BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= AAZ22059.1 pubi0 AAZ22059.1 GIB00256CH01 "Putative
NADPH-quinone reductase"
         (189 letters)

Database: 95pdb09Oct16x 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

1zx1B [x.x.x] NRH DEHYDROGENASE [QUINONE] 2                            79   1e-17
1sg0A [c.23.5 (1qr2A)] NRH DEHYDROGENASE [QUINONE] 2                   79   1e-17
3fw1A [x.x.x] RIBOSYLDIHYDRONICOTINAMIDE DEHYDROGENASE                 79   1e-17
1zx1A [x.x.x] NRH DEHYDROGENASE [QUINONE] 2                            78   2e-17
1qrdA [c.23.5] QUINONE-REDUCTASE                                       69   9e-15
1dxqA [c.23.5] QUINONE REDUCTASE                                       68   2e-14
1qbgA [c.23.5] NAD(P)H DEHYDROGENASE [QUINONE] 1                       62   2e-12
1kbqB [c.23.5] NAD(P)H DEHYDROGENASE [QUINONE] 1                       61   2e-12
1kbqA [c.23.5] NAD(P)H DEHYDROGENASE [QUINONE] 1                       61   2e-12
1h69A [c.23.5] NAD(P)H DEHYDROGENASE [QUINONE] 1                       61   2e-12
1d4aA [c.23.5] QUINONE REDUCTASE                                       61   2e-12
3f2vA [x.x.x] GENERAL STRESS PROTEIN 14                                40   7e-06
3eywB [x.x.x] C-TERMINAL DOMAIN OF GLUTATHIONE-REGULATED               36   8e-05
3eywA [x.x.x] C-TERMINAL DOMAIN OF GLUTATHIONE-REGULATED               36   8e-05
2v9cA [x.x.x] FMN-DEPENDENT NADH-AZOREDUCTASE 1                        34   3e-04

>1zx1B [x.x.x] NRH DEHYDROGENASE [QUINONE] 2
          Length = 229

 Score = 78.6 bits (192), Expect = 1e-17
 Identities = 50/204 (24%), Positives = 88/204 (43%), Gaps = 34/204 (16%)

Query: 2   KKIFLLYGHYNEKSFNAAIRDTFIKTAEKNGNTVDCVDLYKDKFNP-------------- 47
           KK+ ++Y H   KSFN ++++  +    + G TV   DLY   F P              
Sbjct: 2   KKVLIVYAHQEPKSFNGSLKNVAVDELSRQGCTVTVSDLYAMNFEPRATDKDITGTLSNP 61

Query: 48  -----------VFAGEQAGEDVLDHRRRIEKCDIIVLIAPIWNFRMPAIVEGWIDKVLSP 96
                       +       D+ D ++++ + D+++   P++ F +PAI++GW+D+VL  
Sbjct: 62  EVFNYGVETHEAYKQRSLASDITDEQKKVREADLVIFQFPLYWFSVPAILKGWMDRVLCQ 121

Query: 97  PWAYTFKKLVGNYGYPMGNLKDKKAIIFCTYGSPRLAVTTFFLNLPIR----RLKRGVFH 152
            +A+          Y  G L+ K A++  T G      T   +N   R     L+ G  H
Sbjct: 122 GFAFDIPGF-----YDSGLLQGKLALLSVTTGGTAEMYTKTGVNGDSRYFLWPLQHGTLH 176

Query: 153 MCGIYNIVYRRYFAVPFVTDEKRK 176
            CG   +  +  FA    ++E+RK
Sbjct: 177 FCGFKVLAPQISFAPEIASEEERK 200


>1sg0A [c.23.5 (1qr2A)] NRH DEHYDROGENASE [QUINONE] 2
          Length = 230

 Score = 78.6 bits (192), Expect = 1e-17
 Identities = 50/204 (24%), Positives = 88/204 (43%), Gaps = 34/204 (16%)

Query: 2   KKIFLLYGHYNEKSFNAAIRDTFIKTAEKNGNTVDCVDLYKDKFNP-------------- 47
           KK+ ++Y H   KSFN ++++  +    + G TV   DLY   F P              
Sbjct: 3   KKVLIVYAHQEPKSFNGSLKNVAVDELSRQGCTVTVSDLYAMNFEPRATDKDITGTLSNP 62

