BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= AAZ22111.1 pubi0 AAZ22111.1 GIB00256CH01 "GXGXG
motif-containing protein"
         (284 letters)

Database: 95pdb09Oct16x 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

1ofeA [d.153.1 - c.1.4 - b.80.4] FERREDOXIN-DEPENDENT GLUTAMATE ...    45   3e-07
1ofdA [d.153.1 - c.1.4 - b.80.4] FERREDOXIN-DEPENDENT GLUTAMATE ...    45   3e-07
1llwA [d.153.1 - c.1.4 - b.80.4] FERREDOXIN-DEPENDENT GLUTAMATE ...    45   3e-07

>1ofeA [d.153.1 - c.1.4 - b.80.4] FERREDOXIN-DEPENDENT GLUTAMATE
            SYNTHASE 2
          Length = 1485

 Score = 45.1 bits (105), Expect = 3e-07
 Identities = 35/130 (26%), Positives = 54/130 (41%), Gaps = 14/130 (10%)

Query: 95   GILNKLNLIFEGSLGY-FGMGSCDGPTVRINGRVGWSCAENLMAGKVVIEKNAGSCFGA- 152
            G    + L F+G+ G  FG  + DG T+ + G       + +  G++VI  +  + F   
Sbjct: 1274 GFEGNITLNFQGAAGQSFGAFNLDGMTLHLQGEANDYVGKGMNGGEIVIVPHPQASFAPE 1333

Query: 153  -----------AIRGGDLICKGSVGARTGIDMKGGTIIVGGDAGAFTGFMMQRGRIIILG 201
                          GG+L   G  G R  +    G  ++ G AG      M  G I++LG
Sbjct: 1334 DNVIIGNTCLYGATGGNLYANGRAGERFAVRNSVGKAVIEG-AGDHCCEYMTGGVIVVLG 1392

Query: 202  DVGINLGDSM 211
             VG N+G  M
Sbjct: 1393 PVGRNVGAGM 1402


>1ofdA [d.153.1 - c.1.4 - b.80.4] FERREDOXIN-DEPENDENT GLUTAMATE
            SYNTHASE 2
          Length = 1491

 Score = 45.1 bits (105), Expect = 3e-07
 Identities = 35/130 (26%), Positives = 54/130 (41%), Gaps = 14/130 (10%)

Query: 95   GILNKLNLIFEGSLGY-FGMGSCDGPTVRINGRVGWSCAENLMAGKVVIEKNAGSCFGA- 152
            G    + L F+G+ G  FG  + DG T+ + G       + +  G++VI  +  + F   
Sbjct: 1280 GFEGNITLNFQGAAGQSFGAFNLDGMTLHLQGEANDYVGKGMNGGEIVIVPHPQASFAPE 1339

Query: 153  -----------AIRGGDLICKGSVGARTGIDMKGGTIIVGGDAGAFTGFMMQRGRIIILG 201
                          GG+L   G  G R  +    G  ++ G AG      M  G I++LG
Sbjct: 1340 DNVIIGNTCLYGATGGNLYANGRAGERFAVRNSVGKAVIEG-AGDHCCEYMTGGVIVVLG 1398

Query: 202  DVGINLGDSM 211
             VG N+G  M
Sbjct: 1399 PVGRNVGAGM 1408


>1llwA [d.153.1 - c.1.4 - b.80.4] FERREDOXIN-DEPENDENT GLUTAMATE
            SYNTHASE
          Length = 1475

 Score = 45.1 bits (105), Expect = 3e-07
 Identities = 35/130 (26%), Positives = 54/130 (41%), Gaps = 14/130 (10%)

Query: 95   GILNKLNLIFEGSLGY-FGMGSCDGPTVRINGRVGWSCAENLMAGKVVIEKNAGSCFGA- 152
            G    + L F+G+ G  FG  + DG T+ + G       + +  G++VI  +  + F   
Sbjct: 1264 GFEGNITLNFQGAAGQSFGAFNLDGMTLHLQGEANDYVGKGMNGGEIVIVPHPQASFAPE 1323

Query: 153  -----------AIRGGDLICKGSVGARTGIDMKGGTIIVGGDAGAFTGFMMQRGRIIILG 201
                          GG+L   G  G R  +    G  ++ G AG      M  G I++LG
Sbjct: 1324 DNVIIGNTCLYGATGGNLYANGRAGERFAVRNSVGKAVIEG-AGDHCCEYMTGGVIVVLG 1382

Query: 202  DVGINLGDSM 211
             VG N+G  M
Sbjct: 1383 PVGRNVGAGM 1392


  Database: 95pdb09Oct16x
    Posted date:  Nov 2, 2009  3:15 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.319    0.138    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 965,856,097
Number of extensions: 39986529
Number of successful extensions: 97853
Number of sequences better than 1.0e-03: 1342
Number of HSP's gapped: 96270
Number of HSP's successfully gapped: 2077
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.2 bits)