BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= AAZ21181.1 pubi0 AAZ21181.1 GIB00256CH01 "putative porin"
         (329 letters)

Database: sws57.9x 
           510,076 sequences; 179,409,320 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ICEK_PSESX RecName: Full=Ice nucleation protein;                       40   4e-05
ICEN_PSEFL RecName: Full=Ice nucleation protein;                       39   6e-05
ICEN_PANAN RecName: Full=Ice nucleation protein inaU;                  37   2e-04
ICEN_PSESY RecName: Full=Ice nucleation protein;                       36   4e-04
HMU_HALWD RecName: Full=Halomucin;Flags: Precursor;                    35   7e-04

>ICEK_PSESX RecName: Full=Ice nucleation protein;
          Length = 1148

 Score = 39.7 bits (91), Expect = 4e-05
 Identities = 44/176 (25%), Positives = 67/176 (38%), Gaps = 36/176 (20%)

Query: 146 FGAIGSAGSNNMMR--YDNT-TAVEGLKISASYVPSGTGEVESSVDYGLEYTGYEG---- 198
           +G+  ++G ++ +   Y +T TA EG  ++A Y  +GT  V+SS+  G   T   G    
Sbjct: 270 YGSTQTSGGDSSLTAGYGSTQTAQEGSNLTAGYGSTGTAGVDSSLIAGYGSTQTSGSDSA 329

Query: 199 LTLGYAMGENNAAGGTSNTDNDTMYVKYAYGPVTVGYQKSEIXXXXXXXXXXXXXYGVTY 258
           LT GY   +    G                  +  GY  ++                 T 
Sbjct: 330 LTAGYGSTQTAQEGSNLXXXXXXXXXXXXXXXLIAGYGSTQ-----------------TS 372

Query: 259 AVSDSLSVGYAESTYDAGSSTTDQENSNLSVSYTQGG-----MTLAAGFAEEKNRG 309
               SL+ GY       GS+ T QE SNL+  Y   G      +L AG+   +  G
Sbjct: 373 GSDSSLTAGY-------GSTQTAQEGSNLTAGYGSTGTAGVDSSLIAGYGSTQTSG 421


>ICEN_PSEFL RecName: Full=Ice nucleation protein;
          Length = 1210

 Score = 38.9 bits (89), Expect = 6e-05
 Identities = 62/185 (33%), Positives = 85/185 (45%), Gaps = 36/185 (19%)

Query: 146 FGAIGSAGSNNMM--RYDNTTAVEG-LKISASYVPSGTGEVESSVDYGLEYTGYEG---- 198
           +G+ G+AGS++ +   Y +T    G   ++A Y  + T +V S++  G   TG  G    
Sbjct: 215 YGSTGTAGSDSSLIAGYGSTQTAGGDSSLTAGYGSTQTAQVGSNLTAGYGSTGTAGPDSS 274

Query: 199 LTLGYAMGENNAAGGTSNTDNDTMYVKYAYGPVTVGYQKSEIXXXXXXXXXXXXX----- 253
           L  GY  G    AGG S+       +   YG        S++                  
Sbjct: 275 LIAGY--GSTQTAGGESS-------LTAGYGSTQTAQVGSDLXXXXXXXXXXXXXXXLIA 325

Query: 254 -YGVTYAVS--DSLSVGYAESTYDAGSSTTDQENSNLSVSYTQGG-----MTLAAGFAEE 305
            YG T       SL+ GY       GS+ T Q  SNL+  Y   G      +L AG+   
Sbjct: 326 GYGSTQTAGGDSSLTAGY-------GSTQTAQVGSNLTAGYGSTGTAGPDSSLIAGYGST 378

Query: 306 KNRGG 310
           +  GG
Sbjct: 379 QTAGG 383


>ICEN_PANAN RecName: Full=Ice nucleation protein inaU;
          Length = 1034

 Score = 37.4 bits (85), Expect = 2e-04
 Identities = 58/196 (29%), Positives = 86/196 (43%), Gaps = 32/196 (16%)

Query: 132 TVDNGGVTSTASTLFGAIGSAGSNNMMRYDNTTAVEGLKISASYVPSGTGEVESS--VDY 189
           + +  G +ST    +G+ G+AGS++              + A Y  + T   ESS    Y
Sbjct: 182 STETAGDSSTLIAGYGSTGTAGSDS-------------TLVAGYGSTQTAGEESSQMAGY 228