Query: 48  -----------VFAGEQAGEDVLDHRRRIEKCDIIVLIAPIWNFRMPAIVEGWIDKVLSP 96
                       +       D+ D ++++ + D+++   P++ F +PAI++GW+D+VL  
Sbjct: 63  EVFNYGVETHEAYKQRSLASDITDEQKKVREADLVIFQFPLYWFSVPAILKGWMDRVLCQ 122

Query: 97  PWAYTFKKLVGNYGYPMGNLKDKKAIIFCTYGSPRLAVTTFFLNLPIR----RLKRGVFH 152
            +A+          Y  G L+ K A++  T G      T   +N   R     L+ G  H
Sbjct: 123 GFAFDIPGF-----YDSGLLQGKLALLSVTTGGTAEMYTKTGVNGDSRYFLWPLQHGTLH 177

Query: 153 MCGIYNIVYRRYFAVPFVTDEKRK 176
            CG   +  +  FA    ++E+RK
Sbjct: 178 FCGFKVLAPQISFAPEIASEEERK 201


>3fw1A [x.x.x] RIBOSYLDIHYDRONICOTINAMIDE DEHYDROGENASE
          Length = 228

 Score = 78.6 bits (192), Expect = 1e-17
 Identities = 50/204 (24%), Positives = 88/204 (43%), Gaps = 34/204 (16%)

Query: 2   KKIFLLYGHYNEKSFNAAIRDTFIKTAEKNGNTVDCVDLYKDKFNP-------------- 47
           KK+ ++Y H   KSFN ++++  +    + G TV   DLY   F P              
Sbjct: 2   KKVLIVYAHQEPKSFNGSLKNVAVDELSRQGCTVTVSDLYAMNFEPRATDKDITGTLSNP 61

Query: 48  -----------VFAGEQAGEDVLDHRRRIEKCDIIVLIAPIWNFRMPAIVEGWIDKVLSP 96
                       +       D+ D ++++ + D+++   P++ F +PAI++GW+D+VL  
Sbjct: 62  EVFNYGVETHEAYKQRSLASDITDEQKKVREADLVIFQFPLYWFSVPAILKGWMDRVLCQ 121

Query: 97  PWAYTFKKLVGNYGYPMGNLKDKKAIIFCTYGSPRLAVTTFFLNLPIR----RLKRGVFH 152
            +A+          Y  G L+ K A++  T G      T   +N   R     L+ G  H
Sbjct: 122 GFAFDIPGF-----YDSGLLQGKLALLSVTTGGTAEMYTKTGVNGDSRYFLWPLQHGTLH 176

Query: 153 MCGIYNIVYRRYFAVPFVTDEKRK 176
            CG   +  +  FA    ++E+RK
Sbjct: 177 FCGFKVLAPQISFAPEIASEEERK 200


>1zx1A [x.x.x] NRH DEHYDROGENASE [QUINONE] 2
          Length = 227

 Score = 77.8 bits (190), Expect = 2e-17
 Identities = 50/204 (24%), Positives = 88/204 (43%), Gaps = 35/204 (17%)

Query: 2   KKIFLLYGHYNEKSFNAAIRDTFIKTAEKNGNTVDCVDLYKDKFNP-------------- 47
           KK+ ++Y H   KSFN ++++  +    + G TV   DLY   F P              
Sbjct: 3   KKVLIVYAHQEPKSFNGSLKNVAVDELSRQGCTVTVSDLYAMNFEPRATDKDITGTLSNP 62

Query: 48  -----------VFAGEQAGEDVLDHRRRIEKCDIIVLIAPIWNFRMPAIVEGWIDKVLSP 96
                       +       D+ D ++++ + D+++   P++ F +PAI++GW+D+VL  
Sbjct: 63  EVFNYGVETHEAYKQRSLASDITDEQKKVREADLVIFQFPLYWFSVPAILKGWMDRVLCQ 122

