BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= AAZ21597.1 pubi0 hpaG GIB00256CH01 "fumarylacetoacetate
hydrolase family protein"
         (281 letters)

Database: sws57.9x 
           510,076 sequences; 179,409,320 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UGL_BURCM RecName: Full=Ureidoglycolate lyase;         Short=UGL...   248   6e-68
UGL_BURA4 RecName: Full=Ureidoglycolate lyase;         Short=UGL...   246   2e-67
UGL_BURCJ RecName: Full=Ureidoglycolate lyase;         Short=UGL...   245   4e-67
UGL_BURS3 RecName: Full=Ureidoglycolate lyase;         Short=UGL...   244   9e-67
UGL_BURM1 RecName: Full=Ureidoglycolate lyase;         Short=UGL...   232   3e-63
UGL_BURCH RecName: Full=Ureidoglycolate lyase;         Short=UGL...   229   2e-62
UGL_BURCC RecName: Full=Ureidoglycolate lyase;         Short=UGL...   229   2e-62
UGL_BURCA RecName: Full=Ureidoglycolate lyase;         Short=UGL...   229   2e-62
FAHD2_XENLA RecName: Full=Fumarylacetoacetate hydrolase domain-c...   187   7e-50
FAHD2_RAT RecName: Full=Fumarylacetoacetate hydrolase domain-con...   187   7e-50
FAH2A_HUMAN RecName: Full=Fumarylacetoacetate hydrolase domain-c...   182   4e-48
FAHD2_BOVIN RecName: Full=Fumarylacetoacetate hydrolase domain-c...   176   2e-46
FAHD2_PONAB RecName: Full=Fumarylacetoacetate hydrolase domain-c...   175   4e-46
FAH2B_HUMAN RecName: Full=Fumarylacetoacetate hydrolase domain-c...   175   5e-46
FAHD2_MOUSE RecName: Full=Fumarylacetoacetate hydrolase domain-c...   166   2e-43
Y1397_PYRAB RecName: Full=Uncharacterized protein PYRAB13970;         142   5e-36
Y1656_METJA RecName: Full=Uncharacterized protein MJ1656;             141   8e-36
Y643_PYRHO RecName: Full=Uncharacterized protein PH0643;              140   1e-35
FAHD2_DICDI RecName: Full=Fumarylacetoacetate hydrolase domain-c...   137   9e-35
Y2225_ARCFU RecName: Full=Uncharacterized protein AF_2225;            135   6e-34
YISK_BACSU RecName: Full=Uncharacterized protein yisK;                132   4e-33
Y973_STAAC RecName: Full=Uncharacterized protein SACOL0973;           130   2e-32
Y968_STAAM RecName: Full=Uncharacterized protein SAV0968;             130   2e-32
Y906_STAA8 RecName: Full=Uncharacterized protein SAOUHSC_00906;       130   2e-32
Y871_STAA3 RecName: Full=Uncharacterized protein SAUSA300_0871;       130   2e-32
Y850_STAAW RecName: Full=Uncharacterized protein MW0850;              130   2e-32
Y838_STAAS RecName: Full=Uncharacterized protein SAS0838;             130   2e-32
Y837_STAAB RecName: Full=Uncharacterized protein SAB0837;             130   2e-32
Y829_STAAN RecName: Full=Uncharacterized protein SA0829;              130   2e-32
Y930_STAAR RecName: Full=Uncharacterized protein SAR0930;             129   3e-32
Y665_STAES RecName: Full=Uncharacterized protein SE_0665;             125   4e-31
Y556_STAEQ RecName: Full=Uncharacterized protein SERP0556;            125   4e-31
Y1982_STAHJ RecName: Full=Uncharacterized protein SH1982;             125   4e-31
Y1806_STAS1 RecName: Full=Uncharacterized protein SSP1806;            123   2e-30
HPAG_SALDU RecName: Full=4-hydroxyphenylacetate degradation bifu...   120   1e-29
HPCE_ECOLX RecName: Full=Homoprotocatechuate catabolism bifuncti...   118   5e-29
HPAG_ECOLX RecName: Full=4-hydroxyphenylacetate degradation bifu...   118   5e-29
FAHD1_DICDI RecName: Full=Fumarylacetoacetate hydrolase domain-c...   108   6e-26
FAHD1_BOVIN RecName: Full=Fumarylacetoacetate hydrolase domain-c...   108   6e-26
FAHD1_MOUSE RecName: Full=Fumarylacetoacetate hydrolase domain-c...   105   4e-25
FAHD1_HUMAN RecName: Full=Fumarylacetoacetate hydrolase domain-c...   103   1e-24
FAHD1_RAT RecName: Full=Fumarylacetoacetate hydrolase domain-con...   102   3e-24
FAHD1_PONAB RecName: Full=Fumarylacetoacetate hydrolase domain-c...   102   3e-24
YO23_CAEEL RecName: Full=Uncharacterized protein ZK688.3;             101   9e-24
YCGM_ECOLI RecName: Full=Uncharacterized protein ycgM;                 88   8e-20
FMP41_YEAST RecName: Full=Uncharacterized mitochondrial hydrolas...    71   1e-14
YOS9_SCHPO RecName: Full=Uncharacterized hydrolase C21C3.09c;   ...    53   4e-09
FAAA_RAT RecName: Full=Fumarylacetoacetase;         Short=FAA;  ...    39   4e-05
FAAA_DICDI RecName: Full=Fumarylacetoacetase;         Short=FAA;...    37   3e-04
FAAA_BOVIN RecName: Full=Fumarylacetoacetase;         Short=FAA;...    36   4e-04

>UGL_BURCM RecName: Full=Ureidoglycolate lyase;         Short=UGL;  
                 EC=4.3.2.3;AltName: Full=Ureidoglycolase;AltName:
           Full=Ureidoglycolatase;
          Length = 282

 Score =  248 bits (632), Expect = 6e-68
 Identities = 126/274 (45%), Positives = 164/274 (59%), Gaps = 1/274 (0%)

Query: 1   MKFLRIGKAGQEIPVALDRNGKYRNLSSIIKDLNSETINFETLDKIKDIXXXXXXXXXXX 60
           MK LR G +GQE P  LD NG+ R+LS+ + DL  + ++   L +++ I           
Sbjct: 1   MKLLRYGPSGQEKPGILDANGRIRDLSAHVPDLAGDALSDAGLTRLRAIDPATLPLVSGE 60

Query: 61  XRIGSCISKPGNFFAIGLNYVEHAKETGAKTPDNPVLFNKSVHSIVGPNDNVIIPKTSKK 120
            RIG+C+ + G F  IGLNY +HA E G   P  PV+F K   SI GPND + IPK S K
Sbjct: 61  PRIGACVGRVGKFIGIGLNYADHAAEAGMPVPKEPVVFGKWTSSICGPNDGIDIPKGSVK 120

Query: 121 LDHEVEIAFVIGKKAKRVLEKDAQDYIFGYCICNDISEREWQKEKGGQWVKGKSGDTFGP 180
            D EVE+  VIG   K V E  A DY+ GYC+ ND+SEREWQ E+GGQW KGK  DTFGP
Sbjct: 121 TDWEVELGVVIGTTCKDVDEARALDYVAGYCVVNDVSEREWQIERGGQWDKGKGFDTFGP 180

Query: 181 LGPYLVTKDEIQXXXXXXXXXXXXGHRHQTGNTNQMIFNFNFLVAHITSFITLMPGDIXX 240
           +GP+LVT+DE+             GHR+Q GNT  M+F    LVA++++ +TL PGD+  
Sbjct: 181 IGPWLVTRDEVPDPQRLDLWLEVDGHRYQNGNTRTMVFTVAQLVAYLSTCMTLQPGDVIT 240

Query: 241 XXXXXXXXLGMDP-PVFLKEGDEMKLNIDSLGSQ 273
                   +G+ P PVFLK G  ++L ID LG Q
Sbjct: 241 TGTPPGVGMGIKPSPVFLKAGQTVRLGIDGLGEQ 274


>UGL_BURA4 RecName: Full=Ureidoglycolate lyase;         Short=UGL;  
                 EC=4.3.2.3;AltName: Full=Ureidoglycolase;AltName:
           Full=Ureidoglycolatase;
          Length = 282

 Score =  246 bits (628), Expect = 2e-67
 Identities = 125/274 (45%), Positives = 164/274 (59%), Gaps = 1/274 (0%)

Query: 1   MKFLRIGKAGQEIPVALDRNGKYRNLSSIIKDLNSETINFETLDKIKDIXXXXXXXXXXX 60
           MK LR G +GQE P  LD +G+ R+LS+ + DL  + ++   L +++ I           
Sbjct: 1   MKLLRYGPSGQEKPGILDADGRIRDLSAHVPDLAGDVLSDAALARLRAIDPATLPLVSGE 60

Query: 61  XRIGSCISKPGNFFAIGLNYVEHAKETGAKTPDNPVLFNKSVHSIVGPNDNVIIPKTSKK 120
            RIG+C+ + G F  IGLNY +HA E G   P  PV+F K   SI GPND + IPK S K
Sbjct: 61  PRIGACVGRVGKFIGIGLNYADHAAEAGMPVPKEPVVFGKWTSSICGPNDGIDIPKGSVK 120

Query: 121 LDHEVEIAFVIGKKAKRVLEKDAQDYIFGYCICNDISEREWQKEKGGQWVKGKSGDTFGP 180
            D EVE+  VIG   K V E  A DY+ GYC+ ND+SEREWQ E+GGQW KGK  DTFGP
Sbjct: 121 TDWEVELGVVIGTTCKDVDEARALDYVAGYCVVNDVSEREWQIERGGQWDKGKGFDTFGP 180

