGAKLVKEFPHIP 65
           +AL++ Q+       V+++D+S L  GDV V V +S LNYKDAL +    K+++ FP IP
Sbjct: 1   QALLLEQQDGKTLASVQTLDESRLPEGDVTVDVHWSSLNYKDALAITGKGKIIRNFPMIP 60

Query: 66  GIDFAGTVLESDNSKFIKGDEVILTGWRVGEIYFGGYSQFAKVNGDYLVKKPKDISSKQA 125
           GIDFAGTV  S++ +F  G EV+LTGW VGE ++GG ++ A+V GD+LV  P+ + +++A
Sbjct: 61  GIDFAGTVRTSEDPRFHAGQEVLLTGWGVGENHWGGLAEQARVKGDWLVAMPQGLDARKA 120

Query: 126 MILGTAGLTALLCSFAIKAREELLLGEKVKDVLVTGASGGVGSIAVMILNKFGYDVTAVT 185
           MI+GTAG TA+LC   + A E+  +  +  ++               +L+K GY V AV+
Sbjct: 121 MIIGTAGFTAMLC---VMALEDAGVRPQDGEIXXXXXXXXXXXXXXXLLHKLGYQVVAVS 177

Query: 186 GKAENEKYLRSLGAKNIINKADLDKDARPLDKGLWDGVVDTVGGKILANALAQTRDNGIV 245
           G+    +YL+SLGA  ++ + D   ++RPL+K +W G +DTVG K+LA  LAQ       
Sbjct: 178 GRESTHEYLKSLGASRVLPR-DEFAESRPLEKQVWAGAIDTVGDKVLAKVLAQMNYXXXX 236

Query: 246 AACGNASDYKLNTTVMPFIIRGVKLWGINSVTASIKRREFVWNEVKSLIDFEQLEKSIKT 305
                   + L TTVMPFI+R V+L G++SV    +RR   W  + + +      ++ K 
Sbjct: 237 XXXXXXXXFTLPTTVMPFILRNVRLQGVDSVMTPPERRAQAWQRLVADLPESFYTQAAKE 296

Query: 306 VSLEDLIDIYPKMLKGETSGRYIVDLN 332
           +SL +  +    ++  +  GR +V +N
Sbjct: 297 ISLSEAPNFAEAIINNQIQGRTLVKVN 323


>1o8cA [b.35.1 - c.2.1] YHDH
          Length = 324

 Score =  227 bits (578), Expect = 4e-62
 Identities = 122/327 (37%), Positives = 192/327 (58%), Gaps = 4/327 (1%)

Query: 6   KALVVNQESENFTREVKSIDKSFLKHGDVLVQVDYSDLNYKDALILNNGAKLVKEFPHIP 65
           +AL++ Q+       V+++D+S L  GDV V V +S LNYKDAL +    K+++ FP IP
Sbjct: 2   QALLLEQQDGKTLASVQTLDESRLPEGDVTVDVHWSSLNYKDALAITGKGKIIRNFPMIP 61

Query: 66  GIDFAGTVLESDNSKFIKGDEVILTGWRVGEIYFGGYSQFAKVNGDYLVKKPKDISSKQA 125
           GIDFAGTV  S++ +F  G EV+LTGW VGE ++GG ++ A+V GD+LV  P+ + +++A
Sbjct: 62  GIDFAGTVRTSEDPRFHAGQEVLLTGWGVGENHWGGLAEQARVKGDWLVAMPQGLDARKA 121

Query: 126 MILGTAGLTALLCSFAIKAREELLLGEKVKDVLVTGASGGVGSIAVMILNKFGYDVTAVT 185
           MI+GTAG TA+LC   + A E+  +  +  ++               +L+K GY V AV+
Sbjct: 122 MIIGTAGFTAMLC---VMALEDAGVRPQDGEIXXXXXXXXXXXXXXXLLHKLGYQVVAVS 178

Query: 186 GKAENEKYLRSLGAKNIINKADLDKDARPLDKGLWDGVVDTVGGKILANALAQTRDNGIV 245
           G+    +YL+SLGA  ++ + D   ++RPL+K +W G +DTVG K+LA  LAQ       
Sbjct: 179 GRESTHEYLKSLGASRVLPR-DEFAESRPLEKQVWAGAIDTVGDKVLAKVLAQMNYXXXX 237

Query: 246 AACGNASDYKLNTTVMPFIIRGVKLWGINSVTASIKRREFVWNEVKSLIDFEQLEKSIKT 305
                   + L TTVMPFI+R V+L G++SV    +RR   W  + + +      ++ K 
Sbjct: 238 XXXXXXXXFTLPTTVMPFILRNVRLQGVDSVMTPPERRAQAWQRLVADLPESFYTQAAKE 297

Query: 306 VSLEDLIDIYPKMLKGETSGRYIVDLN 332
           +SL +  +    ++  +  GR +V +N
Sbjct: 298 ISLSEAPNFAEAIINNQIQGRTLVKVN 324


>1xa0A [b.35.1 - c.2.1] PUTATIVE NADPH DEPENDENT OXIDOREDUCTASES
          Length = 312

 Score =  223 bits (567), Expect = 8e-61
 Identities = 146/327 (44%), Positives = 195/327 (59%), Gaps = 18/327 (5%)

Query: 5   FKALVVNQESENFTREVKSIDKSFLKHGDVLVQVDYSDLNYKDALILNNGAKLVKEFPHI 64
           F+A VVN+    FT  V++I    L  GDVLV+V YS +NYKD L      K+VK  P +
Sbjct: 3   FQAFVVNKTETEFTAGVQTISDD-LPEGDVLVRVHYSSVNYKDGLASIPDGKIVKT-PFV 60

Query: 65  PGIDFAGTVLESDNSKFIKGDEVILTGWRVGEIYFGGYSQFAKVNGDYLVKKPKDISSKQ 124
           PGID AG V+ S + +F +GDEVI TG+ +G  +FGGYS++A+++G++LV  PK ++ K+
Sbjct: 61  PGIDLAGVVVSSQHPRFREGDEVIATGYEIGVTHFGGYSEYARLHGEWLVPLPKGLTLKE 120

Query: 125 AMILGTAGLTALLCSFAIKAREELLLGEKVKDVLVTGASGGVGSIAVMILNKFGYDVTAV 184
           A I GTAG TA L   +I   EE  L  +   VLVTGA+GGVGS+AV  L K GY V A 
Sbjct: 121 AAI-GTAGFTAAL---SIHRLEEHGLTPERGPVLVTGATGGVGSLAVS-LAKRGYTVEAS 175

Query: 185 TGKAENEKYLRSLGAKNIINKADLDKDARPLDKGLWDGVVDTVGGKILANALAQTRDNGI 244
           TGKA    YLR LGAK ++        AR LDK  W   VD VGG+ LA  L++ R  G 
Sbjct: 176 TGKAAEHDYLRVLGAKEVL--------ARELDKQRWAAAVDPVGGRTLATVLSR-RYGGA 226

Query: 245 VAACGNASDYKLNTTVMPFIIRGVKLWGINSVTASIKRREFVWNEVKSLIDFEQLEKSIK 304
           VA  G     ++ TTV PFI+RGV L GI+SV     R   +W  +   +    LE+  +
Sbjct: 227 VAVSGLTGGAEVPTTVHPFILRGVSLLGIDSVYCPDLRLR-IWERLAGDLK-PDLERIAQ 284

Query: 305 TVSLEDLIDIYPKMLKGETSGRYIVDL 331
            +SL +L     ++L+GE  GR +V L
Sbjct: 285 EISLAELPQALKRILRGELRGRTVVRL 311


>1o89A [b.35.1 - c.2.1] YHDH
          Length = 320

 Score =  220 bits (560), Expect = 5e-60
 Identities = 118/309 (38%), Positives = 183/309 (59%), Gaps = 4/309 (1%)

Query: 21  VKSIDKSFLKHGDVLVQVDYSDLNYKDALILNNGAKLVKEFPHIPGIDFAGTVLESDNSK 80
           V+++D+S L  GDV V V +S LNYKDAL +    K+++ FP IPGIDFAGTV  S++ +
Sbjct: 14  VQTLDESRLPEGDVTVDVHWSSLNYKDALAITGKGKIIRNFPMIPGIDFAGTVRTSEDPR 73

Query: 81  FIKGDEVILTGWRVGEIYFGGYSQFAKVNGDYLVKKPKDISSKQAMILGTAGLTALLCSF 140
           F  G EV+LTGW VGE ++GG ++ A+V GD+LV  P+ + +++AMI+GTAG TA+LC  
Sbjct: 74  FHAGQEVLLTGWGVGENHWGGLAEQARVKGDWLVAMPQGLDARKAMIIGTAGFTAMLC-- 131