Query: 97  PWAYTFKKLVGNYGYPMGNLKDKKAIIFCTYGSPRLAVTTFFLNLPIR----RLKRGVFH 152
            +A+          Y  G L+ K A++  T G      T   +N   R     L+ G  H
Sbjct: 123 GFAFDIP------FYDSGLLQGKLALLSVTTGGTAEMYTKTGVNGDSRYFLWPLQHGTLH 176

Query: 153 MCGIYNIVYRRYFAVPFVTDEKRK 176
            CG   +  +  FA    ++E+RK
Sbjct: 177 FCGFKVLAPQISFAPEIASEEERK 200


>1qrdA [c.23.5] QUINONE-REDUCTASE
          Length = 273

 Score = 69.3 bits (168), Expect = 9e-15
 Identities = 47/218 (21%), Positives = 98/218 (44%), Gaps = 34/218 (15%)

Query: 1   MKKIFLLYGHYNEKSFNAAIRDTFIKTAEKNGNTVDCVDLYKDKFNPVFA-----GE--- 52
           +++  ++  H    SFN A+++  ++  +K G  V   DLY   FNP+ +     GE   
Sbjct: 2   VRRALIVLAHAERTSFNYAMKEAAVEALKKKGWEVVESDLYAMNFNPLISRNDITGEPKD 61

Query: 53  -----------------QAGEDVLDHRRRIEKCDIIVLIAPIWNFRMPAIVEGWIDKVLS 95
                            +   D++  ++++E  D+++   P++ F +PAI++GW ++VL 
Sbjct: 62  SENFQYPVESSLAYKEGRLSPDIVAEQKKLEAADLVIFQFPLYWFGVPAILKGWFERVLV 121

Query: 96  PPWAYTFKKLVGNYGYPMGNLKDKKAIIFCTYGSP----RLAVTTFFLNLPIRRLKRGVF 151
             +AYT+  +     Y  G  ++KK ++  T G       L      +N+ +  ++ G+ 
Sbjct: 122 AGFAYTYATM-----YDKGPFQNKKTLLSITTGGSGSMYSLQGVHGDMNVILWPIQSGIL 176

Query: 152 HMCGIYNIVYRRYFAVPFVTDEKRKEFLEDVKKTANNI 189
             CG   +  +  +++     + R + LE  KK    +
Sbjct: 177 RFCGFQVLEPQLVYSIGHTPPDARVQVLEGWKKRLETV 214


>1dxqA [c.23.5] QUINONE REDUCTASE
          Length = 273

 Score = 68.2 bits (165), Expect = 2e-14
 Identities = 47/217 (21%), Positives = 96/217 (44%), Gaps = 34/217 (15%)

Query: 2   KKIFLLYGHYNEKSFNAAIRDTFIKTAEKNGNTVDCVDLYKDKFNPVFA-----GE---- 52
           ++  ++  H  + SFN A+++  ++  +K G  V   DLY   FNP+ +     GE    
Sbjct: 3   RRALIVLAHSEKTSFNYAMKEAAVEALKKRGWEVLESDLYAMNFNPIISRNDITGELKDS 62

Query: 53  ----------------QAGEDVLDHRRRIEKCDIIVLIAPIWNFRMPAIVEGWIDKVLSP 96
                           +   D++   +++E  D+++   P+  F +PAI++GW ++VL  
Sbjct: 63  KNFQYPSESSLAYKEGRLSPDIVAEHKKLEAADLVIFQFPLQWFGVPAILKGWFERVLVA 122

Query: 97  PWAYTFKKLVGNYGYPMGNLKDKKAIIFCTYGSP----RLAVTTFFLNLPIRRLKRGVFH 152
            +AYT+  +     Y  G  ++KK ++  T G       L      +N+ +  ++ G+  
Sbjct: 123 GFAYTYAAM-----YDNGPFQNKKTLLSITTGGSGSMYSLQGVHGDMNVILWPIQSGILR 177

Query: 153 MCGIYNIVYRRYFAVPFVTDEKRKEFLEDVKKTANNI 189
            CG   +  +  +++     + R + LE  KK    +
Sbjct: 178 FCGFQVLEPQLVYSIGHTPPDARMQILEGWKKRLETV 214