Query: 181 LGPYLVTKDEIQXXXXXXXXXXXXGHRHQTGNTNQMIFNFNFLVAHITSFITLMPGDIXX 240
           +GP+LVT+DE+             GHR+Q GNT  M+F    LVA++++ +TL PGD+  
Sbjct: 181 IGPWLVTRDEVPDPQRVDLWLEIDGHRYQNGNTRTMVFTVAQLVAYLSTCMTLQPGDVIT 240

Query: 241 XXXXXXXXLGMDP-PVFLKEGDEMKLNIDSLGSQ 273
                   +G+ P PVFLK G  ++L ID LG Q
Sbjct: 241 TGTPPGVGMGIKPSPVFLKAGQTVRLGIDGLGEQ 274


>UGL_BURCJ RecName: Full=Ureidoglycolate lyase;         Short=UGL;  
                 EC=4.3.2.3;AltName: Full=Ureidoglycolase;AltName:
           Full=Ureidoglycolatase;
          Length = 282

 Score =  245 bits (625), Expect = 4e-67
 Identities = 126/274 (45%), Positives = 162/274 (59%), Gaps = 1/274 (0%)

Query: 1   MKFLRIGKAGQEIPVALDRNGKYRNLSSIIKDLNSETINFETLDKIKDIXXXXXXXXXXX 60
           MK LR G  GQE P  LD  G+ R+LS+ + DL  E ++   L +++ I           
Sbjct: 1   MKLLRYGPPGQEKPGILDAAGRIRDLSAHVPDLAGEVLSDAGLARLRAIDPATLPLVSGE 60

Query: 61  XRIGSCISKPGNFFAIGLNYVEHAKETGAKTPDNPVLFNKSVHSIVGPNDNVIIPKTSKK 120
            RIG+C+   G F  IGLNY +HA E G   P  PV+F K   SI GPND + IPK S K
Sbjct: 61  PRIGACVGHVGKFIGIGLNYADHAAEAGMPVPKEPVVFGKWTSSICGPNDGIDIPKGSVK 120

Query: 121 LDHEVEIAFVIGKKAKRVLEKDAQDYIFGYCICNDISEREWQKEKGGQWVKGKSGDTFGP 180
            D EVE+  VIG K K V E  A DY+ GYC+ ND+SEREWQ E+GGQW KGK  DTFGP
Sbjct: 121 TDWEVELGVVIGAKCKDVDEARALDYVAGYCVVNDVSEREWQIERGGQWDKGKGFDTFGP 180

Query: 181 LGPYLVTKDEIQXXXXXXXXXXXXGHRHQTGNTNQMIFNFNFLVAHITSFITLMPGDIXX 240
           +GP+LVT+DE+             GHR+Q GNT  M+F    L+A++++ +TL PGD+  
Sbjct: 181 IGPWLVTRDEVPDPQRLDLWLEIDGHRYQNGNTRTMVFTVAQLIAYLSTCMTLQPGDVIT 240

Query: 241 XXXXXXXXLGMDP-PVFLKEGDEMKLNIDSLGSQ 273
                   +G+ P PVFLK G  ++L ID LG Q
Sbjct: 241 TGTPPGVGMGIKPSPVFLKAGQMVRLGIDGLGEQ 274


>UGL_BURS3 RecName: Full=Ureidoglycolate lyase;         Short=UGL;  
                 EC=4.3.2.3;AltName: Full=Ureidoglycolase;AltName:
           Full=Ureidoglycolatase;
          Length = 282

 Score =  244 bits (622), Expect = 9e-67
 Identities = 123/274 (44%), Positives = 164/274 (59%), Gaps = 1/274 (0%)

Query: 1   MKFLRIGKAGQEIPVALDRNGKYRNLSSIIKDLNSETINFETLDKIKDIXXXXXXXXXXX 60
           MK LR G +GQE P  LD +G+ R+LS+ + DL+ + ++   L +++ I           
Sbjct: 1   MKLLRYGPSGQEKPGILDADGRIRDLSAHVPDLSGDVLSDAGLARLRAIDPATLPLVSGE 60

Query: 61  XRIGSCISKPGNFFAIGLNYVEHAKETGAKTPDNPVLFNKSVHSIVGPNDNVIIPKTSKK 120
            RIG+C+   G F  IGLNY +HA E G   P  PV+F K   SI GPND + IPK S K
Sbjct: 61  PRIGACVGHVGKFIGIGLNYADHAAEAGMPVPKEPVVFGKWTSSICGPNDGIDIPKGSVK 120

Query: 121 LDHEVEIAFVIGKKAKRVLEKDAQDYIFGYCICNDISEREWQKEKGGQWVKGKSGDTFGP 180
            D EVE+  VIG   K V E  A DY+ GYC+ ND+SEREWQ E+GGQW KGK  DTFGP
Sbjct: 121 TDWEVELGVVIGATCKDVDEARALDYVAGYCVVNDVSEREWQIERGGQWDKGKGFDTFGP 180

Query: 181 LGPYLVTKDEIQXXXXXXXXXXXXGHRHQTGNTNQMIFNFNFLVAHITSFITLMPGDIXX 240
           +GP+LVT+DE+             GHR+Q GNT  M+F    L+A+++S +TL PGD+  
Sbjct: 181 IGPWLVTRDEVPDPQRLDLWLEIDGHRYQNGNTRTMVFTVAQLIAYLSSCMTLQPGDVIT 240

Query: 241 XXXXXXXXLGMDP-PVFLKEGDEMKLNIDSLGSQ 273
                   +G+ P PVFLK G  ++L ++ LG Q
Sbjct: 241 TGTPPGVGMGIKPSPVFLKAGQMVRLGVEGLGEQ 274


>UGL_BURM1 RecName: Full=Ureidoglycolate lyase;         Short=UGL;  
                 EC=4.3.2.3;AltName: Full=Ureidoglycolase;AltName:
           Full=Ureidoglycolatase;
          Length = 282

 Score =  232 bits (591), Expect = 3e-63
 Identities = 117/265 (44%), Positives = 157/265 (59%), Gaps = 1/265 (0%)

Query: 1   MKFLRIGKAGQEIPVALDRNGKYRNLSSIIKDLNSETINFETLDKIKDIXXXXXXXXXXX 60
           MK LR G  GQE P  LD +G+ R+LS+ + DL  + ++   L +++ +           
Sbjct: 1   MKLLRYGPPGQEKPGILDADGRIRDLSAHVPDLAGDVLSDAGLARLRALDPATLPLVSGE 60

Query: 61  XRIGSCISKPGNFFAIGLNYVEHAKETGAKTPDNPVLFNKSVHSIVGPNDNVIIPKTSKK 120
            RIG+C+ + G F  IGLNY +HA E G   P  PV+F K   SI GPND + IPK S K
Sbjct: 61  PRIGACVGRVGKFIGIGLNYADHAAEAGMPVPKEPVVFGKWTSSICGPNDGIDIPKGSVK 120

Query: 121 LDHEVEIAFVIGKKAKRVLEKDAQDYIFGYCICNDISEREWQKEKGGQWVKGKSGDTFGP 180
            D EVE+  VIG   K V E  A DY+ GYC+ ND+SEREWQ E+GGQW KGK  DTFGP
Sbjct: 121 TDWEVELGVVIGAPCKDVDEARALDYVAGYCVVNDVSEREWQIERGGQWDKGKGFDTFGP 180

Query: 181 LGPYLVTKDEIQXXXXXXXXXXXXGHRHQTGNTNQMIFNFNFLVAHITSFITLMPGDIXX 240
           +GP+LVT+DE+             GHR+Q GNT  M+F    L+A+++S +TL PGD+  
Sbjct: 181 IGPWLVTRDEVPDPQSLDLWLEVDGHRYQNGNTRTMVFTVAQLIAYLSSCMTLQPGDVIT 240

Query: 241 XXXXXXXXLGMDP-PVFLKEGDEMK 264
                   +G+ P PV+LK G  ++
Sbjct: 241 TGTPPGVGMGIKPAPVYLKAGQMVR 265


>UGL_BURCH RecName: Full=Ureidoglycolate lyase;         Short=UGL;  
                 EC=4.3.2.3;AltName: Full=Ureidoglycolase;AltName:
           Full=Ureidoglycolatase;
          Length = 282

 Score =  229 bits (584), Expect = 2e-62
 Identities = 131/274 (47%), Positives = 166/274 (60%), Gaps = 1/274 (0%)

Query: 1   MKFLRIGKAGQEIPVALDRNGKYRNLSSIIKDLNSETINFETLDKIKDIXXXXXXXXXXX 60
           MK LR G +GQE P  LD  G+ R+LS+ + DL  + ++   L +++ I           
Sbjct: 1   MKLLRYGPSGQEKPGILDAAGRIRDLSAHVPDLAGDVLSDAGLARLRAIDPATLPLVSGE 60

Query: 61  XRIGSCISKPGNFFAIGLNYVEHAKETGAKTPDNPVLFNKSVHSIVGPNDNVIIPKTSKK 120
            RIG+C+   G F  IGLNY +HA E G   P  PV+F K   SI GPND + IPK S K
Sbjct: 61  PRIGACVGHVGKFIGIGLNYADHAAEAGMPVPKEPVVFGKWTSSICGPNDGIDIPKGSVK 120

Query: 121 LDHEVEIAFVIGKKAKRVLEKDAQDYIFGYCICNDISEREWQKEKGGQWVKGKSGDTFGP 180
            D EVE+  VIG K K V E  A DY+ GYC+ ND+SEREWQ E+GGQW KGK  DTFGP
Sbjct: 121 TDWEVELGVVIGAKCKDVDEARALDYVAGYCVVNDVSEREWQIERGGQWDKGKGFDTFGP 180