Query: 141 AIKAREELLLGEKVKDVLVTGASGGVGSIAVMILNKFGYDVTAVTGKAENEKYLRSLGAK 200
            + A E+  +  +  ++               +L+K GY V AV+G+    +YL+SLGA 
Sbjct: 132 -VMALEDAGVRPQDGEIXXXXXXXXXXXXXXXLLHKLGYQVVAVSGRESTHEYLKSLGAS 190

Query: 201 NIINKADLDKDARPLDKGLWDGVVDTVGGKILANALAQTRDNGIVAACGNASDYKLNTTV 260
            ++ + D   ++RPL+K +W G +DTVG K+LA  LAQ               + L TTV
Sbjct: 191 RVLPR-DEFAESRPLEKQVWAGAIDTVGDKVLAKVLAQMNYXXXXXXXXXXXXFTLPTTV 249

Query: 261 MPFIIRGVKLWGINSVTASIKRREFVWNEVKSLIDFEQLEKSIKTVSLEDLIDIYPKMLK 320
           MPFI+R V+L G++SV    +RR   W  + + +      ++ K +SL +  +    ++ 
Sbjct: 250 MPFILRNVRLQGVDSVMTPPERRAQAWQRLVADLPESFYTQAAKEISLSEAPNFAEAIIN 309

Query: 321 GETSGRYIV 329
            +  GR +V
Sbjct: 310 NQIQGRTLV 318


>1xa0B [b.35.1 - c.2.1] PUTATIVE NADPH DEPENDENT OXIDOREDUCTASES
          Length = 311

 Score =  217 bits (553), Expect = 3e-59
 Identities = 146/327 (44%), Positives = 194/327 (59%), Gaps = 18/327 (5%)

Query: 5   FKALVVNQESENFTREVKSIDKSFLKHGDVLVQVDYSDLNYKDALILNNGAKLVKEFPHI 64
           F+A VVN+    FT  V++I    L  GDVLV+V YS +NYKD L      K+VK  P +
Sbjct: 3   FQAFVVNKTETEFTAGVQTISDD-LPEGDVLVRVHYSSVNYKDGLASIPDGKIVKT-PFV 60

Query: 65  PGIDFAGTVLESDNSKFIKGDEVILTGWRVGEIYFGGYSQFAKVNGDYLVKKPKDISSKQ 124
           PGID AG V+ S + +   GDEVI TG+ +G  +FGGYS++A+++G++LV  PK ++ K+
Sbjct: 61  PGIDLAGVVVSSQHPE---GDEVIATGYEIGVTHFGGYSEYARLHGEWLVPLPKGLTLKE 117

Query: 125 AMILGTAGLTALLCSFAIKAREELLLGEKVKDVLVTGASGGVGSIAVMILNKFGYDVTAV 184
           A I GTAG TA L   +I   EE  L  +   VLVTGA+GGVGS+AV  L K GY V A 
Sbjct: 118 AAI-GTAGFTAAL---SIHRLEEHGLTPERGPVLVTGATGGVGSLAVS-LAKRGYTVEAS 172

Query: 185 TGKAENEKYLRSLGAKNIINKADLDKDARPLDKGLWDGVVDTVGGKILANALAQTRDNGI 244
           TGKA    YLR LGAK +     L +  RPLDK  W   VD VGG+ LA  L++ R  G 
Sbjct: 173 TGKAAEHDYLRVLGAKEV-----LAERIRPLDKQRWAAAVDPVGGRTLATVLSR-RYGGA 226

Query: 245 VAACGNASDYKLNTTVMPFIIRGVKLWGINSVTASIKRREFVWNEVKSLIDFEQLEKSIK 304
           VA  G     ++ TTV PFI+RGV L GI+SV     R   +W  +   +    LE+  +
Sbjct: 227 VAVSGLTGGAEVPTTVHPFILRGVSLLGIDSVYCPDLRLR-IWERLAGDLK-PDLERIAQ 284

Query: 305 TVSLEDLIDIYPKMLKGETSGRYIVDL 331
            +SL +L     ++L+GE  GR +V L
Sbjct: 285 EISLAELPQALKRILRGELRGRTVVRL 311


>1tt7A [b.35.1 - c.2.1] YHFP
          Length = 325

 Score =  186 bits (472), Expect = 8e-50
 Identities = 125/328 (38%), Positives = 176/328 (53%), Gaps = 7/328 (2%)

Query: 5   FKALVVNQESENFTREVKSIDKSFLKHGDVLVQVDYSDLNYKDALILNNGAKLVKEFPHI 64
           F+AL   + +++ +  VK+I    L    VL++V YS +NYKD L    G  +V+E+P I
Sbjct: 4   FQALQAEKNADDVSVHVKTISTEDLPKDGVLIKVAYSGINYKDGLAGKAGGNIVREYPLI 63

Query: 65  PGIDFAGTVLESDNSKFIKGDEVILTGWRVGEIYFGGYSQFAKVNGDYLVKKPKDISSKQ 124
            GID AGTV+ S++ +F +GDEVI T + +G    GG S++A V GD+LV  P+++S K+
Sbjct: 64  LGIDAAGTVVSSNDPRFAEGDEVIATSYELGVSRDGGLSEYASVPGDWLVPLPQNLSLKE 123

Query: 125 AMILGTAGLTALLCSFAIKAREELLLGEKVKDVLVTGASGGVGSIAVMILNKFGYDVTAV 184
           A + GTAG TA L   ++   E+  L  + K                  LNK GYDV A 
Sbjct: 124 A-VYGTAGFTAAL---SVHRLEQNGLSPE-KXXXXXXXXXXXXXXXXXXLNKRGYDVVAS 178

Query: 185 TGKAENEKYLRSLGAKNIINKADL-DKDARPLDKGLWDGVVDTVGGKILANALAQTRDNG 243
           TG  E   YL+ LGA  +I++ D+ D   + L K  W G VD VGGK LA+ L++ +  G
Sbjct: 179 TGNREAADYLKQLGASEVISREDVYDGTLKALSKQQWQGAVDPVGGKQLASLLSKIQYGG 238

Query: 244 IVAACGNASDYKLNTTVMPFIIRGVKLWGINSVTASIKRREFVWNEVKSLIDFEQLEKSI 303
            VA  G     ++  TV PFI+RGV L GI+SV      R  VW     L   + L    
Sbjct: 239 SVAVSGLTGGGEVPATVYPFILRGVSLLGIDSVYCP-DVRAAVWERSSDLKPDQLLTIVD 297

Query: 304 KTVSLEDLIDIYPKMLKGETSGRYIVDL 331
           + VSLE+       +L+    GR IV L
Sbjct: 298 REVSLEETPGALKDILQNRIQGRVIVKL 325


>1yb5A [b.35.1 - c.2.1] QUINONE OXIDOREDUCTASE
          Length = 324

 Score = 70.5 bits (171), Expect = 7e-15
 Identities = 62/236 (26%), Positives = 100/236 (42%), Gaps = 22/236 (9%)

Query: 30  KHGDVLVQVDYSDLNYKDALILNNGAKLVKEFPHIPGIDFAGTV--LESDNSKFIKGDEV 87
           K   VL++V    +N  +  I +         P+ PG D AG +  +  + S F KGD V
Sbjct: 29  KDHQVLIKVHACGVNPVETYIRSGTYSRKPLLPYTPGSDVAGVIEAVGDNASAFKKGDRV 88

Query: 88  ILTGWRVGEIYFGGYSQFAKVNGDYLVKKPKDISSKQAMILGTAGLTA---LLCSFAIKA 144
             +         GGY+++A      + K P+ +  KQ   +G    TA   L+ S  +KA
Sbjct: 89  FTSS-----TISGGYAEYALAADHTVYKLPEKLDFKQGAAIGIPYFTAYRALIHSACVKA 143

Query: 145 REELLLGEKVKDVLVTGASGGVGSIAVMILNKFGYDVTAVTGKAENEKYLRSLGAKNIIN 204
            E          VLV GASGGVG  A  I   +G  +    G  E +K +   GA  + N
Sbjct: 144 GES---------VLVHGASGGVGLAACQIARAYGLKILGTAGTEEGQKIVLQNGAHEVFN 194

Query: 205 KAD---LDKDARPLDKGLWDGVVDTVGGKILANALAQTRDNGIVAACGNASDYKLN 257
             +   +DK  + + +   D +++ +    L+  L+     G V   G+    ++N
Sbjct: 195 HREVNYIDKIKKYVGEKGIDIIIEMLANVNLSKDLSLLSHGGRVIVVGSRGTIEIN 250


>2vn8B [x.x.x] RETICULON-4-INTERACTING PROTEIN 1
          Length = 355

 Score = 67.0 bits (162), Expect = 7e-14
 Identities = 57/178 (32%), Positives = 88/178 (49%), Gaps = 18/178 (10%)