Query: 190 GLEYTGYEGLTLGYAMGENNAAG---------GTSNTDNDTMYVKYAYGPVTVGYQKSEI 240
           G   TG +G  L    G    AG         G++ T  +   +   YG      + S++
Sbjct: 229 GSTQTGMKGSDLTAGYGSTGTAGDDSSLIAGYGSTQTAGEDSSLTAGYGSTQTAQKGSDL 288

Query: 241 XXXXXXXXXXXXXYGVTYAVSDSLSVGYAESTYDA--GSSTTDQENSNLSVSYTQGG--- 295
                          +      + + G  EST  A  GS+ T Q+ S+L+  Y   G   
Sbjct: 289 XXXXXXXXXXXXXXXLIAGYGSTQTAG-EESTQTAGYGSTQTAQKGSDLTAGYGSTGTAG 347

Query: 296 --MTLAAGFAEEKNRG 309
              +L AG+   +  G
Sbjct: 348 DDSSLIAGYGSTQTAG 363


>ICEN_PSESY RecName: Full=Ice nucleation protein;
          Length = 1200

 Score = 36.2 bits (82), Expect = 4e-04
 Identities = 43/176 (24%), Positives = 66/176 (37%), Gaps = 36/176 (20%)

Query: 146 FGAIGSAGSNNMMR--YDNT-TAVEGLKISASYVPSGTGEVESSVDYGLEYTGYEG---- 198
           +G+  ++G ++ +   Y +T TA EG  ++A Y  +GT  V+SS+  G   T   G    
Sbjct: 322 YGSTQTSGGDSSLTAGYGSTQTAQEGSNLTAGYGSTGTAGVDSSLIAGYGSTQTSGSDSA 381

Query: 199 LTLGYAMGENNAAGGTSNTDNDTMYVKYAYGPVTVGYQKSEIXXXXXXXXXXXXXYGVTY 258
           LT GY   +    G                  +  GY  ++                 T 
Sbjct: 382 LTAGYGSTQTAQEGSNLXXXXXXXXXXXXXXXLIAGYGSTQ-----------------TS 424

Query: 259 AVSDSLSVGYAESTYDAGSSTTDQENSNLSVSYTQGG-----MTLAAGFAEEKNRG 309
               SL+ GY       GS+ T QE S L+  Y   G      +L AG+   +  G
Sbjct: 425 GSDSSLTAGY-------GSTQTAQEGSILTAGYGSTGTAGVDSSLIAGYGSTQTSG 473


>HMU_HALWD RecName: Full=Halomucin;Flags: Precursor;
          Length = 9159

 Score = 35.4 bits (80), Expect = 7e-04
 Identities = 37/155 (23%), Positives = 60/155 (38%), Gaps = 14/155 (9%)

Query: 128  IISNTVDNGGVTSTASTLFGAIGSAGSNNMMRYDNTTAVEGLKISASYVPSGTGEVESSV 187
            I++N    G VT+T   + G IG   +  ++R  N TA   +      V    G+ ++S+
Sbjct: 2341 IVANASATGNVTTTGQRVGGLIGYHRTGTILR--NVTATGDVSTDGQRVGGLVGDTDASI 2398

Query: 188  D----YGLEYTGYEGLTLGYAMGENNAAGGTSNTDNDTMYVKYAYGPVTVGYQKSEIXXX 243
                  G   T   G  +G  +G+  A  G     N T     + G   VG     +   
Sbjct: 2399 TDASATGEVTTSTTGEYVGGLVGQLRAQHGDEEVRNVTASGNVSSGGQYVGGLMGYVDDN 2458

Query: 244  XXXXXXXXXXYGVTYAVSDSLSVGYAESTYDAGSS 278
                       G   A+S++ + G   +TYD GS+
Sbjct: 2459 NNE--------GRYVAMSEAHATGNVNTTYDGGSN 2485


  Database: sws57.9x
    Posted date:  Nov 5, 2009 10:46 AM
  Number of letters in database: 179,409,320
  Number of sequences in database:  510,076
  
Lambda     K      H
   0.314    0.132    0.383 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 510076
Number of Hits to DB: 8,433,866,562
Number of extensions: 345252627
Number of successful extensions: 977602
Number of sequences better than 1.0e-03: 25324
Number of HSP's gapped: 933865
Number of HSP's successfully gapped: 31598
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.8 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.0 bits)