Query: 181 LGPYLVTKDEIQXXXXXXXXXXXXGHRHQTGNTNQMIFNFNFLVAHITSFITLMPGDIXX 240
           +GP+LVT+DE+             GHR+Q GNT  M+F    LVA++++ +TL       
Sbjct: 181 IGPWLVTRDEVPDPQRLDLWLEIDGHRYQNGNTRTMVFTVAQLVAYLSTCMTLQXXXXXX 240

Query: 241 XXXXXXXXLGMDP-PVFLKEGDEMKLNIDSLGSQ 273
                       P PVFLK G  ++L I+ LG Q
Sbjct: 241 XXXXXXXXXXXKPSPVFLKAGQTVRLGIEGLGEQ 274


>UGL_BURCC RecName: Full=Ureidoglycolate lyase;         Short=UGL;  
                 EC=4.3.2.3;AltName: Full=Ureidoglycolase;AltName:
           Full=Ureidoglycolatase;
          Length = 282

 Score =  229 bits (584), Expect = 2e-62
 Identities = 131/274 (47%), Positives = 166/274 (60%), Gaps = 1/274 (0%)

Query: 1   MKFLRIGKAGQEIPVALDRNGKYRNLSSIIKDLNSETINFETLDKIKDIXXXXXXXXXXX 60
           MK LR G +GQE P  LD  G+ R+LS+ + DL  + ++   L +++ I           
Sbjct: 1   MKLLRYGPSGQEKPGILDSAGRIRDLSAHVPDLAGDVLSDAGLARLRAIDPATLPLVSGE 60

Query: 61  XRIGSCISKPGNFFAIGLNYVEHAKETGAKTPDNPVLFNKSVHSIVGPNDNVIIPKTSKK 120
            RIG+C+   G F  IGLNY +HA E G   P  PV+F K   SI GPND + IPK S K
Sbjct: 61  PRIGACVGHVGKFIGIGLNYADHAAEAGMPVPKEPVVFGKWTSSICGPNDGIDIPKGSVK 120

Query: 121 LDHEVEIAFVIGKKAKRVLEKDAQDYIFGYCICNDISEREWQKEKGGQWVKGKSGDTFGP 180
            D EVE+  VIG K K V E  A DY+ GYC+ ND+SEREWQ E+GGQW KGK  DTFGP
Sbjct: 121 TDWEVELGVVIGAKCKDVDEARALDYVAGYCVVNDVSEREWQIERGGQWDKGKGFDTFGP 180

Query: 181 LGPYLVTKDEIQXXXXXXXXXXXXGHRHQTGNTNQMIFNFNFLVAHITSFITLMPGDIXX 240
           +GP+LVT+DE+             GHR+Q GNT  M+F    LVA++++ +TL       
Sbjct: 181 IGPWLVTRDEVPDPQRLDLWLEIDGHRYQNGNTRTMVFTVAQLVAYLSTCMTLQXXXXXX 240

Query: 241 XXXXXXXXLGMDP-PVFLKEGDEMKLNIDSLGSQ 273
                       P PVFLK G  ++L I+ LG Q
Sbjct: 241 XXXXXXXXXXXKPSPVFLKAGQTVRLGIEGLGEQ 274


>UGL_BURCA RecName: Full=Ureidoglycolate lyase;         Short=UGL;  
                 EC=4.3.2.3;AltName: Full=Ureidoglycolase;AltName:
           Full=Ureidoglycolatase;
          Length = 282

 Score =  229 bits (584), Expect = 2e-62
 Identities = 131/274 (47%), Positives = 166/274 (60%), Gaps = 1/274 (0%)

Query: 1   MKFLRIGKAGQEIPVALDRNGKYRNLSSIIKDLNSETINFETLDKIKDIXXXXXXXXXXX 60
           MK LR G +GQE P  LD  G+ R+LS+ + DL  + ++   L +++ I           
Sbjct: 1   MKLLRYGPSGQEKPGILDAAGRIRDLSAHVPDLAGDVLSDAGLARLRAIDPATLPLVSGE 60

Query: 61  XRIGSCISKPGNFFAIGLNYVEHAKETGAKTPDNPVLFNKSVHSIVGPNDNVIIPKTSKK 120
            RIG+C+   G F  IGLNY +HA E G   P  PV+F K   SI GPND + IPK S K
Sbjct: 61  PRIGACVGHVGKFIGIGLNYADHAAEAGMPVPKEPVVFGKWTSSICGPNDGIDIPKGSVK 120

Query: 121 LDHEVEIAFVIGKKAKRVLEKDAQDYIFGYCICNDISEREWQKEKGGQWVKGKSGDTFGP 180
            D EVE+  VIG K K V E  A DY+ GYC+ ND+SEREWQ E+GGQW KGK  DTFGP
Sbjct: 121 TDWEVELGVVIGAKCKDVDEARALDYVAGYCVVNDVSEREWQIERGGQWDKGKGFDTFGP 180

Query: 181 LGPYLVTKDEIQXXXXXXXXXXXXGHRHQTGNTNQMIFNFNFLVAHITSFITLMPGDIXX 240
           +GP+LVT+DE+             GHR+Q GNT  M+F    LVA++++ +TL       
Sbjct: 181 IGPWLVTRDEVPDPQRLDLWLEIDGHRYQNGNTRTMVFTVAQLVAYLSTCMTLQXXXXXX 240

Query: 241 XXXXXXXXLGMDP-PVFLKEGDEMKLNIDSLGSQ 273
                       P PVFLK G  ++L I+ LG Q
Sbjct: 241 XXXXXXXXXXXKPSPVFLKAGQTVRLGIEGLGEQ 274


>FAHD2_XENLA RecName: Full=Fumarylacetoacetate hydrolase
           domain-containing protein 2;         EC=3.-.-.-;
          Length = 319

 Score =  187 bits (476), Expect = 7e-50
 Identities = 93/213 (43%), Positives = 128/213 (60%), Gaps = 1/213 (0%)

Query: 67  ISKPGNFFAIGLNYVEHAKETGAKTPDNPVLFNKSVHSIVGPNDNVIIPKTSKKLDHEVE 126
           I+ P     IG+NYV+H  E     P  P++FNK   SIVGP+D + IP+ S+++D E E
Sbjct: 107 ITNPEKIICIGMNYVDHCLEQNVPVPKEPIIFNKFASSIVGPSDPIRIPEESQEVDWEAE 166

Query: 127 IAFVIGKKAKRVLEKDAQDYIFGYCICNDISEREWQKEKGG-QWVKGKSGDTFGPLGPYL 185
           +AFVIGKK K + E+DA D++ GY + +D+S R+WQ +K G QW+ GK+ DTF PLGP L
Sbjct: 167 LAFVIGKKGKNIKEEDAMDHVVGYTVAHDVSARDWQMKKNGKQWLLGKTFDTFCPLGPAL 226

Query: 186 VTKDEIQXXXXXXXXXXXXGHRHQTGNTNQMIFNFNFLVAHITSFITLMPGDIXXXXXXX 245
           VTKD I             G   Q  NTNQM+F    L+A  + F+TL PGD+       
Sbjct: 227 VTKDVISDPHNLGIRCRVNGDLVQNSNTNQMVFKTEALIAWASKFVTLNPGDVFLTGTPP 286

Query: 246 XXXLGMDPPVFLKEGDEMKLNIDSLGSQNSKVI 278
              +   PPVFLK GD ++  ID LG+ ++ V+
Sbjct: 287 GVGVFRKPPVFLKAGDVVRCEIDELGAISNPVV 319


>FAHD2_RAT RecName: Full=Fumarylacetoacetate hydrolase
           domain-containing protein 2;         EC=3.-.-.-;
          Length = 313

 Score =  187 bits (476), Expect = 7e-50
 Identities = 90/212 (42%), Positives = 128/212 (60%)

Query: 67  ISKPGNFFAIGLNYVEHAKETGAKTPDNPVLFNKSVHSIVGPNDNVIIPKTSKKLDHEVE 126
           +++P     +GLNY +H +E   + P NP++F+K   SIVGP D++I+P  SK++D EVE
Sbjct: 102 VTRPDKVICVGLNYADHCQEQNVRVPKNPIIFSKFSSSIVGPYDSIILPPESKEVDWEVE 161

Query: 127 IAFVIGKKAKRVLEKDAQDYIFGYCICNDISEREWQKEKGGQWVKGKSGDTFGPLGPYLV 186
           +A VIGKK K +   D   Y+ G+ + +D+S R+WQ   G QW+ GK+ DTF PLGP LV
Sbjct: 162 MAVVIGKKGKHIKATDVMAYVAGFTVAHDVSARDWQMRNGKQWLLGKTFDTFCPLGPALV 221

Query: 187 TKDEIQXXXXXXXXXXXXGHRHQTGNTNQMIFNFNFLVAHITSFITLMPGDIXXXXXXXX 246
           TKD I             G   Q+ NTNQM+F    L+A ++ F+TL PGDI        
Sbjct: 222 TKDTIADPHNLKISCRVNGEIVQSSNTNQMVFKTEDLIAWVSQFVTLYPGDILLTGTPPG 281

Query: 247 XXLGMDPPVFLKEGDEMKLNIDSLGSQNSKVI 278
             +   PPVFLK+GDE++  I+ LG   +KV+
Sbjct: 282 VGMFRKPPVFLKKGDEVQCEIEELGVIINKVV 313