Query: 59  KEFPHIPGIDFAGTVLES--DNSKFIKGDEV--ILTGWRVGEIYFGGYSQFAKVNGDYLV 114
           +EFP   G D +G V+E   D   F  GDEV   +  W+ G +     S+F  V+G+ + 
Sbjct: 72  EEFPLTLGRDVSGVVMECGLDVKYFKPGDEVWAAVPPWKQGTL-----SEFVVVSGNEVS 126

Query: 115 KKPKDISSKQAMILGTAGLTALLCSFAIKAREELLLGEKV---KDVLVTGASGGVGSIAV 171
            KPK ++  QA  L    LTA      +       L +K    K VL+ GASGGVG+ A+
Sbjct: 127 HKPKSLTHTQAASLPYVALTAWSAINKVGG-----LNDKNCTGKRVLILGASGGVGTFAI 181

Query: 172 MILNKFGYDVTAVTGKAENEKYLRSLGAKNIINKADLDKDARPLDKGLWDGVVDTVGG 229
            ++  +   VTAV  +  +E  +R LGA ++I+      + +      +D ++D VGG
Sbjct: 182 QVMKAWDAHVTAVCSQDASE-LVRKLGADDVIDYKSGSVEEQLKSLKPFDFILDNVGG 238


>2vn8A [x.x.x] RETICULON-4-INTERACTING PROTEIN 1
          Length = 358

 Score = 67.0 bits (162), Expect = 7e-14
 Identities = 57/178 (32%), Positives = 88/178 (49%), Gaps = 18/178 (10%)

Query: 59  KEFPHIPGIDFAGTVLES--DNSKFIKGDEV--ILTGWRVGEIYFGGYSQFAKVNGDYLV 114
           +EFP   G D +G V+E   D   F  GDEV   +  W+ G +     S+F  V+G+ + 
Sbjct: 75  EEFPLTLGRDVSGVVMECGLDVKYFKPGDEVWAAVPPWKQGTL-----SEFVVVSGNEVS 129

Query: 115 KKPKDISSKQAMILGTAGLTALLCSFAIKAREELLLGEKV---KDVLVTGASGGVGSIAV 171
            KPK ++  QA  L    LTA      +       L +K    K VL+ GASGGVG+ A+
Sbjct: 130 HKPKSLTHTQAASLPYVALTAWSAINKVGG-----LNDKNCTGKRVLILGASGGVGTFAI 184

Query: 172 MILNKFGYDVTAVTGKAENEKYLRSLGAKNIINKADLDKDARPLDKGLWDGVVDTVGG 229
            ++  +   VTAV  +  +E  +R LGA ++I+      + +      +D ++D VGG
Sbjct: 185 QVMKAWDAHVTAVCSQDASE-LVRKLGADDVIDYKSGSVEEQLKSLKPFDFILDNVGG 241


>3fbgB [x.x.x] PUTATIVE ARGINATE LYASE
          Length = 332

 Score = 60.8 bits (146), Expect = 5e-12
 Identities = 46/174 (26%), Positives = 80/174 (45%), Gaps = 10/174 (5%)

Query: 33  DVLVQVDYSDLNYKDALILNNGAKLVKEFPHIPGIDFAGTVLESDN--SKFIKGDEVILT 90
           ++LV++    +N  D        +L+   P + G D  G V    N  + F +GD V  +
Sbjct: 32  EILVKIQSISVNPVDTK-----QRLMDVSPRVLGFDAIGVVESVGNEVTMFNQGDIVYYS 86

Query: 91  GWRVGEIYFGGYSQFAKVNGDYLVKKPKDISSKQAMILGTAGLTALLCSFAIKAREELLL 150
           G        G  +++  +N   + K PK+IS++QA+ L   G+TA    F +        
Sbjct: 87  G---SPDQNGSNAEYQLINERLVAKAPKNISAEQAVSLPLTGITAYETLFDVFGISRNRN 143

Query: 151 GEKVKDVLVTGASGGVGSIAVMILNKFGYDVTAVTGKAENEKYLRSLGAKNIIN 204
             + K +L+   +GGVGSIA  I   +G  V     + E  ++ + +GA  ++N
Sbjct: 144 ENEGKTLLIINGAGGVGSIATQIAKAYGLRVITTASRNETIEWTKKMGADIVLN 197


>3fbgA [x.x.x] PUTATIVE ARGINATE LYASE
          Length = 336

 Score = 60.5 bits (145), Expect = 7e-12
 Identities = 42/149 (28%), Positives = 70/149 (46%), Gaps = 5/149 (3%)

Query: 58  VKEFPHIPGIDFAGTVLESDN--SKFIKGDEVILTGWRVGEIYFGGYSQFAKVNGDYLVK 115
           V + P + G D  G V    N  + F +GD V  +G        G  +++  +N   + K
Sbjct: 55  VSKAPRVLGFDAIGVVESVGNEVTMFNQGDIVYYSG---SPDQNGSNAEYQLINERLVAK 111

Query: 116 KPKDISSKQAMILGTAGLTALLCSFAIKAREELLLGEKVKDVLVTGASGGVGSIAVMILN 175
            PK+IS++QA+ L   G+TA    F +          + K +L+   +GGVGSIA  I  
Sbjct: 112 APKNISAEQAVSLPLTGITAYETLFDVFGISRNRNENEGKTLLIINGAGGVGSIATQIAK 171

Query: 176 KFGYDVTAVTGKAENEKYLRSLGAKNIIN 204
            +G  V     + E  ++ + +GA  ++N
Sbjct: 172 AYGLRVITTASRNETIEWTKKMGADIVLN 200


>1rjwA [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE
          Length = 339

 Score = 59.7 bits (143), Expect = 1e-11
 Identities = 56/238 (23%), Positives = 105/238 (44%), Gaps = 25/238 (10%)

Query: 100 GGYSQFAKVNGDYLVKKPKDISSKQAMILGTAGLTALLCSFAIKAREELLLGEKVKDVLV 159
           GGY+++ +   DY+VK P ++S ++A  +  AG+T      A+K     + G K  + + 
Sbjct: 118 GGYAEYCRAAADYVVKIPDNLSFEEAAPIFCAGVTTYK---ALK-----VTGAKPGEWVA 169

Query: 160 TGASGGVGSIAVMILNKFGYDVTAVTGKAENEKYLRSLGAKNIIN--KADLDKDARPLDK 217
               GG+G +AV      G +V AV    E  +  + LGA  ++N  K D  K  +    
Sbjct: 170 IYGIGGLGHVAVQYAKAMGLNVVAVDIGDEKLELAKELGADLVVNPLKEDAAKFMKEKXX 229

Query: 218 GLWDGVVDTVGGKILANALAQTRDNGIVAACGNASDYKLNTTVMPFIIRGVKLWGINSVT 277
                           +A    R  G     G   + ++   +   ++ G+K+  I S+ 
Sbjct: 230 XXXXXXXXXXSKPAFQSAYNSIRRGGACVLVGLPPE-EMPIPIFDTVLNGIKI--IGSIV 286

Query: 278 ASIKRREFVWNEVKSLIDFEQLEKSIKTV----SLEDLIDIYPKMLKGETSGRYIVDL 331
            + K       +++  + F   E  +KT+     LE + +++ +MLKG+ +GR ++ L
Sbjct: 287 GTRK-------DLQEALQF-AAEGKVKTIIEVQPLEKINEVFDRMLKGQINGRVVLTL 336


>1v3vB [b.35.1 - c.2.1] LEUKOTRIENE B4 12-
          Length = 328

 Score = 52.8 bits (125), Expect = 1e-09
 Identities = 64/239 (26%), Positives = 98/239 (41%), Gaps = 20/239 (8%)

Query: 20  EVKSIDKSFLKHGDVLVQVDYSDLNYKDALILNNGAKLVKEFPHIPGIDFAGTVLESDNS 79
           E+K+++   LK+G+VL++  +  ++      +   +K +KE   + G   A  V+ES NS
Sbjct: 22  ELKTVELPPLKNGEVLLEALFLSVDP----YMRIASKRLKEGAVMMGQQVA-RVVESKNS 76

Query: 80  KFIKGDEVIL-TGWRVGEIYFGGYSQFAKVNGDYLVKKPKDISSKQAMILGTAGLTALLC 138
            F  G  V+  +GW    I  G      K+  ++  K P  ++      LGT G+  L  
Sbjct: 77  AFPAGSIVLAQSGWTTHFISDG--KGLEKLLTEWPDKLPLSLA------LGTIGMPGLTA 128