>1qbgA [c.23.5] NAD(P)H DEHYDROGENASE [QUINONE] 1
          Length = 272

 Score = 61.6 bits (148), Expect = 2e-12
 Identities = 46/218 (21%), Positives = 88/218 (40%), Gaps = 34/218 (15%)

Query: 1   MKKIFLLYGHYNEKSFNAAIRDTFIKTAEKNGNTVDCVDLYKDKFNPVFAGEQA------ 54
           +++  ++  H    SFN              G  V   DLY   FNP+ + +        
Sbjct: 1   VRRALIVLAHSERTSFNYXXXXXXXXXXXXXGWEVVESDLYAMNFNPIISRKDITGKLKD 60

Query: 55  -------------------GEDVLDHRRRIEKCDIIVLIAPIWNFRMPAIVEGWIDKVLS 95
                                D++  ++++E  D+++   P+  F +PAI++GW ++V  
Sbjct: 61  PANFQYPAESVLAYKEGHLSPDIVAEQKKLEAADLVIFQFPLQWFGVPAILKGWFERVFI 120

Query: 96  PPWAYTFKKLVGNYGYPMGNLKDKKAIIFCTYGSP----RLAVTTFFLNLPIRRLKRGVF 151
             +AYT+  +     Y  G  + KKA++  T G       L      +N+ +  ++ G+ 
Sbjct: 121 GEFAYTYAAM-----YDKGPFRSKKAVLSITTGGSGSMYSLQGIHGDMNVILWPIQSGIL 175

Query: 152 HMCGIYNIVYRRYFAVPFVTDEKRKEFLEDVKKTANNI 189
           H CG   +  +  +++     + R + LE  KK   NI
Sbjct: 176 HFCGFQVLEPQLTYSIGHTPADARIQILEGWKKRLENI 213


>1kbqB [c.23.5] NAD(P)H DEHYDROGENASE [QUINONE] 1
          Length = 271

 Score = 61.2 bits (147), Expect = 2e-12
 Identities = 46/217 (21%), Positives = 87/217 (40%), Gaps = 34/217 (15%)

Query: 2   KKIFLLYGHYNEKSFNAAIRDTFIKTAEKNGNTVDCVDLYKDKFNPVFAGEQA------- 54
           ++  ++  H    SFN              G  V   DLY   FNP+ + +         
Sbjct: 1   RRALIVLAHSERTSFNYXXXXXXXXXXXXXGWEVVESDLYAMNFNPIISRKDITGKLKDP 60

Query: 55  ------------------GEDVLDHRRRIEKCDIIVLIAPIWNFRMPAIVEGWIDKVLSP 96
                               D++  ++++E  D+++   P+  F +PAI++GW ++V   
Sbjct: 61  ANFQYPAESVLAYKEGHLSPDIVAEQKKLEAADLVIFQFPLQWFGVPAILKGWFERVFIG 120

Query: 97  PWAYTFKKLVGNYGYPMGNLKDKKAIIFCTYGSP----RLAVTTFFLNLPIRRLKRGVFH 152
            +AYT+  +     Y  G  + KKA++  T G       L      +N+ +  ++ G+ H
Sbjct: 121 EFAYTYAAM-----YDKGPFRSKKAVLSITTGGSGSMYSLQGIHGDMNVILWPIQSGILH 175

Query: 153 MCGIYNIVYRRYFAVPFVTDEKRKEFLEDVKKTANNI 189
            CG   +  +  +++     + R + LE  KK   NI
Sbjct: 176 FCGFQVLEPQLTYSIGHTPADARIQILEGWKKRLENI 212


>1kbqA [c.23.5] NAD(P)H DEHYDROGENASE [QUINONE] 1
          Length = 272

 Score = 61.2 bits (147), Expect = 2e-12
 Identities = 46/217 (21%), Positives = 87/217 (40%), Gaps = 34/217 (15%)