>FAH2A_HUMAN RecName: Full=Fumarylacetoacetate hydrolase
           domain-containing protein 2A;         EC=3.-.-.-;
          Length = 314

 Score =  182 bits (461), Expect = 4e-48
 Identities = 87/213 (40%), Positives = 128/213 (60%), Gaps = 1/213 (0%)

Query: 67  ISKPGNFFAIGLNYVEHAKETGAKTPDNPVLFNKSVHSIVGPNDNVIIPKTSKKLDHEVE 126
           +++P     +G+NYV+H KE     P  P++F+K   SIVGP D V++P  S+++D EVE
Sbjct: 102 VTRPDKVVCVGMNYVDHCKEQNVPVPKEPIIFSKFASSIVGPYDEVVLPPQSQEVDWEVE 161

Query: 127 IAFVIGKKAKRVLEKDAQDYIFGYCICNDISEREWQKEKGG-QWVKGKSGDTFGPLGPYL 185
           +A VIGKK K +   DA  ++ G+ + +D+S R+WQ  + G QW+ GK+ DTF PLGP L
Sbjct: 162 LAVVIGKKGKHIKATDAMAHVAGFTVAHDVSARDWQMRRNGKQWLLGKTFDTFCPLGPAL 221

Query: 186 VTKDEIQXXXXXXXXXXXXGHRHQTGNTNQMIFNFNFLVAHITSFITLMPGDIXXXXXXX 245
           VTKD +             G   Q+GNTNQM+F    L+A ++ F+T  PGD+       
Sbjct: 222 VTKDSVADPHNLKICCRVNGEVVQSGNTNQMVFKTEDLIAWVSQFVTFYPGDVILTGTPP 281

Query: 246 XXXLGMDPPVFLKEGDEMKLNIDSLGSQNSKVI 278
              +   PPVFLK+GDE++  I+ LG   +KV+
Sbjct: 282 GVGVFRKPPVFLKKGDEVQCEIEELGVIINKVV 314


>FAHD2_BOVIN RecName: Full=Fumarylacetoacetate hydrolase
           domain-containing protein 2;         EC=3.-.-.-;
          Length = 314

 Score =  176 bits (447), Expect = 2e-46
 Identities = 84/213 (39%), Positives = 127/213 (59%), Gaps = 1/213 (0%)

Query: 67  ISKPGNFFAIGLNYVEHAKETGAKTPDNPVLFNKSVHSIVGPNDNVIIPKTSKKLDHEVE 126
           +++P     +G+NY +H +E     P  P++F+K   +IVGP DN+I+P  S+++D EVE
Sbjct: 102 VTRPDKVVCVGMNYADHCREQNVPVPKEPIIFSKFASAIVGPYDNIILPPESQEVDWEVE 161

Query: 127 IAFVIGKKAKRVLEKDAQDYIFGYCICNDISEREWQKEKGG-QWVKGKSGDTFGPLGPYL 185
           +A VIGK+ K +   DA  ++ G+ + +D+S R+WQ  + G QW+ GK+ DTF PLGP L
Sbjct: 162 LAVVIGKRGKYIKATDAMAHVAGFTVAHDVSARDWQMGRNGKQWLLGKTFDTFCPLGPAL 221

Query: 186 VTKDEIQXXXXXXXXXXXXGHRHQTGNTNQMIFNFNFLVAHITSFITLMPGDIXXXXXXX 245
           VTKD +             G   Q+ NTNQM+F    L+  ++ F+TL PGDI       
Sbjct: 222 VTKDSVADPHNLKICCRVNGELMQSSNTNQMVFKTEELITWVSQFVTLYPGDIILTGTPP 281

Query: 246 XXXLGMDPPVFLKEGDEMKLNIDSLGSQNSKVI 278
              +   PPVFLK+GDE++  I+ LG   +KV+
Sbjct: 282 GVGVFRKPPVFLKKGDEVQCEIEELGVIINKVV 314


>FAHD2_PONAB RecName: Full=Fumarylacetoacetate hydrolase
           domain-containing protein 2;         EC=3.-.-.-;
          Length = 314

 Score =  175 bits (444), Expect = 4e-46
 Identities = 85/213 (39%), Positives = 125/213 (58%), Gaps = 1/213 (0%)

Query: 67  ISKPGNFFAIGLNYVEHAKETGAKTPDNPVLFNKSVHSIVGPNDNVIIPKTSKKLDHEVE 126
           +++P     + +NYV+H KE     P  P +F+K   SIVGP D V++P  S+++D EVE
Sbjct: 102 VTRPDKVVCVRMNYVDHCKEQNVPVPKEPFIFSKFASSIVGPYDEVVLPPQSQEVDWEVE 161

Query: 127 IAFVIGKKAKRVLEKDAQDYIFGYCICNDISEREWQKEKGG-QWVKGKSGDTFGPLGPYL 185
           +A VIGKK K +   DA  ++ G+ + +D+S R+WQ  + G QW+ GK+ DTF PLGP L
Sbjct: 162 LAVVIGKKGKHIKATDAMAHVAGFTVAHDVSARDWQMRRNGKQWLLGKTFDTFCPLGPAL 221

Query: 186 VTKDEIQXXXXXXXXXXXXGHRHQTGNTNQMIFNFNFLVAHITSFITLMPGDIXXXXXXX 245
           VTKD +             G   Q+ NTNQM+F    L+A ++ F+T  PGD+       
Sbjct: 222 VTKDSVADPHNLKICCRVNGELVQSSNTNQMVFKTEDLIAWVSQFVTFYPGDVILTGTPP 281

Query: 246 XXXLGMDPPVFLKEGDEMKLNIDSLGSQNSKVI 278
              +   PPVFLK+GDE++  I+ LG   +KV+
Sbjct: 282 GVGVFRKPPVFLKKGDEVQCEIEELGVIINKVV 314


>FAH2B_HUMAN RecName: Full=Fumarylacetoacetate hydrolase
           domain-containing protein 2B;         EC=3.-.-.-;
          Length = 314

 Score =  175 bits (443), Expect = 5e-46
 Identities = 85/213 (39%), Positives = 125/213 (58%), Gaps = 1/213 (0%)

Query: 67  ISKPGNFFAIGLNYVEHAKETGAKTPDNPVLFNKSVHSIVGPNDNVIIPKTSKKLDHEVE 126
           ++ P     +G+NYV+H KE     P  P++F+K   SIVGP D V++P  S+++D EVE
Sbjct: 102 VTWPDKVVCVGMNYVDHCKEQNVPVPKEPIIFSKFASSIVGPYDEVVLPPQSQEVDWEVE 161

Query: 127 IAFVIGKKAKRVLEKDAQDYIFGYCICNDISEREW-QKEKGGQWVKGKSGDTFGPLGPYL 185
           +A VIGKK K +   DA  ++ G+ + +D+S R+W  +  G QW+ GK+ DTF PLGP L
Sbjct: 162 LAVVIGKKGKHIKATDAMAHVAGFTVAHDVSARDWLTRRNGKQWLLGKTFDTFCPLGPAL 221

Query: 186 VTKDEIQXXXXXXXXXXXXGHRHQTGNTNQMIFNFNFLVAHITSFITLMPGDIXXXXXXX 245
           VTKD +             G   Q+ NTNQM+F    L+A ++ F+T  PGD+       
Sbjct: 222 VTKDSVADPHNLKICCRVNGEVVQSSNTNQMVFKTEDLIAWVSQFVTFYPGDVILTGTPP 281

Query: 246 XXXLGMDPPVFLKEGDEMKLNIDSLGSQNSKVI 278
              +   PPVFLK+GDE++  I+ LG   +KV+
Sbjct: 282 GVGVFRKPPVFLKKGDEVQCEIEELGVIINKVV 314


>FAHD2_MOUSE RecName: Full=Fumarylacetoacetate hydrolase
           domain-containing protein 2A;         EC=3.-.-.-;
          Length = 313

 Score =  166 bits (420), Expect = 2e-43
 Identities = 81/212 (38%), Positives = 118/212 (55%)

Query: 67  ISKPGNFFAIGLNYVEHAKETGAKTPDNPVLFNKSVHSIVGPNDNVIIPKTSKKLDHEVE 126
           +++P     +GLNY +H +E   +               VGP D +I+P  SK++D EVE
Sbjct: 102 VTRPEKVICVGLNYADHCQEQNVRVXXXXXXXXXXXXXXVGPYDEIILPPESKEVDWEVE 161

Query: 127 IAFVIGKKAKRVLEKDAQDYIFGYCICNDISEREWQKEKGGQWVKGKSGDTFGPLGPYLV 186
           +A VIGKK K +   D   ++ G+ + +D+S R+WQ   G QW+ GK+ DTF PLGP LV
Sbjct: 162 MAVVIGKKGKHIKATDVMAHVAGFTVAHDVSARDWQMRNGKQWLLGKTFDTFCPLGPALV 221

Query: 187 TKDEIQXXXXXXXXXXXXGHRHQTGNTNQMIFNFNFLVAHITSFITLMPGDIXXXXXXXX 246
           TKD I             G   Q+ NTNQM+F   +L+A ++ F+TL PGD+        
Sbjct: 222 TKDTIADPHNLKICCRVNGEVVQSSNTNQMVFKTEYLIAWVSQFVTLYPGDLLLTGTPPG 281

Query: 247 XXLGMDPPVFLKEGDEMKLNIDSLGSQNSKVI 278
             +   PPVFLK+GDE++  I+ LG   +KV+
Sbjct: 282 VGMFRKPPVFLKKGDEVQCEIEELGVIINKVV 313