Query: 139 SFAIKAREELLLGEKVKDVLVTGASGGVGSIAVMILNKFGYDVTAVTGKAENEKYLRSLG 198
            F +     +  GE V   L              I    G  V    G  E   YL+ +G
Sbjct: 129 YFGLLEVCGVKGGETV---LXXXXXXXXXXXXXQIAKLKGCKVVGAAGSDEKIAYLKQIG 185

Query: 199 AKNIINKADLDKDARPLDKGLWDGV---VDTVGGKILANALAQTRDNGIVAACGNASDY 254
                N   ++     L K   DG     D VGG+ L   L+Q +D G +A CG  S Y
Sbjct: 186 FDAAFNYKTVNSLEEALKKASPDGYDCYFDNVGGEFLNTVLSQMKDFGKIAICGAISVY 244


>1v3uB [b.35.1 - c.2.1] LEUKOTRIENE B4 12-
          Length = 332

 Score = 52.8 bits (125), Expect = 1e-09
 Identities = 64/239 (26%), Positives = 98/239 (41%), Gaps = 20/239 (8%)

Query: 20  EVKSIDKSFLKHGDVLVQVDYSDLNYKDALILNNGAKLVKEFPHIPGIDFAGTVLESDNS 79
           E+K+++   LK+G+VL++  +  ++      +   +K +KE   + G   A  V+ES NS
Sbjct: 26  ELKTVELPPLKNGEVLLEALFLSVDP----YMRIASKRLKEGAVMMGQQVA-RVVESKNS 80

Query: 80  KFIKGDEVIL-TGWRVGEIYFGGYSQFAKVNGDYLVKKPKDISSKQAMILGTAGLTALLC 138
            F  G  V+  +GW    I  G      K+  ++  K P  ++      LGT G+  L  
Sbjct: 81  AFPAGSIVLAQSGWTTHFISDG--KGLEKLLTEWPDKLPLSLA------LGTIGMPGLTA 132

Query: 139 SFAIKAREELLLGEKVKDVLVTGASGGVGSIAVMILNKFGYDVTAVTGKAENEKYLRSLG 198
            F +     +  GE V   L              I    G  V    G  E   YL+ +G
Sbjct: 133 YFGLLEVCGVKGGETV---LXXXXXXXXXXXXXQIAKLKGCKVVGAAGSDEKIAYLKQIG 189

Query: 199 AKNIINKADLDKDARPLDKGLWDGV---VDTVGGKILANALAQTRDNGIVAACGNASDY 254
                N   ++     L K   DG     D VGG+ L   L+Q +D G +A CG  S Y
Sbjct: 190 FDAAFNYKTVNSLEEALKKASPDGYDCYFDNVGGEFLNTVLSQMKDFGKIAICGAISVY 248


>1v3tB [b.35.1 - c.2.1] LEUKOTRIENE B4 12-
          Length = 330

 Score = 52.8 bits (125), Expect = 1e-09
 Identities = 64/239 (26%), Positives = 98/239 (41%), Gaps = 20/239 (8%)

Query: 20  EVKSIDKSFLKHGDVLVQVDYSDLNYKDALILNNGAKLVKEFPHIPGIDFAGTVLESDNS 79
           E+K+++   LK+G+VL++  +  ++      +   +K +KE   + G   A  V+ES NS
Sbjct: 24  ELKTVELPPLKNGEVLLEALFLSVDP----YMRIASKRLKEGAVMMGQQVA-RVVESKNS 78

Query: 80  KFIKGDEVIL-TGWRVGEIYFGGYSQFAKVNGDYLVKKPKDISSKQAMILGTAGLTALLC 138
            F  G  V+  +GW    I  G      K+  ++  K P  ++      LGT G+  L  
Sbjct: 79  AFPAGSIVLAQSGWTTHFISDG--KGLEKLLTEWPDKLPLSLA------LGTIGMPGLTA 130

Query: 139 SFAIKAREELLLGEKVKDVLVTGASGGVGSIAVMILNKFGYDVTAVTGKAENEKYLRSLG 198
            F +     +  GE V   L              I    G  V    G  E   YL+ +G
Sbjct: 131 YFGLLEVCGVKGGETV---LXXXXXXXXXXXXXQIAKLKGCKVVGAAGSDEKIAYLKQIG 187

Query: 199 AKNIINKADLDKDARPLDKGLWDGV---VDTVGGKILANALAQTRDNGIVAACGNASDY 254
                N   ++     L K   DG     D VGG+ L   L+Q +D G +A CG  S Y
Sbjct: 188 FDAAFNYKTVNSLEEALKKASPDGYDCYFDNVGGEFLNTVLSQMKDFGKIAICGAISVY 246


>1v3tA [b.35.1 - c.2.1] LEUKOTRIENE B4 12-
          Length = 333

 Score = 52.8 bits (125), Expect = 1e-09
 Identities = 64/239 (26%), Positives = 98/239 (41%), Gaps = 20/239 (8%)

Query: 20  EVKSIDKSFLKHGDVLVQVDYSDLNYKDALILNNGAKLVKEFPHIPGIDFAGTVLESDNS 79
           E+K+++   LK+G+VL++  +  ++      +   +K +KE   + G   A  V+ES NS
Sbjct: 27  ELKTVELPPLKNGEVLLEALFLSVDP----YMRIASKRLKEGAVMMGQQVA-RVVESKNS 81

Query: 80  KFIKGDEVIL-TGWRVGEIYFGGYSQFAKVNGDYLVKKPKDISSKQAMILGTAGLTALLC 138
            F  G  V+  +GW    I  G      K+  ++  K P  ++      LGT G+  L  
Sbjct: 82  AFPAGSIVLAQSGWTTHFISDG--KGLEKLLTEWPDKLPLSLA------LGTIGMPGLTA 133

Query: 139 SFAIKAREELLLGEKVKDVLVTGASGGVGSIAVMILNKFGYDVTAVTGKAENEKYLRSLG 198
            F +     +  GE V   L              I    G  V    G  E   YL+ +G
Sbjct: 134 YFGLLEVCGVKGGETV---LXXXXXXXXXXXXXQIAKLKGCKVVGAAGSDEKIAYLKQIG 190

Query: 199 AKNIINKADLDKDARPLDKGLWDGV---VDTVGGKILANALAQTRDNGIVAACGNASDY 254
                N   ++     L K   DG     D VGG+ L   L+Q +D G +A CG  S Y
Sbjct: 191 FDAAFNYKTVNSLEEALKKASPDGYDCYFDNVGGEFLNTVLSQMKDFGKIAICGAISVY 249


>2dm6A [x.x.x] NADP-DEPENDENT LEUKOTRIENE B4 12-
          Length = 331

 Score = 52.8 bits (125), Expect = 1e-09
 Identities = 64/239 (26%), Positives = 98/239 (41%), Gaps = 20/239 (8%)

Query: 20  EVKSIDKSFLKHGDVLVQVDYSDLNYKDALILNNGAKLVKEFPHIPGIDFAGTVLESDNS 79
           E+K+++   LK+G+VL++  +  ++      +   +K +KE   + G   A  V+ES NS
Sbjct: 25  ELKTVELPPLKNGEVLLEALFLSVDP----YMRIASKRLKEGAVMMGQQVA-RVVESKNS 79

Query: 80  KFIKGDEVIL-TGWRVGEIYFGGYSQFAKVNGDYLVKKPKDISSKQAMILGTAGLTALLC 138
            F  G  V+  +GW    I  G      K+  ++  K P  ++      LGT G+  L  
Sbjct: 80  AFPAGSIVLAQSGWTTHFISDG--KGLEKLLTEWPDKLPLSLA------LGTIGMPGLTA 131

Query: 139 SFAIKAREELLLGEKVKDVLVTGASGGVGSIAVMILNKFGYDVTAVTGKAENEKYLRSLG 198
            F +     +  GE V   L              I    G  V    G  E   YL+ +G
Sbjct: 132 YFGLLEVCGVKGGETV---LXXXXXXXXXXXXXQIAKLKGCKVVGAAGSDEKIAYLKQIG 188

Query: 199 AKNIINKADLDKDARPLDKGLWDGV---VDTVGGKILANALAQTRDNGIVAACGNASDY 254
                N   ++     L K   DG     D VGG+ L   L+Q +D G +A CG  S Y
Sbjct: 189 FDAAFNYKTVNSLEEALKKASPDGYDCYFDNVGGEFLNTVLSQMKDFGKIAICGAISVY 247


>1wlyA [x.x.x] 2-HALOACRYLATE REDUCTASE
          Length = 322

 Score = 50.4 bits (119), Expect = 7e-09
 Identities = 44/156 (28%), Positives = 67/156 (42%), Gaps = 7/156 (4%)

Query: 100 GGYSQFAKVNGDYLVKKPKDISSKQAMILGTAGLTALLCSFAIKAREELLLGEKVKDVLV 159
           G YSQ      + L+K PKD+      + G   L  +   + +    ++  G+ V   L+
Sbjct: 85  GAYSQERLYPAEKLIKVPKDLDLDDVHLAGLM-LKGMTAQYLLHQTHKVKPGDYV---LI 140