Query: 2   KKIFLLYGHYNEKSFNAAIRDTFIKTAEKNGNTVDCVDLYKDKFNPVFAGEQA------- 54
           ++  ++  H    SFN              G  V   DLY   FNP+ + +         
Sbjct: 2   RRALIVLAHSERTSFNYXXXXXXXXXXXXXGWEVVESDLYAMNFNPIISRKDITGKLKDP 61

Query: 55  ------------------GEDVLDHRRRIEKCDIIVLIAPIWNFRMPAIVEGWIDKVLSP 96
                               D++  ++++E  D+++   P+  F +PAI++GW ++V   
Sbjct: 62  ANFQYPAESVLAYKEGHLSPDIVAEQKKLEAADLVIFQFPLQWFGVPAILKGWFERVFIG 121

Query: 97  PWAYTFKKLVGNYGYPMGNLKDKKAIIFCTYGSP----RLAVTTFFLNLPIRRLKRGVFH 152
            +AYT+  +     Y  G  + KKA++  T G       L      +N+ +  ++ G+ H
Sbjct: 122 EFAYTYAAM-----YDKGPFRSKKAVLSITTGGSGSMYSLQGIHGDMNVILWPIQSGILH 176

Query: 153 MCGIYNIVYRRYFAVPFVTDEKRKEFLEDVKKTANNI 189
            CG   +  +  +++     + R + LE  KK   NI
Sbjct: 177 FCGFQVLEPQLTYSIGHTPADARIQILEGWKKRLENI 213


>1h69A [c.23.5] NAD(P)H DEHYDROGENASE [QUINONE] 1
          Length = 273

 Score = 61.2 bits (147), Expect = 2e-12
 Identities = 46/217 (21%), Positives = 87/217 (40%), Gaps = 34/217 (15%)

Query: 2   KKIFLLYGHYNEKSFNAAIRDTFIKTAEKNGNTVDCVDLYKDKFNPVFAGEQA------- 54
           ++  ++  H    SFN              G  V   DLY   FNP+ + +         
Sbjct: 3   RRALIVLAHSERTSFNYXXXXXXXXXXXXXGWEVVESDLYAMNFNPIISRKDITGKLKDP 62

Query: 55  ------------------GEDVLDHRRRIEKCDIIVLIAPIWNFRMPAIVEGWIDKVLSP 96
                               D++  ++++E  D+++   P+  F +PAI++GW ++V   
Sbjct: 63  ANFQYPAESVLAYKEGHLSPDIVAEQKKLEAADLVIFQFPLQWFGVPAILKGWFERVFIG 122

Query: 97  PWAYTFKKLVGNYGYPMGNLKDKKAIIFCTYGSP----RLAVTTFFLNLPIRRLKRGVFH 152
            +AYT+  +     Y  G  + KKA++  T G       L      +N+ +  ++ G+ H
Sbjct: 123 EFAYTYAAM-----YDKGPFRSKKAVLSITTGGSGSMYSLQGIHGDMNVILWPIQSGILH 177

Query: 153 MCGIYNIVYRRYFAVPFVTDEKRKEFLEDVKKTANNI 189
            CG   +  +  +++     + R + LE  KK   NI
Sbjct: 178 FCGFQVLEPQLTYSIGHTPADARIQILEGWKKRLENI 214


>1d4aA [c.23.5] QUINONE REDUCTASE
          Length = 273

 Score = 61.2 bits (147), Expect = 2e-12
 Identities = 46/217 (21%), Positives = 87/217 (40%), Gaps = 34/217 (15%)

Query: 2   KKIFLLYGHYNEKSFNAAIRDTFIKTAEKNGNTVDCVDLYKDKFNPVFAGEQA------- 54
           ++  ++  H    SFN              G  V   DLY   FNP+ + +         
Sbjct: 3   RRALIVLAHSERTSFNYXXXXXXXXXXXXXGWEVVESDLYAMNFNPIISRKDITGKLKDP 62

Query: 55  ------------------GEDVLDHRRRIEKCDIIVLIAPIWNFRMPAIVEGWIDKVLSP 96
                               D++  ++++E  D+++   P+  F +PAI++GW ++V   
Sbjct: 63  ANFQYPAESVLAYKEGHLSPDIVAEQKKLEAADLVIFQFPLQWFGVPAILKGWFERVFIG 122