>Y1397_PYRAB RecName: Full=Uncharacterized protein PYRAB13970;
          Length = 225

 Score =  142 bits (357), Expect = 5e-36
 Identities = 73/173 (42%), Positives = 104/173 (60%), Gaps = 4/173 (2%)

Query: 69  KPGNFFAIGLNYVEHAKETGAKTPDNPVLFNKSVHSIVGPNDNVIIPKTSKKLDHEVEIA 128
           +P    A+  NY EHA+E G++ P+ PV+F K   +++GPN  +++P+ SK++DHEVE+A
Sbjct: 14  RPTKIIALAKNYAEHAREMGSEPPEEPVIFLKPPSALIGPNSVIVLPRRSKRVDHEVELA 73

Query: 129 FVIGKKAKRVLEKDAQDYIFGYCICNDISEREWQKE---KGGQWVKGKSGDTFGPLGPYL 185
            +IGK+AK V  + A DYI GY I  DI+ R+ Q E   KG  W   K  DTF P+GP +
Sbjct: 74  VIIGKRAKNVPAEKAFDYILGYTILLDITARDLQAEARKKGYPWTVSKGFDTFAPIGPRI 133

Query: 186 VTKDEIQXXXXXXXXXXXXGHRHQTGNTNQMIFNFNFLVAHITSFITLMPGDI 238
           V K E+             G   Q G T++MIF    L+ +I+S +TL PGDI
Sbjct: 134 VDKRELD-PSDLEIGLKVNGKVRQLGRTSEMIFKIPELIEYISSIMTLEPGDI 185


>Y1656_METJA RecName: Full=Uncharacterized protein MJ1656;
          Length = 237

 Score =  141 bits (355), Expect = 8e-36
 Identities = 80/204 (39%), Positives = 113/204 (55%), Gaps = 13/204 (6%)

Query: 69  KPGNFFAIGLNYVEHAKETGAKTPDNPVLFNKSVHSIVGPNDNVIIPKTSKKLDHEVEIA 128
           KP     +GLNY++HAKE   + P+ P++F K   +I+   D +I P+ SK++D+EVE+A
Sbjct: 36  KPTKIICVGLNYIDHAKELNMEIPEYPIIFLKPTSAIIYNEDYIIRPRISKRVDYEVELA 95

Query: 129 FVIGKKAKRVLEKDAQDYIFGYCICNDISEREWQKEKGGQWVKGKSGDTFGPLGPYLVTK 188
            VIGKK K + + +A DYI GY I ND++ R+ Q +K GQW + KS DTF P+GP +V  
Sbjct: 96  IVIGKKCKNIKKDEANDYIMGYTILNDVTARDLQ-QKDGQWTRAKSFDTFCPIGPRIVKD 154

Query: 189 DEIQXXXXXXXXXXXXGHRHQTGNTNQMIFNFNFLVAHITSFITLMPGDIXXXXXXXXXX 248
            +              G   Q  NT  MIF+   LV  + S +TL PGDI          
Sbjct: 155 ID---PMNLNIECRVNGEIKQKSNTKNMIFDVYELVEFVASIMTLYPGDI--------IS 203

Query: 249 LGMDPPV-FLKEGDEMKLNIDSLG 271
            G  P V  LK GD ++  I+ +G
Sbjct: 204 TGTPPGVGELKAGDVVECEIEGIG 227


>Y643_PYRHO RecName: Full=Uncharacterized protein PH0643;
          Length = 230

 Score =  140 bits (354), Expect = 1e-35
 Identities = 79/215 (36%), Positives = 117/215 (54%), Gaps = 11/215 (5%)

Query: 69  KPGNFFAIGLNYVEHAKETGAKTPDNPVLFNKSVHSIVGPNDNVIIPKTSKKLDHEVEIA 128
           +P    A+  NY EHA+E G++ P+ P++F K   +++GP  ++I+P+ SK++DHEVE+A
Sbjct: 19  RPTKIVALAKNYAEHAREMGSEPPEEPIIFLKPPSALIGPGSSIILPRRSKRVDHEVELA 78

Query: 129 FVIGKKAKRVLEKDAQDYIFGYCICNDISEREWQKE---KGGQWVKGKSGDTFGPLGPYL 185
            ++GK+AK V    A DYI GY I  DI+ R+ Q E   KG  W   K  DTF P+GP +
Sbjct: 79  VIMGKRAKNVPASKAFDYILGYTIILDITARDLQAEARKKGYPWTISKGFDTFAPIGPRV 138

Query: 186 VTKDEIQXXXXXXXXXXXXGHRHQTGNTNQMIFNFNFLVAHITSFITLMPGDIXXXXXXX 245
           V   E+             G   Q G T+QMIF    L+ +I+  +TL PGDI       
Sbjct: 139 VDSRELD-PSDLEIGLKVNGKIRQLGRTSQMIFKIPELIEYISHIMTLEPGDIIATGTPP 197

Query: 246 XXXLGMDPPVFLKEGDEMKLNIDSLGSQNSKVILE 280
               G+ P   L+ GD ++  I+ +G     V+ E
Sbjct: 198 ----GVGP---LRHGDRIEAWIEGIGKMEFDVLAE 225


>FAHD2_DICDI RecName: Full=Fumarylacetoacetate hydrolase
           domain-containing protein 2 homolog;         EC=3.-.-.-;
          Length = 305

 Score =  137 bits (346), Expect = 9e-35
 Identities = 77/214 (35%), Positives = 106/214 (49%), Gaps = 10/214 (4%)

Query: 69  KPGNFFAIGLNYVEHAKETGAKTPDNPVLFNKSVHSIVGPNDNVIIPKTSKKLDHEVEIA 128
           +PG    IGLNY EHA E     P  P++F+K  ++I GPND++I P             
Sbjct: 86  EPGKIICIGLNYKEHANEAKMAIPKEPIVFSKFDNAICGPNDSIIKPXXXXXXXXXXXXX 145

Query: 129 FVIGKKAKRVLEKDAQDYIFGYCICNDISEREWQ-KEKGGQWVKGKSGDTFGPLGPYLVT 187
             IGK+AK V E DA  Y+ GY + ND+S R+WQ ++   QW+ GK+ DTF P+GP +V 
Sbjct: 146 XXIGKQAKNVSESDALQYVAGYTVGNDVSARDWQLRKNNSQWLLGKTFDTFAPIGPSIVI 205

Query: 188 KDEIQ--------XXXXXXXXXXXXGHRHQTGNTNQMIFNFNFLVAHITSFITLMPGDIX 239
             E+                     G   Q   T + IFN   +V++++   TL PGDI 
Sbjct: 206 NPEVAALSDDTYFDPNNLSIKCTLNGQVVQNSTTKEFIFNIQTVVSYLSKLFTLNPGDII 265

Query: 240 XXXXXXXXXLGMDP-PVFLKEGDEMKLNIDSLGS 272
                        P P+FLK GD +K  I+ LGS
Sbjct: 266 FTGTPSGVGFIRKPNPIFLKSGDVIKCEIEELGS 299


>Y2225_ARCFU RecName: Full=Uncharacterized protein AF_2225;
          Length = 250

 Score =  135 bits (339), Expect = 6e-34
 Identities = 74/202 (36%), Positives = 115/202 (56%), Gaps = 11/202 (5%)

Query: 70  PGNFFAIGLNYVEHAKETGAKTPDNPVLFNKSVHSIVGPNDNVIIPKTSKKLDHEVEIAF 129
           P    A+GLNY++HA+E     P+ P+LF K   +++G +D +I+P+ S+++D+E E+A 
Sbjct: 43  PSKIIAVGLNYIDHAEELNMPVPEEPILFMKPSTAVIGHDDCIILPQISQRVDYEGELAV 102

Query: 130 VIGKKAKRVLEKDAQDYIFGYCICNDISEREWQKEKGGQWVKGKSGDTFGPLGPYLVTKD 189
           VI +  + V E +A DYI GY   ND++ R+ Q  K GQW + KS DTF PLGPY+    
Sbjct: 103 VIAEDCRNVPETNAADYILGYTCFNDVTARDLQ-AKDGQWTRAKSFDTFAPLGPYIA--- 158

Query: 190 EIQXXXXXXXXXXXXGHRHQTGNTNQMIFNFNFLVAHITSFITLMPGDIXXXXXXXXXXL 249
           EI             G   Q  NT+ +IF+   LV+ ++S +TL  GD+          +
Sbjct: 159 EIDDPSKLGIQTRVNGKVVQKSNTSNLIFDVFQLVSFVSSVMTLKAGDV--IATGTPAGV 216

Query: 250 GMDPPVFLKEGDEMKLNIDSLG 271
           GM     LK+GD +++ I+ +G
Sbjct: 217 GM-----LKDGDVVEVEIEKIG 233


>YISK_BACSU RecName: Full=Uncharacterized protein yisK;
          Length = 301

 Score =  132 bits (332), Expect = 4e-33
 Identities = 79/215 (36%), Positives = 121/215 (56%), Gaps = 5/215 (2%)

Query: 67  ISKPG-NFFAIGLNYVEHAKETGAKT--PDNPVLFNKSVHSIVGPNDNVII-PKTSKKLD 122
           I KP  N   IG NY +HA E G++   P++P++F KS  ++ G  D V    + + +LD
Sbjct: 87  IPKPSKNIICIGKNYRDHAIEMGSEADIPEHPMVFTKSPVTVTGHGDIVKSHEEVTSQLD 146