Query: 160 TGASGGVGSIAVMILNKFGYDVTAVTGKAENEKYLRSLGAKNIINKA--DLDKDARPLDK 217
             A+GG+G I V      G  V       E  +  R LG  + IN +  D  +  R +  
Sbjct: 141 HAAAGGMGHIMVPWARHLGATVIGTVSTEEKAETARKLGCHHTINYSTQDFAEVVREITG 200

Query: 218 GLW-DGVVDTVGGKILANALAQTRDNGIVAACGNAS 252
           G   D V D++G   L  +L   R  G+ AA G+AS
Sbjct: 201 GKGVDVVYDSIGKDTLQKSLDCLRPRGMCAAYGHAS 236


>1lluA [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE
          Length = 341

 Score = 50.4 bits (119), Expect = 7e-09
 Identities = 75/330 (22%), Positives = 128/330 (38%), Gaps = 49/330 (14%)

Query: 32  GDVLVQVDYSDLNYKDALILNNGAKLVKEFPHIPGIDFAGTVLESDN--SKFIKGDEV-- 87
           G VLV+++ S + + D         +    P IPG +            ++  +GD V  
Sbjct: 31  GQVLVKIEASGVCHTDLHAAEGDWPVKPPLPFIPGHEXXXXXXXXXXXXTRVKEGDRVGI 90

Query: 88  ------------ILTGWRV--------GEIYFGGYSQFAKVNGDYLVKKPKDISSKQAMI 127
                        LTGW          G    GGY+++   + +Y+   PK++   +   
Sbjct: 91  PWLYTACGCCEHCLTGWETLCESQQNTGYSVNGGYAEYVLADPNYVGILPKNVEFAEIAP 150

Query: 128 LGTAGLTALLCSFAIKAREELLLGEKVKDVLVTGASGGVGSIAVMILNKFGYDVTAVTGK 187
           +  AG+T         AR         + V ++G  GG+G +AV      G  V A+   
Sbjct: 151 ILCAGVTVYKGLKQTNARPG-------QWVAISGI-GGLGHVAVQYARAMGLHVAAIDID 202

Query: 188 AENEKYLRSLGAKNIINKADLDK-DARPLDKGLWDGV-VDTVGGKILANALAQTRDNGIV 245
               +  R LGA   +N    D  +A   D G   GV V  V       A+   R  G +
Sbjct: 203 DAKLELARKLGASLTVNARQEDPVEAIQRDIGGAHGVLVTAVSNSAFGQAIGMARRGGTI 262

Query: 246 AACG-NASDYKLNTTVMPFIIRGVKLWGINSVTASIKRREFVWNEVKSLIDF--EQLEK- 301
           A  G    D+   T +   +++G+ + G    T +         +++  +DF  E L K 
Sbjct: 263 ALVGLPPGDFP--TPIFDVVLKGLHIAGSIVGTRA---------DLQEALDFAGEGLVKA 311

Query: 302 SIKTVSLEDLIDIYPKMLKGETSGRYIVDL 331
           +I    L+D+  I  +M  G+  GR ++++
Sbjct: 312 TIHPGKLDDINQILDQMRAGQIEGRIVLEM 341


>1v3uA [b.35.1 - c.2.1] LEUKOTRIENE B4 12-
          Length = 316

 Score = 48.9 bits (115), Expect = 2e-08
 Identities = 62/237 (26%), Positives = 94/237 (39%), Gaps = 22/237 (9%)

Query: 20  EVKSIDKSFLKHGDVLVQVDYSDLNYKDALILNNGAKLVKEFPHIPGIDFAGTVLESDNS 79
           E+K+++   LK+G+VL++  +  ++      +   +K +KE   + G   A  V+ES NS
Sbjct: 19  ELKTVELPPLKNGEVLLEALFLSVDP----YMRIASKRLKEGAVMMGQQVA-RVVESKNS 73

Query: 80  KFIKGDEVIL-TGWRVGEIYFGGYSQFAKVNGDYLVKKPKDISSKQAMILGTAGLTALLC 138
            F  G  V+  +GW    I           +G  L K         ++ LGT G+  L  
Sbjct: 74  AFPAGSIVLAQSGWTTHFIS----------DGKGLEKLLWPDKLPLSLALGTIGMPGLTA 123

Query: 139 SFAIKAREELLLGEKVKDVLVTGASGGVGSIAVMILNKFGYDVTAVTGKAENEKYLRSLG 198
            F +     +  GE V   L              I    G  V    G  E   YL+ +G
Sbjct: 124 YFGLLEVCGVKGGETV---LXXXXXXXXXXXXXQIAKLKGCKVVGAAGSDEKIAYLKQIG 180

Query: 199 AKNIINKADLDKDARPLDKGLWDGV---VDTVGGKILANALAQTRDNGIVAACGNAS 252
                N   ++     L K   DG     D VGG+ L   L+Q +D G +A CG  S
Sbjct: 181 FDAAFNYKTVNSLEEALKKASPDGYDCYFDNVGGEFLNTVLSQMKDFGKIAICGAIS 237


>2hcyA [x.x.x] ALCOHOL DEHYDROGENASE 1
          Length = 347

 Score = 47.0 bits (110), Expect = 8e-08
 Identities = 46/172 (26%), Positives = 73/172 (42%), Gaps = 20/172 (11%)

Query: 171 VMILNKFGYDVTAVTGKAENEKYLRSLGAKNIIN---KADLDKDARPLDKGLWDGVVD-T 226
           V      GY V  + G    E+  RS+G +  I+   + D+         G   GV++ +
Sbjct: 187 VQYAKAMGYRVLGIDGGEGKEELFRSIGGEVFIDFTKEKDIVGAVLKATDGGAHGVINVS 246

Query: 227 VGGKILANALAQTRDNGIVAACGNASDYKLNTTVMPFIIRGVKLWGINSVTASIKRREFV 286
           V    +  +    R NG     G  +  K  + V   +++ + + G            +V
Sbjct: 247 VSEAAIEASTRYVRANGTTVLVGMPAGAKCCSDVFNQVVKSISIVG-----------SYV 295

Query: 287 WN--EVKSLIDF--EQLEKS-IKTVSLEDLIDIYPKMLKGETSGRYIVDLNK 333
            N  + +  +DF    L KS IK V L  L +IY KM KG+  GRY+VD +K
Sbjct: 296 GNRADTREALDFFARGLVKSPIKVVGLSTLPEIYEKMEKGQIVGRYVVDTSK 347


>3gmsA [x.x.x] PUTATIVE NADPH:QUINONE REDUCTASE
          Length = 331

 Score = 46.6 bits (109), Expect = 1e-07
 Identities = 61/247 (24%), Positives = 103/247 (41%), Gaps = 27/247 (10%)

Query: 20  EVKSIDKSFLKHGDVLVQVDYSDLNYKDALILNNGAKLVKEFPHIPGIDFAGTVLESDNS 79
           E K+I+   LK  +V V++    +N  D + +          P+IPG +  G V   +  
Sbjct: 22  EYKNIEP--LKDNEVFVRMLVRPINPSDLIPITGAYAHRIPLPNIPGYEGVGIV--ENVG 77

Query: 80  KFIKGDEVILTGWRV----GEIYFGGYSQFAKVNGDYLVKKPKDISSKQAMILGTAGLTA 135
            F+  +   L G RV    GE   G + ++ K + D++V  P  I    A  +    LTA
Sbjct: 78  AFVSRE---LIGKRVLPLRGE---GTWQEYVKTSADFVVPIPDSIDDFTAAQMYINPLTA 131

Query: 136 -LLCSFAIKAREELLLGEKVKDVLVTGASGG-VGSIAVMILNKFGYDVTAVTGKAENEKY 193
            + C+  +  +          DVL+  A G  +G +   +     + + AVT   ++ + 
Sbjct: 132 WVTCTETLNLQRN--------DVLLVNACGSAIGHLFAQLSQILNFRLIAVTRNNKHTEE 183

Query: 194 LRSLGAKNII--NKADLDKDARPLDKGLW-DGVVDTVGGKILANALAQTRDNGIVAACGN 250
           L  LGA  +I  + A L +    L  G+  D  +D++GG          R NG     G 
Sbjct: 184 LLRLGAAYVIDTSTAPLYETVMELTNGIGADAAIDSIGGPDGNELAFSLRPNGHFLTIGL 243

Query: 251 ASDYKLN 257
            S  ++N
Sbjct: 244 LSGIQVN 250


>1zsvA [x.x.x] NADP-DEPENDENT LEUKOTRIENE B4 12-
          Length = 328

 Score = 44.7 bits (104), Expect = 4e-07
 Identities = 74/322 (22%), Positives = 122/322 (37%), Gaps = 29/322 (9%)