Query: 97  PWAYTFKKLVGNYGYPMGNLKDKKAIIFCTYGSP----RLAVTTFFLNLPIRRLKRGVFH 152
            +AYT+  +     Y  G  + KKA++  T G       L      +N+ +  ++ G+ H
Sbjct: 123 EFAYTYAAM-----YDKGPFRSKKAVLSITTGGSGSMYSLQGIHGDMNVILWPIQSGILH 177

Query: 153 MCGIYNIVYRRYFAVPFVTDEKRKEFLEDVKKTANNI 189
            CG   +  +  +++     + R + LE  KK   NI
Sbjct: 178 FCGFQVLEPQLTYSIGHTPADARIQILEGWKKRLENI 214


>3f2vA [x.x.x] GENERAL STRESS PROTEIN 14
          Length = 174

 Score = 39.7 bits (91), Expect = 7e-06
 Identities = 29/98 (29%), Positives = 49/98 (50%), Gaps = 12/98 (12%)

Query: 36  DCVDLYKDKF--NPVFAGEQAGE-DVLDHRRRIEKCDIIVLIAPIWNFRMPAIVEGWIDK 92
           D V  + D+F  + ++A    G+ DV   ++ IE  D +V   PI+ F  P +++ W+D+
Sbjct: 23  DAVRQHTDRFTVHELYAVYPQGKIDVAAEQKLIETHDSLVWQFPIYWFNCPPLLKQWLDE 82

Query: 93  VLSPPWAYTFKKLVGNYGYPMGNLKDKKAIIFCTYGSP 130
           VL+  WAY  K            LK +K  +  + G+P
Sbjct: 83  VLTYGWAYGSKGKA---------LKGRKIALAVSLGAP 111


>3eywB [x.x.x] C-TERMINAL DOMAIN OF GLUTATHIONE-REGULATED
          Length = 352

 Score = 36.2 bits (82), Expect = 8e-05
 Identities = 15/44 (34%), Positives = 26/44 (59%)

Query: 57  DVLDHRRRIEKCDIIVLIAPIWNFRMPAIVEGWIDKVLSPPWAY 100
           D+   +  + + D+IV   P+  + +P +++ WIDKV S  WAY
Sbjct: 223 DIAAEQEALSRADLIVWQHPMQWYSIPPLLKLWIDKVFSHGWAY 266


>3eywA [x.x.x] C-TERMINAL DOMAIN OF GLUTATHIONE-REGULATED
          Length = 337

 Score = 36.2 bits (82), Expect = 8e-05
 Identities = 15/44 (34%), Positives = 26/44 (59%)

Query: 57  DVLDHRRRIEKCDIIVLIAPIWNFRMPAIVEGWIDKVLSPPWAY 100
           D+   +  + + D+IV   P+  + +P +++ WIDKV S  WAY
Sbjct: 208 DIAAEQEALSRADLIVWQHPMQWYSIPPLLKLWIDKVFSHGWAY 251


>2v9cA [x.x.x] FMN-DEPENDENT NADH-AZOREDUCTASE 1
          Length = 203

 Score = 34.3 bits (77), Expect = 3e-04
 Identities = 18/60 (30%), Positives = 36/60 (60%), Gaps = 3/60 (5%)

Query: 69  DIIVLIAPIWNFRMPAIVEGWIDKVLSPPWAYTFKKLVGNYGYPMGNLKDKKAIIFCTYG 128
           D++V+  P++NF +P+ ++ WID+++     + F   V  Y  P+  L+ K+A+I  + G
Sbjct: 88  DLLVISTPMYNFSVPSGLKAWIDQIVRLGVTFDFVLDVAQY-RPL--LRGKRALIVTSRG 144


  Database: 95pdb09Oct16x
    Posted date:  Nov 2, 2009  3:15 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.317    0.136    0.429 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 827,899,320
Number of extensions: 34704357
Number of successful extensions: 88933
Number of sequences better than 1.0e-03: 2071
Number of HSP's gapped: 87520
Number of HSP's successfully gapped: 2139
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.2 bits)