Query: 123 HEVEIAFVIGKKAKRVLEKDAQDYIFGYCICNDISEREWQKEKGGQWVKGKSGDTFGPLG 182
           +E E+A VIGK   R+ ++DA D++FGY I NDI+ R+ QK +  Q+  GKS DT  P+G
Sbjct: 147 YEGELAVVIGKSGTRISKEDAYDHVFGYTIVNDITARDLQK-RHKQFFIGKSLDTTCPMG 205

Query: 183 PYLVTKDEIQXXXXXXXXXXXXGHRHQTGNTNQMIFNFNFLVAHITSFITLMPGDIXXXX 242
           P LV K  IQ            G   Q+G+ + MIF+   L+  ++  +TL  GDI    
Sbjct: 206 PVLVHKSSIQEPERLKVETRVNGELRQSGSASDMIFSIPELIETLSKGMTLEAGDIIATG 265

Query: 243 XXXXXXLGMDPPVFLKEGDEMKLNIDSLGSQNSKV 277
                  G  PP FL+ GD++ + ID +G+ ++++
Sbjct: 266 TPSGVGKGFTPPKFLRSGDKIDITIDPIGTLSNQI 300


>Y973_STAAC RecName: Full=Uncharacterized protein SACOL0973;
          Length = 300

 Score =  130 bits (326), Expect = 2e-32
 Identities = 74/209 (35%), Positives = 113/209 (54%), Gaps = 7/209 (3%)

Query: 67  ISKPGNFFAIGLNYVEHAKETGAKTPDNPVLFNKSVHSIVGPNDNVIIPK---TSKKLDH 123
           ++ P N  A G NY +HA E   +  +   +F K+  S+ G  DN  IP     + +LD+
Sbjct: 89  VTPPNNVIAFGRNYKDHANELNHEV-EKLYVFTKAASSLTG--DNATIPNHKDITDQLDY 145

Query: 124 EVEIAFVIGKKAKRVLEKDAQDYIFGYCICNDISEREWQKEKGGQWVKGKSGDTFGPLGP 183
           E E+  VIGK  +++ +  A DY++GY I NDI++R+ Q E+   ++  KS     P+GP
Sbjct: 146 EGELGIVIGKSGEKIPKALALDYVYGYTIINDITDRKAQSEQDQAFLS-KSLTGGCPMGP 204

Query: 184 YLVTKDEIQXXXXXXXXXXXXGHRHQTGNTNQMIFNFNFLVAHITSFITLMPGDIXXXXX 243
           Y+VTKDE+                 Q GNT +MI   + L+  I+ ++ L PGDI     
Sbjct: 205 YIVTKDELPLPENVNIVTKVNNEIRQDGNTGEMILKIDELIEEISKYVALHPGDIIATGT 264

Query: 244 XXXXXLGMDPPVFLKEGDEMKLNIDSLGS 272
                 GM PP FL+ GDE+K+ ID++G+
Sbjct: 265 PAGVGAGMQPPKFLQPGDEVKVTIDNIGT 293


>Y968_STAAM RecName: Full=Uncharacterized protein SAV0968;
          Length = 300

 Score =  130 bits (326), Expect = 2e-32
 Identities = 74/209 (35%), Positives = 113/209 (54%), Gaps = 7/209 (3%)

Query: 67  ISKPGNFFAIGLNYVEHAKETGAKTPDNPVLFNKSVHSIVGPNDNVIIPK---TSKKLDH 123
           ++ P N  A G NY +HA E   +  +   +F K+  S+ G  DN  IP     + +LD+
Sbjct: 89  VTPPNNVIAFGRNYKDHANELNHEV-EKLYVFTKAASSLTG--DNATIPNHKDITDQLDY 145

Query: 124 EVEIAFVIGKKAKRVLEKDAQDYIFGYCICNDISEREWQKEKGGQWVKGKSGDTFGPLGP 183
           E E+  VIGK  +++ +  A DY++GY I NDI++R+ Q E+   ++  KS     P+GP
Sbjct: 146 EGELGIVIGKSGEKIPKALALDYVYGYTIINDITDRKAQSEQDQAFLS-KSLTGGCPMGP 204

Query: 184 YLVTKDEIQXXXXXXXXXXXXGHRHQTGNTNQMIFNFNFLVAHITSFITLMPGDIXXXXX 243
           Y+VTKDE+                 Q GNT +MI   + L+  I+ ++ L PGDI     
Sbjct: 205 YIVTKDELPLPENVNIVTKVNNEIRQDGNTGEMILKIDELIEEISKYVALHPGDIIATGT 264

Query: 244 XXXXXLGMDPPVFLKEGDEMKLNIDSLGS 272
                 GM PP FL+ GDE+K+ ID++G+
Sbjct: 265 PAGVGAGMQPPKFLQPGDEVKVTIDNIGT 293


>Y906_STAA8 RecName: Full=Uncharacterized protein SAOUHSC_00906;
          Length = 300

 Score =  130 bits (326), Expect = 2e-32
 Identities = 74/209 (35%), Positives = 113/209 (54%), Gaps = 7/209 (3%)

Query: 67  ISKPGNFFAIGLNYVEHAKETGAKTPDNPVLFNKSVHSIVGPNDNVIIPK---TSKKLDH 123
           ++ P N  A G NY +HA E   +  +   +F K+  S+ G  DN  IP     + +LD+
Sbjct: 89  VTPPNNVIAFGRNYKDHANELNHEV-EKLYVFTKAASSLTG--DNATIPNHKDITDQLDY 145

Query: 124 EVEIAFVIGKKAKRVLEKDAQDYIFGYCICNDISEREWQKEKGGQWVKGKSGDTFGPLGP 183
           E E+  VIGK  +++ +  A DY++GY I NDI++R+ Q E+   ++  KS     P+GP
Sbjct: 146 EGELGIVIGKSGEKIPKALALDYVYGYTIINDITDRKAQSEQDQAFLS-KSLTGGCPMGP 204

Query: 184 YLVTKDEIQXXXXXXXXXXXXGHRHQTGNTNQMIFNFNFLVAHITSFITLMPGDIXXXXX 243
           Y+VTKDE+                 Q GNT +MI   + L+  I+ ++ L PGDI     
Sbjct: 205 YIVTKDELPLPENVNIVTKVNNEIRQDGNTGEMILKIDELIEEISKYVALHPGDIIATGT 264

Query: 244 XXXXXLGMDPPVFLKEGDEMKLNIDSLGS 272
                 GM PP FL+ GDE+K+ ID++G+
Sbjct: 265 PAGVGAGMQPPKFLQPGDEVKVTIDNIGT 293


>Y871_STAA3 RecName: Full=Uncharacterized protein SAUSA300_0871;
          Length = 300

 Score =  130 bits (326), Expect = 2e-32
 Identities = 74/209 (35%), Positives = 113/209 (54%), Gaps = 7/209 (3%)

Query: 67  ISKPGNFFAIGLNYVEHAKETGAKTPDNPVLFNKSVHSIVGPNDNVIIPK---TSKKLDH 123
           ++ P N  A G NY +HA E   +  +   +F K+  S+ G  DN  IP     + +LD+
Sbjct: 89  VTPPNNVIAFGRNYKDHANELNHEV-EKLYVFTKAASSLTG--DNATIPNHKDITDQLDY 145

Query: 124 EVEIAFVIGKKAKRVLEKDAQDYIFGYCICNDISEREWQKEKGGQWVKGKSGDTFGPLGP 183
           E E+  VIGK  +++ +  A DY++GY I NDI++R+ Q E+   ++  KS     P+GP
Sbjct: 146 EGELGIVIGKSGEKIPKALALDYVYGYTIINDITDRKAQSEQDQAFLS-KSLTGGCPMGP 204

Query: 184 YLVTKDEIQXXXXXXXXXXXXGHRHQTGNTNQMIFNFNFLVAHITSFITLMPGDIXXXXX 243
           Y+VTKDE+                 Q GNT +MI   + L+  I+ ++ L PGDI     
Sbjct: 205 YIVTKDELPLPENVNIVTKVNNEIRQDGNTGEMILKIDELIEEISKYVALHPGDIIATGT 264

Query: 244 XXXXXLGMDPPVFLKEGDEMKLNIDSLGS 272
                 GM PP FL+ GDE+K+ ID++G+
Sbjct: 265 PAGVGAGMQPPKFLQPGDEVKVTIDNIGT 293


>Y850_STAAW RecName: Full=Uncharacterized protein MW0850;
          Length = 300

 Score =  130 bits (326), Expect = 2e-32
 Identities = 74/209 (35%), Positives = 113/209 (54%), Gaps = 7/209 (3%)

Query: 67  ISKPGNFFAIGLNYVEHAKETGAKTPDNPVLFNKSVHSIVGPNDNVIIPK---TSKKLDH 123
           ++ P N  A G NY +HA E   +  +   +F K+  S+ G  DN  IP     + +LD+
Sbjct: 89  VTPPNNVIAFGRNYKDHANELNHEV-EKLYVFTKAASSLTG--DNATIPNHKDITDQLDY 145

Query: 124 EVEIAFVIGKKAKRVLEKDAQDYIFGYCICNDISEREWQKEKGGQWVKGKSGDTFGPLGP 183
           E E+  VIGK  +++ +  A DY++GY I NDI++R+ Q E+   ++  KS     P+GP
Sbjct: 146 EGELGIVIGKSGEKIPKALALDYVYGYTIINDITDRKAQSEQDQAFLS-KSLTGGCPMGP 204

Query: 184 YLVTKDEIQXXXXXXXXXXXXGHRHQTGNTNQMIFNFNFLVAHITSFITLMPGDIXXXXX 243
           Y+VTKDE+                 Q GNT +MI   + L+  I+ ++ L PGDI     
Sbjct: 205 YIVTKDELPLPENVNIVTKVNNEIRQDGNTGEMILKIDELIEEISKYVALHPGDIIATGT 264