Query: 20  EVKSIDKSFLKHGDVLVQVDYSDLNYKDALILNNGAKLVKEFPHIPGIDFAGTVLESDNS 79
           E+K+ +   LK+G+VL++  +  ++      +   AK +KE   + G   A  V+ES N 
Sbjct: 22  ELKTSELPPLKNGEVLLEALFLTVDP----YMRVAAKRLKEGDTMMGQQVA-KVVESKNV 76

Query: 80  KFIKGDEVILT-GWRVGEIYFGGYSQFAKVNGDYLVKKPKDISSKQAMILGTAGLTALLC 138
              KG  V+ + GW    I  G      K     L + P  I    A  LGT G+  L  
Sbjct: 77  ALPKGTIVLASPGWTTHSISDG------KDLEKLLTEWPDTIPLSLA--LGTVGMPGLTA 128

Query: 139 SFAIKAREELLLGEKVKDVLVTGASGGVGSIAVMILNKF-GYDVTAVTGKAENEKYLRSL 197
            F +      + G K  +                   K  G  V    G  E   YL+ L
Sbjct: 129 YFGLLE----ICGVKGGETXXXXXXXXXXXXXXXXXXKLKGCKVVGAVGSDEKVAYLQKL 184

Query: 198 GAKNIINKADLDKDARPLDKGLWDGV---VDTVGGKILANALAQTRDNGIVAACGNASDY 254
           G   + N   ++     L K   DG     D VGG+     + Q +  G +A CG  S Y
Sbjct: 185 GFDVVFNYKTVESLEETLKKASPDGYDCYFDNVGGEFSNTVIGQMKKFGRIAICGAISTY 244

Query: 255 KLNTTVMPFIIRGVKLWGINSVTASI-------KRREFVWNEVKSLIDFEQLEKSIKTVS 307
                        + ++    + A +        R++ + + +K +++ +   K      
Sbjct: 245 NRTXXXXXXXXXEIVIYQELRMEAFVVYRWQGDARQKALKDLLKWVLEGKIQYKEYIIEG 304

Query: 308 LEDLIDIYPKMLKGETSGRYIV 329
            E++   +  MLKG+  G+ IV
Sbjct: 305 FENMPAAFMGMLKGDNLGKTIV 326


>2j3hB [x.x.x] NADP-DEPENDENT OXIDOREDUCTASE P1
          Length = 345

 Score = 44.3 bits (103), Expect = 5e-07
 Identities = 49/189 (25%), Positives = 78/189 (41%), Gaps = 17/189 (8%)

Query: 73  VLESDNSKFIKGDEVILTGWRVGEIYFGGYSQFAKVNGDYLVKKPKDIS-SKQAMILGTA 131
           ++ES +  + KGD +    W  G + +  YS    +   +   +  D+  S    +LG  
Sbjct: 86  IIESGHPDYKKGDLL----W--GIVAWEEYSVITPMTHAHFKIQHTDVPLSYYTGLLGMP 139

Query: 132 GLTALLCSFAIKAREELLLGEKVKDVLVTGASGGVGSIAVMILNKFGYDVTAVTGKAENE 191
           G+TA    + + + +E   GE V    V+ ASG VG +   +    G  V    G  E  
Sbjct: 140 GMTAYAGFYEVCSPKE---GETV---YVSAASGAVGQLVGQLAKMMGCYVVGSAGSKEKV 193

Query: 192 KYLRSL----GAKNIINKADLDKDARPLDKGLWDGVVDTVGGKILANALAQTRDNGIVAA 247
             L++      A N   ++DL    +       D   + VGGK+L   L     +G +A 
Sbjct: 194 DLLKTKFGFDDAFNYKEESDLTAALKRCFPNGIDIYFENVGGKMLDAVLVNMNMHGRIAV 253

Query: 248 CGNASDYKL 256
           CG  S Y L
Sbjct: 254 CGMISQYNL 262


>2j3hA [x.x.x] NADP-DEPENDENT OXIDOREDUCTASE P1
          Length = 336

 Score = 44.3 bits (103), Expect = 5e-07
 Identities = 49/189 (25%), Positives = 78/189 (41%), Gaps = 17/189 (8%)

Query: 73  VLESDNSKFIKGDEVILTGWRVGEIYFGGYSQFAKVNGDYLVKKPKDIS-SKQAMILGTA 131
           ++ES +  + KGD +    W  G + +  YS    +   +   +  D+  S    +LG  
Sbjct: 77  IIESGHPDYKKGDLL----W--GIVAWEEYSVITPMTHAHFKIQHTDVPLSYYTGLLGMP 130

Query: 132 GLTALLCSFAIKAREELLLGEKVKDVLVTGASGGVGSIAVMILNKFGYDVTAVTGKAENE 191
           G+TA    + + + +E   GE V    V+ ASG VG +   +    G  V    G  E  
Sbjct: 131 GMTAYAGFYEVCSPKE---GETV---YVSAASGAVGQLVGQLAKMMGCYVVGSAGSKEKV 184

Query: 192 KYLRSL----GAKNIINKADLDKDARPLDKGLWDGVVDTVGGKILANALAQTRDNGIVAA 247
             L++      A N   ++DL    +       D   + VGGK+L   L     +G +A 
Sbjct: 185 DLLKTKFGFDDAFNYKEESDLTAALKRCFPNGIDIYFENVGGKMLDAVLVNMNMHGRIAV 244

Query: 248 CGNASDYKL 256
           CG  S Y L
Sbjct: 245 CGMISQYNL 253


>1qorA [b.35.1 - c.2.1] QUINONE OXIDOREDUCTASE
          Length = 326

 Score = 41.6 bits (96), Expect = 3e-06
 Identities = 51/182 (28%), Positives = 74/182 (40%), Gaps = 17/182 (9%)

Query: 79  SKFIKGDEVILTGWRV--GEIYFGGYSQFAKVNGDYLVKKPKDISSKQAMILGTAGLTA- 135
           SK   G + I  G RV   +   G YS    +  D     P  IS +QA      GLT  
Sbjct: 69  SKVGSGVKHIKAGDRVVYAQSALGAYSSVHNIIADKAAILPAAISFEQAAASFLKGLTVY 128

Query: 136 --LLCSFAIKAREELLLGEKVKDVLVTGASGGVGSIAVMILNKFGYDVTAVTGKAENEKY 193
             L  ++ IK  E+ L            A+GGVG IA       G  +    G A+  + 
Sbjct: 129 YLLRKTYEIKPDEQFLFH---------AAAGGVGLIACQWAKALGAKLIGTVGTAQKAQS 179

Query: 194 LRSLGAKNIIN--KADLDKDARPLDKGLWDGVV-DTVGGKILANALAQTRDNGIVAACGN 250
               GA  +IN  + DL +  + +  G    VV D+VG      +L   +  G++ + GN
Sbjct: 180 ALKAGAWQVINYREEDLVERLKEITGGKKVRVVYDSVGRDTWERSLDCLQRRGLMVSFGN 239

Query: 251 AS 252
           +S
Sbjct: 240 SS 241


>1h2bB [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE
          Length = 344

 Score = 41.2 bits (95), Expect = 4e-06
 Identities = 44/137 (32%), Positives = 66/137 (48%), Gaps = 12/137 (8%)

Query: 100 GGYSQFAKVNGDYLVKKPKDISSKQAM---ILGTAGLTALLCSFAIKAREELLLGEKVKD 156
           GG+++F + +   ++K PKDIS ++ +    L  AG+TA       KA   L  G  V  
Sbjct: 120 GGFAEFMRTSHRSVIKLPKDISREKLVEMAPLADAGITAYRA--VKKAARTLYPGAYVAI 177

Query: 157 VLVTGASGGVGSIAVMILNKF-GYDVTAVTGKAENEKYLRSLGAKNIIN-KADLDKDARP 214
           V V    GG+G IAV +L       V A+  K E  K    LGA ++++ + D  K    
Sbjct: 178 VGV----GGLGHIAVQLLKVMTPATVIALDVKEEKLKLAERLGADHVVDARRDPVKQVME 233

Query: 215 LDKGLWDGV-VDTVGGK 230
           L +G    V +D VG +
Sbjct: 234 LTRGRGVNVAMDFVGSQ 250


>1h2bA [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE
          Length = 343

 Score = 41.2 bits (95), Expect = 4e-06
 Identities = 44/137 (32%), Positives = 66/137 (48%), Gaps = 12/137 (8%)