Query: 244 XXXXXLGMDPPVFLKEGDEMKLNIDSLGS 272
                 GM PP FL+ GDE+K+ ID++G+
Sbjct: 265 PAGVGAGMQPPKFLQPGDEVKVTIDNIGT 293


>Y838_STAAS RecName: Full=Uncharacterized protein SAS0838;
          Length = 300

 Score =  130 bits (326), Expect = 2e-32
 Identities = 74/209 (35%), Positives = 113/209 (54%), Gaps = 7/209 (3%)

Query: 67  ISKPGNFFAIGLNYVEHAKETGAKTPDNPVLFNKSVHSIVGPNDNVIIPK---TSKKLDH 123
           ++ P N  A G NY +HA E   +  +   +F K+  S+ G  DN  IP     + +LD+
Sbjct: 89  VTPPNNVIAFGRNYKDHANELNHEV-EKLYVFTKAASSLTG--DNATIPNHKDITDQLDY 145

Query: 124 EVEIAFVIGKKAKRVLEKDAQDYIFGYCICNDISEREWQKEKGGQWVKGKSGDTFGPLGP 183
           E E+  VIGK  +++ +  A DY++GY I NDI++R+ Q E+   ++  KS     P+GP
Sbjct: 146 EGELGIVIGKSGEKIPKALALDYVYGYTIINDITDRKAQSEQDQAFLS-KSLTGGCPMGP 204

Query: 184 YLVTKDEIQXXXXXXXXXXXXGHRHQTGNTNQMIFNFNFLVAHITSFITLMPGDIXXXXX 243
           Y+VTKDE+                 Q GNT +MI   + L+  I+ ++ L PGDI     
Sbjct: 205 YIVTKDELPLPENVNIVTKVNNEIRQDGNTGEMILKIDELIEEISKYVALHPGDIIATGT 264

Query: 244 XXXXXLGMDPPVFLKEGDEMKLNIDSLGS 272
                 GM PP FL+ GDE+K+ ID++G+
Sbjct: 265 PAGVGAGMQPPKFLQPGDEVKVTIDNIGT 293


>Y837_STAAB RecName: Full=Uncharacterized protein SAB0837;
          Length = 300

 Score =  130 bits (326), Expect = 2e-32
 Identities = 74/209 (35%), Positives = 113/209 (54%), Gaps = 7/209 (3%)

Query: 67  ISKPGNFFAIGLNYVEHAKETGAKTPDNPVLFNKSVHSIVGPNDNVIIPK---TSKKLDH 123
           ++ P N  A G NY +HA E   +  +   +F K+  S+ G  DN  IP     + +LD+
Sbjct: 89  VTPPNNVIAFGRNYKDHANELNHEV-EKLYVFTKAASSLTG--DNATIPNHKDITDQLDY 145

Query: 124 EVEIAFVIGKKAKRVLEKDAQDYIFGYCICNDISEREWQKEKGGQWVKGKSGDTFGPLGP 183
           E E+  VIGK  +++ +  A DY++GY I NDI++R+ Q E+   ++  KS     P+GP
Sbjct: 146 EGELGIVIGKSGEKIPKALALDYVYGYTIINDITDRKAQSEQDQAFLS-KSLTGGCPMGP 204

Query: 184 YLVTKDEIQXXXXXXXXXXXXGHRHQTGNTNQMIFNFNFLVAHITSFITLMPGDIXXXXX 243
           Y+VTKDE+                 Q GNT +MI   + L+  I+ ++ L PGDI     
Sbjct: 205 YIVTKDELPLPENVNIVTKVNNEIRQDGNTGEMILKIDELIEEISKYVALHPGDIIATGT 264

Query: 244 XXXXXLGMDPPVFLKEGDEMKLNIDSLGS 272
                 GM PP FL+ GDE+K+ ID++G+
Sbjct: 265 PAGVGAGMQPPKFLQPGDEVKVTIDNIGT 293


>Y829_STAAN RecName: Full=Uncharacterized protein SA0829;
          Length = 300

 Score =  130 bits (326), Expect = 2e-32
 Identities = 74/209 (35%), Positives = 113/209 (54%), Gaps = 7/209 (3%)

Query: 67  ISKPGNFFAIGLNYVEHAKETGAKTPDNPVLFNKSVHSIVGPNDNVIIPK---TSKKLDH 123
           ++ P N  A G NY +HA E   +  +   +F K+  S+ G  DN  IP     + +LD+
Sbjct: 89  VTPPNNVIAFGRNYKDHANELNHEV-EKLYVFTKAASSLTG--DNATIPNHKDITDQLDY 145

Query: 124 EVEIAFVIGKKAKRVLEKDAQDYIFGYCICNDISEREWQKEKGGQWVKGKSGDTFGPLGP 183
           E E+  VIGK  +++ +  A DY++GY I NDI++R+ Q E+   ++  KS     P+GP
Sbjct: 146 EGELGIVIGKSGEKIPKALALDYVYGYTIINDITDRKAQSEQDQAFLS-KSLTGGCPMGP 204

Query: 184 YLVTKDEIQXXXXXXXXXXXXGHRHQTGNTNQMIFNFNFLVAHITSFITLMPGDIXXXXX 243
           Y+VTKDE+                 Q GNT +MI   + L+  I+ ++ L PGDI     
Sbjct: 205 YIVTKDELPLPENVNIVTKVNNEIRQDGNTGEMILKIDELIEEISKYVALHPGDIIATGT 264

Query: 244 XXXXXLGMDPPVFLKEGDEMKLNIDSLGS 272
                 GM PP FL+ GDE+K+ ID++G+
Sbjct: 265 PAGVGAGMQPPKFLQPGDEVKVTIDNIGT 293


>Y930_STAAR RecName: Full=Uncharacterized protein SAR0930;
          Length = 300

 Score =  129 bits (324), Expect = 3e-32
 Identities = 74/209 (35%), Positives = 113/209 (54%), Gaps = 7/209 (3%)

Query: 67  ISKPGNFFAIGLNYVEHAKETGAKTPDNPVLFNKSVHSIVGPNDNVIIPK---TSKKLDH 123
           ++ P N  A G NY +HA E   +  +   +F K+  S+ G  DN  IP     + +LD+
Sbjct: 89  VTPPNNVIAFGRNYKDHANELNHEV-ERLYVFTKAASSLTG--DNAKIPNHKDITDQLDY 145

Query: 124 EVEIAFVIGKKAKRVLEKDAQDYIFGYCICNDISEREWQKEKGGQWVKGKSGDTFGPLGP 183
           E E+  VIGK  +++ +  A DY++GY I NDI++R+ Q E+   ++  KS     P+GP
Sbjct: 146 EGELGIVIGKSGEKIPKALALDYVYGYTIINDITDRKAQSEQDQAFLS-KSLTGGCPMGP 204

Query: 184 YLVTKDEIQXXXXXXXXXXXXGHRHQTGNTNQMIFNFNFLVAHITSFITLMPGDIXXXXX 243
           Y+VTKDE+                 Q GNT +MI   + L+  I+ ++ L PGDI     
Sbjct: 205 YIVTKDELPLPENVNIVTKVNNEIRQDGNTGEMILKIDELIEEISKYVALHPGDIIATGT 264

Query: 244 XXXXXLGMDPPVFLKEGDEMKLNIDSLGS 272
                 GM PP FL+ GDE+K+ ID++G+
Sbjct: 265 PAGVGAGMQPPKFLQPGDEVKVTIDNIGT 293


>Y665_STAES RecName: Full=Uncharacterized protein SE_0665;
          Length = 301

 Score =  125 bits (314), Expect = 4e-31
 Identities = 73/209 (34%), Positives = 110/209 (52%), Gaps = 7/209 (3%)

Query: 67  ISKPGNFFAIGLNYVEHAKETGAKTPDNPVLFNKSVHSIVGPNDNVIIPK---TSKKLDH 123
           ++ P N  A G NY +HA E   +  D+  +F K+  S+ G  D   IP     +++LD+
Sbjct: 89  VTPPNNVIAFGRNYEDHASELNHEV-DSLYVFTKAASSLTG--DEATIPNHKDITEQLDY 145

Query: 124 EVEIAFVIGKKAKRVLEKDAQDYIFGYCICNDISEREWQKEKGGQWVKGKSGDTFGPLGP 183
           E E+  VIGK  +++    A DYI+GY I NDI++R  Q      ++  KS     P+GP
Sbjct: 146 EGELGIVIGKSGEKIPRGLALDYIYGYTIINDITDRTAQSSHDQAFLS-KSLTGACPMGP 204

Query: 184 YLVTKDEIQXXXXXXXXXXXXGHRHQTGNTNQMIFNFNFLVAHITSFITLMPGDIXXXXX 243
           Y+VTKDE+                 Q GNT +MI   + L+  I+ ++ L PGDI     
Sbjct: 205 YIVTKDELPAPENVNIVTKVNNEIRQDGNTGEMILKIDELIEKISKYVALHPGDIIATGT 264

Query: 244 XXXXXLGMDPPVFLKEGDEMKLNIDSLGS 272
                 G+ PP FL+ GDE+K+ ID++G+
Sbjct: 265 PAGVGAGLQPPQFLQPGDEVKVTIDNIGT 293


>Y556_STAEQ RecName: Full=Uncharacterized protein SERP0556;
          Length = 301

 Score =  125 bits (314), Expect = 4e-31
 Identities = 73/209 (34%), Positives = 110/209 (52%), Gaps = 7/209 (3%)