Query: 100 GGYSQFAKVNGDYLVKKPKDISSKQAM---ILGTAGLTALLCSFAIKAREELLLGEKVKD 156
           GG+++F + +   ++K PKDIS ++ +    L  AG+TA       KA   L  G  V  
Sbjct: 119 GGFAEFMRTSHRSVIKLPKDISREKLVEMAPLADAGITAYRA--VKKAARTLYPGAYVAI 176

Query: 157 VLVTGASGGVGSIAVMILNKF-GYDVTAVTGKAENEKYLRSLGAKNIIN-KADLDKDARP 214
           V V    GG+G IAV +L       V A+  K E  K    LGA ++++ + D  K    
Sbjct: 177 VGV----GGLGHIAVQLLKVMTPATVIALDVKEEKLKLAERLGADHVVDARRDPVKQVME 232

Query: 215 LDKGLWDGV-VDTVGGK 230
           L +G    V +D VG +
Sbjct: 233 LTRGRGVNVAMDFVGSQ 249


>2c0cB [x.x.x] ZINC BINDING ALCOHOL DEHYDROGENASE, DOMAIN
          Length = 342

 Score = 40.4 bits (93), Expect = 8e-06
 Identities = 70/269 (26%), Positives = 109/269 (40%), Gaps = 35/269 (13%)

Query: 8   LVVNQESENFTREVKSIDKS----FLKHGDVLVQ-----VDYSDLNYKDALILNNGAKLV 58
           LVV + S NF RE  ++ +         GD+LV+     V+ SD+NY            V
Sbjct: 7   LVVTRLSPNF-REAVTLSRDCPVPLPGDGDLLVRNRFVGVNASDINYS----AGRYDPSV 61

Query: 59  KEFPHIPGIDFAGTVLESDNSKFIKGDEVILTGWRVGEIYFGGYSQFAKVNGDYLVKKPK 118
           K  P   G +  G V+    S   +       G  V  +  G ++++  V     +  P 
Sbjct: 62  KP-PFDIGFEGIGEVVALGLSASAR----YTVGQAVAYMAPGSFAEYTVVPAS--IATPV 114

Query: 119 DISSKQAMILGTAGLTALLCSFAIKAREELLLGEKVKDVLVTGASGGVGSIAVMILNKFG 178
                + + L  +G TA +   ++K    L  G+KV   LVT A+GG G  A+ +  K  
Sbjct: 115 PSVKPEYLTLLVSGTTAYI---SLKELGGLSEGKKV---LVTAAAGGTGQFAMQLSKKAK 168

Query: 179 YDVTAVTGKAENEKYLRSLGAKNIIN-----KADLDKDARPLDKGLWDGVVDTVGGKILA 233
             V       E   +L+SLG    IN        + K   P  +G+ D V ++VGG +  
Sbjct: 169 CHVIGTCSSDEKSAFLKSLGCDRPINYKTEPVGTVLKQEYP--EGV-DVVYESVGGAMFD 225

Query: 234 NALAQTRDNGIVAACGNASDYKLNTTVMP 262
            A+      G +   G  S Y+  T + P
Sbjct: 226 LAVDALATKGRLIVIGFISGYQTPTGLSP 254


>2c0cA [x.x.x] ZINC BINDING ALCOHOL DEHYDROGENASE, DOMAIN
          Length = 353

 Score = 40.4 bits (93), Expect = 8e-06
 Identities = 70/269 (26%), Positives = 109/269 (40%), Gaps = 35/269 (13%)

Query: 8   LVVNQESENFTREVKSIDKS----FLKHGDVLVQ-----VDYSDLNYKDALILNNGAKLV 58
           LVV + S NF RE  ++ +         GD+LV+     V+ SD+NY            V
Sbjct: 18  LVVTRLSPNF-REAVTLSRDCPVPLPGDGDLLVRNRFVGVNASDINYS----AGRYDPSV 72

Query: 59  KEFPHIPGIDFAGTVLESDNSKFIKGDEVILTGWRVGEIYFGGYSQFAKVNGDYLVKKPK 118
           K  P   G +  G V+    S   +       G  V  +  G ++++  V     +  P 
Sbjct: 73  KP-PFDIGFEGIGEVVALGLSASAR----YTVGQAVAYMAPGSFAEYTVVPAS--IATPV 125

Query: 119 DISSKQAMILGTAGLTALLCSFAIKAREELLLGEKVKDVLVTGASGGVGSIAVMILNKFG 178
                + + L  +G TA +   ++K    L  G+KV   LVT A+GG G  A+ +  K  
Sbjct: 126 PSVKPEYLTLLVSGTTAYI---SLKELGGLSEGKKV---LVTAAAGGTGQFAMQLSKKAK 179

Query: 179 YDVTAVTGKAENEKYLRSLGAKNIIN-----KADLDKDARPLDKGLWDGVVDTVGGKILA 233
             V       E   +L+SLG    IN        + K   P  +G+ D V ++VGG +  
Sbjct: 180 CHVIGTCSSDEKSAFLKSLGCDRPINYKTEPVGTVLKQEYP--EGV-DVVYESVGGAMFD 236

Query: 234 NALAQTRDNGIVAACGNASDYKLNTTVMP 262
            A+      G +   G  S Y+  T + P
Sbjct: 237 LAVDALATKGRLIVIGFISGYQTPTGLSP 265


>2eihA [x.x.x] ALCOHOL DEHYDROGENASE
          Length = 343

 Score = 38.1 bits (87), Expect = 4e-05
 Identities = 38/152 (25%), Positives = 61/152 (40%), Gaps = 15/152 (9%)

Query: 94  VGEIYFGGYSQFAKVNGDYLVKKPKDISSKQAMILGTAGLTA---LLCSFAIKAREELLL 150
           +GE   G Y+++  +    L  KPK++S ++A  +    LTA   ++    ++  +    
Sbjct: 113 LGEHRHGTYAEYVVLPEANLAPKPKNLSFEEAAAIPLTFLTAWQMVVDKLGVRPGD---- 168

Query: 151 GEKVKDVLVTGASGGVGSIAVMILNKFGYDVTAVTGKAENEKYLRSLGAKNIIN--KADL 208
                DVLV           + I   FG  V A  G  +  +  ++LGA   +N    D 
Sbjct: 169 -----DVLVMXXXXXXXXXXIQIAKLFGARVIATAGSEDKLRRAKALGADETVNYTHPDW 223

Query: 209 DKDARPLDKGLW-DGVVDTVGGKILANALAQT 239
            K+ R L  G   D VVD  G       +  T
Sbjct: 224 PKEVRRLTGGKGADKVVDHTGALYFEGVIKAT 255


>2j8zA [x.x.x] QUINONE OXIDOREDUCTASE
          Length = 330

 Score = 37.4 bits (85), Expect = 6e-05
 Identities = 50/217 (23%), Positives = 83/217 (38%), Gaps = 23/217 (10%)

Query: 21  VKSIDKSFLKHGDVLVQVDYSDLNYKDALILNNGAKLVKEFPHIPGIDFAGTVLESDNSK 80
           VK + K     G+VL++V  S LN  D +             +I G++ +G V E     
Sbjct: 19  VKEVAKPSPGEGEVLLKVAASALNRADLMQRQGQYDPPPGASNILGLEASGHVAELGPG- 77

Query: 81  FIKGDEVILTGWRVGEIYF-----GGYSQFAKVNGDYLVKKPKDISSKQAMILGTAGLTA 135
                      W++G+        GG +Q+  V    L+  P+ ++  QA  +  A LTA
Sbjct: 78  --------CQHWKIGDTAMALLPGGGQAQYVTVPEGLLMPIPEGLTLTQAAAIPEAWLTA 129

Query: 136 LLCSFAIKAREELLLGEKVKDVLVTGASGGVGSIAVMILNKFGYDVTAVTGKAENEKYLR 195
                 +     +  G+    VL+     GVG+ A+ +    G       G  +  +   
Sbjct: 130 FQLLHLV---GNVQAGDY---VLIHAGLSGVGTAAIQLTRMAGAIPLVTAGSQKKLQMAE 183

Query: 196 SLGAKNIIN--KADLDKDARPLDKGLW-DGVVDTVGG 229
            LGA    N  K D  +      KG   + ++D +GG
Sbjct: 184 KLGAAAGFNYKKEDFSEATLKFTKGAGVNLILDCIGG 220


>2obyA [x.x.x] PUTATIVE QUINONE OXIDOREDUCTASE
          Length = 334

 Score = 37.0 bits (84), Expect = 8e-05
 Identities = 51/217 (23%), Positives = 85/217 (39%), Gaps = 22/217 (10%)

Query: 21  VKSIDKSFLKHGDVLVQVDYSDLNYKDALILNNGAKLVKEFPHIPGIDFAGTVLESDNSK 80
           VK + K     G+VL++V  S LN  D +             +I G++ +G V E     
Sbjct: 19  VKEVAKPSPGEGEVLLKVAASALNRADLMQRQGQYDPPPGASNILGLEASGHVAELGPG- 77

Query: 81  FIKGDEVILTGWRVGEIYF-----GGYSQFAKVNGDYLVKKPKDISSKQAMILGTAGLTA 135
             +G       W++G+        GG +Q+  V    L+  P+ ++  QA  +  A LTA
Sbjct: 78  -CQGH------WKIGDTAMALLPGGGQAQYVTVPEGLLMPIPEGLTLTQAAAIPEAWLTA 130

Query: 136 LLCSFAIKAREELLLGEKVKDVLVTGASGGVGSIAVMILNKFGYDVTAVTGKAENEKYLR 195
                 +     +  G+    VL+     GVG+ A+ +    G       G  +  +   
Sbjct: 131 FQLLHLV---GNVQAGDY---VLIHAGLSGVGTAAIQLTRMAGAIPLVTAGSQKKLQMAE 184

Query: 196 SLGAKNIIN--KADLDKDARPLDKGLW-DGVVDTVGG 229
            LGA    N  K D  +      KG   + ++D +GG
Sbjct: 185 KLGAAAGFNYKKEDFSEATLKFTKGAGVNLILDCIGG 221


>2zb3A [x.x.x] PROSTAGLANDIN REDUCTASE 2
          Length = 345

 Score = 36.2 bits (82), Expect = 1e-04
 Identities = 45/189 (23%), Positives = 72/189 (38%), Gaps = 14/189 (7%)

Query: 71  GTVLESDNSKFIKGDEVILTGWRVGEIYFGGYSQFAKVNGDYLVK-KPKDISSKQAMILG 129
           G V ES + K  KGD V    W         +   A ++G+ L K  P+ +    +  LG
Sbjct: 79  GVVEESKHQKLTKGDFVTSFYWP--------WQTKAILDGNGLEKVDPQLVDGHLSYFLG 130

Query: 130 TAGLTALLCSFAIKAREELLLGEKVKDVLVTGASGGVGSIAVMILNKFGYD-VTAVTGKA 188
             G+  L     ++ +  +  G   + ++V             I +  G   V  + G  
Sbjct: 131 AIGMPGLTSLIGVQEKGHISAGSN-QTMVVXXXXXXXXXXXXQIGHLLGCSRVVGICGTQ 189

Query: 189 ENEKYLRS-LGAKNIIN--KADLDKDARPLDKGLWDGVVDTVGGKILANALAQTRDNGIV 245
           E   +L S LG    +N    ++ +  R    G  D   D VGG I    ++Q  +N  +
Sbjct: 190 EKCLFLTSELGFDAAVNYKTGNVAEQLREACPGGVDVYFDNVGGDISNAVISQMNENSHI 249

Query: 246 AACGNASDY 254
             CG  S Y
Sbjct: 250 ILCGQISQY 258


>3gqvA [x.x.x] ENOYL REDUCTASE
          Length = 352

 Score = 36.2 bits (82), Expect = 1e-04
 Identities = 41/149 (27%), Positives = 62/149 (41%), Gaps = 11/149 (7%)

Query: 66  GIDFAGTVLE--SDNSKFIKGDEVILTGWRVGEIY--FGGYSQFAKVNGDYLVKKPKDIS 121
           G D+AGTV+   SD +    GD V      +       G +SQ+    G    K PK +S
Sbjct: 59  GTDYAGTVVAVGSDVTHIQVGDRVYGAQNEMCPRTPDQGAFSQYTVTRGRVWAKIPKGLS 118

Query: 122 SKQAMIL----GTAGLTALLCSFAI--KAREELLLGEKVKDVLVTGASGGVGSIAVMILN 175
            +QA  L     TAGL   L    +   + ++     K   VLV G S    ++ + +L 
Sbjct: 119 FEQAAALPAGISTAGLAMKLLGLPLPSPSADQPPTHSKPVYVLVYGGSTATATVTMQMLR 178

Query: 176 KFGYDVTAVTGKAENEKYLRSLGAKNIIN 204
             GY +   T    N    +S GA+ + +
Sbjct: 179 LSGY-IPIATCSPHNFDLAKSRGAEEVFD 206


>3b70A [x.x.x] ENOYL REDUCTASE
          Length = 357

 Score = 36.2 bits (82), Expect = 1e-04
 Identities = 41/149 (27%), Positives = 62/149 (41%), Gaps = 11/149 (7%)

Query: 66  GIDFAGTVLE--SDNSKFIKGDEVILTGWRVGEIY--FGGYSQFAKVNGDYLVKKPKDIS 121
           G D+AGTV+   SD +    GD V      +       G +SQ+    G    K PK +S
Sbjct: 64  GTDYAGTVVAVGSDVTHIQVGDRVYGAQNEMCPRTPDQGAFSQYTVTRGRVWAKIPKGLS 123

Query: 122 SKQAMIL----GTAGLTALLCSFAI--KAREELLLGEKVKDVLVTGASGGVGSIAVMILN 175
            +QA  L     TAGL   L    +   + ++     K   VLV G S    ++ + +L 
Sbjct: 124 FEQAAALPAGISTAGLAMKLLGLPLPSPSADQPPTHSKPVYVLVYGGSTATATVTMQMLR 183

Query: 176 KFGYDVTAVTGKAENEKYLRSLGAKNIIN 204
             GY +   T    N    +S GA+ + +
Sbjct: 184 LSGY-IPIATCSPHNFDLAKSRGAEEVFD 211


>3b6zA [x.x.x] ENOYL REDUCTASE
          Length = 352

 Score = 36.2 bits (82), Expect = 1e-04
 Identities = 41/149 (27%), Positives = 62/149 (41%), Gaps = 11/149 (7%)

Query: 66  GIDFAGTVLE--SDNSKFIKGDEVILTGWRVGEIY--FGGYSQFAKVNGDYLVKKPKDIS 121
           G D+AGTV+   SD +    GD V      +       G +SQ+    G    K PK +S
Sbjct: 63  GTDYAGTVVAVGSDVTHIQVGDRVYGAQNEMCPRTPDQGAFSQYTVTRGRVWAKIPKGLS 122

Query: 122 SKQAMIL----GTAGLTALLCSFAI--KAREELLLGEKVKDVLVTGASGGVGSIAVMILN 175
            +QA  L     TAGL   L    +   + ++     K   VLV G S    ++ + +L 
Sbjct: 123 FEQAAALPAGISTAGLAMKLLGLPLPSPSADQPPTHSKPVYVLVYGGSTATATVTMQMLR 182

Query: 176 KFGYDVTAVTGKAENEKYLRSLGAKNIIN 204
             GY +   T    N    +S GA+ + +
Sbjct: 183 LSGY-IPIATCSPHNFDLAKSRGAEEVFD 210


>2iodB [x.x.x] DIHYDROFLAVONOL 4-REDUCTASE
          Length = 326

 Score = 34.3 bits (77), Expect = 5e-04
 Identities = 20/48 (41%), Positives = 27/48 (56%)

Query: 150 LGEKVKDVLVTGASGGVGSIAVMILNKFGYDVTAVTGKAENEKYLRSL 197
           +G + + V VTGASG +GS  VM L + GY V A      N K ++ L
Sbjct: 1   MGSQSETVCVTGASGFIGSWLVMRLLERGYTVRATVRDPTNVKKVKHL 48


>3f9iB [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] REDUCTASE
          Length = 229

 Score = 34.3 bits (77), Expect = 5e-04
 Identities = 19/44 (43%), Positives = 26/44 (59%), Gaps = 3/44 (6%)

Query: 155 KDVLVTGASGGVGSIAVMILNKFGYDVTAVTGKAENEKYLRSLG 198
           K  L+TGAS G+GS    +L+K G   + V     NE+ L+SLG
Sbjct: 7   KTSLITGASSGIGSAIARLLHKLG---SKVIISGSNEEKLKSLG 47


>3f9iA [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] REDUCTASE
          Length = 220

 Score = 34.3 bits (77), Expect = 5e-04
 Identities = 19/44 (43%), Positives = 26/44 (59%), Gaps = 3/44 (6%)

Query: 155 KDVLVTGASGGVGSIAVMILNKFGYDVTAVTGKAENEKYLRSLG 198
           K  L+TGAS G+GS    +L+K G   + V     NE+ L+SLG
Sbjct: 7   KTSLITGASSGIGSAIARLLHKLG---SKVIISGSNEEKLKSLG 47


  Database: 95pdb09Oct16x
    Posted date:  Nov 2, 2009  3:15 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.317    0.136    0.429 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 827,899,320
Number of extensions: 34704357
Number of successful extensions: 88933
Number of sequences better than 1.0e-03: 2071
Number of HSP's gapped: 87520
Number of HSP's successfully gapped: 2139
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.2 bits)