Query: 67  ISKPGNFFAIGLNYVEHAKETGAKTPDNPVLFNKSVHSIVGPNDNVIIPK---TSKKLDH 123
           ++ P N  A G NY +HA E   +  D+  +F K+  S+ G  D   IP     +++LD+
Sbjct: 89  VTPPNNVIAFGRNYEDHASELNHEV-DSLYVFTKAASSLTG--DEATIPNHKDITEQLDY 145

Query: 124 EVEIAFVIGKKAKRVLEKDAQDYIFGYCICNDISEREWQKEKGGQWVKGKSGDTFGPLGP 183
           E E+  VIGK  +++    A DYI+GY I NDI++R  Q      ++  KS     P+GP
Sbjct: 146 EGELGIVIGKSGEKIPRGLALDYIYGYTIINDITDRTAQSSHDQAFLS-KSLTGACPMGP 204

Query: 184 YLVTKDEIQXXXXXXXXXXXXGHRHQTGNTNQMIFNFNFLVAHITSFITLMPGDIXXXXX 243
           Y+VTKDE+                 Q GNT +MI   + L+  I+ ++ L PGDI     
Sbjct: 205 YIVTKDELPAPENVNIVTKVNNEIRQDGNTGEMILKIDELIEKISKYVALHPGDIIATGT 264

Query: 244 XXXXXLGMDPPVFLKEGDEMKLNIDSLGS 272
                 G+ PP FL+ GDE+K+ ID++G+
Sbjct: 265 PAGVGAGLQPPQFLQPGDEVKVTIDNIGT 293


>Y1982_STAHJ RecName: Full=Uncharacterized protein SH1982;
          Length = 301

 Score =  125 bits (314), Expect = 4e-31
 Identities = 72/207 (34%), Positives = 111/207 (53%), Gaps = 3/207 (1%)

Query: 67  ISKPGNFFAIGLNYVEHAKETGAKTPDNPVLFNKSVHSIVGPNDNVIIPKT-SKKLDHEV 125
           ++ P N  A G NY +HA E   +      +F K+  S+ G    +   K  + +LD+E 
Sbjct: 89  VTPPNNVIAFGRNYQDHASELNHEV-QRLYVFTKAASSLTGDESTIPNHKDITDQLDYEG 147

Query: 126 EIAFVIGKKAKRVLEKDAQDYIFGYCICNDISEREWQKEKGGQWVKGKSGDTFGPLGPYL 185
           E+  VIGK  +++ +  A DYI+GY I NDI++R+ Q E+   ++  KS     P+GPY+
Sbjct: 148 ELGIVIGKSGEKIPKALALDYIYGYTIINDITDRKAQNEQDQAFLS-KSLTGGCPMGPYI 206

Query: 186 VTKDEIQXXXXXXXXXXXXGHRHQTGNTNQMIFNFNFLVAHITSFITLMPGDIXXXXXXX 245
           VTKDE+                 Q GNT+QMI   + L+  I+ ++ L PGDI       
Sbjct: 207 VTKDELPTPENVNIVTKVNNDIRQDGNTSQMINKIDDLIEEISKYVALHPGDIIATGTPA 266

Query: 246 XXXLGMDPPVFLKEGDEMKLNIDSLGS 272
               G+ PP FL+ GDE+K+ ID++G+
Sbjct: 267 GVGAGLQPPQFLQPGDEVKVTIDNIGT 293


>Y1806_STAS1 RecName: Full=Uncharacterized protein SSP1806;
          Length = 301

 Score =  123 bits (309), Expect = 2e-30
 Identities = 71/207 (34%), Positives = 110/207 (53%), Gaps = 3/207 (1%)

Query: 67  ISKPGNFFAIGLNYVEHAKETGAKTPDNPVLFNKSVHSIVGPNDNVIIPKT-SKKLDHEV 125
           ++   N  A G NY +HA E   +      +F K+  S+ G N  +   K  + +LD+E 
Sbjct: 89  VTPTNNVIAFGRNYQDHANELNHEV-QRLYVFTKAASSLTGDNSTIPNHKDITDQLDYEG 147

Query: 126 EIAFVIGKKAKRVLEKDAQDYIFGYCICNDISEREWQKEKGGQWVKGKSGDTFGPLGPYL 185
           E+  VIGK  +++ +  A DY++GY I NDI++R+ Q  +   ++  KS     P+GPY+
Sbjct: 148 ELGIVIGKSGEKIPKGLALDYVYGYTIINDITDRKAQNAQDQAFLS-KSLTGGCPVGPYI 206

Query: 186 VTKDEIQXXXXXXXXXXXXGHRHQTGNTNQMIFNFNFLVAHITSFITLMPGDIXXXXXXX 245
           VTKDE+                 Q GNT QMI   + L+  I+ ++ L PGDI       
Sbjct: 207 VTKDELPTPEDVNIVTKVNNDIRQDGNTGQMILKIDELIEEISKYVALHPGDIIATGTPA 266

Query: 246 XXXLGMDPPVFLKEGDEMKLNIDSLGS 272
               GM+PP FL+ GDE+K+ ID++G+
Sbjct: 267 GVGAGMNPPQFLQPGDEIKVTIDNIGT 293


>HPAG_SALDU RecName: Full=4-hydroxyphenylacetate degradation
           bifunctional isomerase/decarboxylase;Includes:  RecName:
           Full=2-hydroxyhepta-2,4-diene-1,7-dioate isomerase;
          Length = 429

 Score =  120 bits (301), Expect = 1e-29
 Identities = 64/215 (29%), Positives = 112/215 (52%), Gaps = 7/215 (3%)

Query: 67  ISKPGNFFAIGLNYVEHAKETGAKTPDNPVLFNKSVHSIVGPNDNVIIPKTSKKLDHEVE 126
           +S  G  FA+GLNY +HA E     P  P++F K+ ++    +   + P   + + +E E
Sbjct: 219 LSATGTLFALGLNYADHASELAFTPPKEPLVFIKAPNTFTEHHQTSVRPNNVEYMHYEAE 278

Query: 127 IAFVIGKKAKRVLEKDAQDYIFGYCICNDISEREWQKEKGGQWVKGKSGDTFGPLGPYLV 186
           +  VIGK A++V E +A +Y+ GY +CND + R++ +      ++ KS D   P+GP++V
Sbjct: 279 LVVVIGKTARKVSEAEAMEYVAGYTVCNDYAIRDYLENYYRPNLRVKSRDGLTPIGPWIV 338

Query: 187 TKDEIQXXXXXXXXXXXXGHRHQTGNTNQMIFNFNFLVAHITSFITLMPGDIXXXXXXXX 246
            K+ +             G   Q G T  +IF+  FL+++++ F+TL PGD+        
Sbjct: 339 DKEAVSDPHNLTLRTFVNGELRQEGTTADLIFSIPFLISYLSEFMTLQPGDMIATGTPK- 397

Query: 247 XXLGMDPPVFLKEGDEMKLNIDSLGSQNSKVILEQ 281
              G+   V    GDE+ L I  +G   ++++ E+
Sbjct: 398 ---GLSDVV---PGDEVVLEIKGVGRLVNQIVCEE 426


>HPCE_ECOLX RecName: Full=Homoprotocatechuate catabolism
           bifunctional isomerase/decarboxylase;Includes:  RecName:
           Full=2-hydroxyhepta-2,4-diene-1,7-dioate isomerase;
          Length = 427

 Score =  118 bits (296), Expect = 5e-29
 Identities = 59/168 (35%), Positives = 94/168 (55%)

Query: 71  GNFFAIGLNYVEHAKETGAKTPDNPVLFNKSVHSIVGPNDNVIIPKTSKKLDHEVEIAFV 130
           G  FA+GLNY +HA E   K P+ P++F K+ +++ G N   + P   + + +E E+  V
Sbjct: 223 GTLFALGLNYADHASELEFKPPEEPLVFLKAPNTLTGDNQTSVRPNNIEYMHYEAELVVV 282

Query: 131 IGKKAKRVLEKDAQDYIFGYCICNDISEREWQKEKGGQWVKGKSGDTFGPLGPYLVTKDE 190
           IGK+A+ V E DA DY+ GY +CND + R++ +      ++ KS D   P+   +V K+ 
Sbjct: 283 IGKQARNVSEADAMDYVAGYTVCNDYAIRDYLENYYRPNLRVKSRDGLTPMLSTIVPKEA 342

Query: 191 IQXXXXXXXXXXXXGHRHQTGNTNQMIFNFNFLVAHITSFITLMPGDI 238
           I             G   Q G T  +IF+  FL+A+++ F+TL PGD+
Sbjct: 343 IPDPHNLTLRTFVNGELRQQGTTADLIFSVPFLIAYLSEFMTLNPGDM 390



 Score = 57.8 bits (138), Expect = 1e-10
 Identities = 47/175 (26%), Positives = 78/175 (44%), Gaps = 15/175 (8%)

Query: 71  GNFFAIGLNY-------VEHAKETGAKTPDNP-VLFNKSVHSIVGPNDNVIIPKTSKKLD 122
           G  FA+ LN+        E  +++  K P    V F K  ++++G  + +  P+    L 
Sbjct: 3   GTIFAVALNHRSQLDAWQEAFQQSPIKAPPKTAVWFIKPRNTVIGCGEPIPFPQGENLLS 62

Query: 123 HEVEIAFVIGKKAKRVLEKDAQDYIFGYCICNDISEREWQKEKGGQWVKGKSGDTFGPLG 182
               +A ++GK A +V E+DA +YI GY + ND+S  E    +    +K K  D F P+G
Sbjct: 63  GAT-VALIVGKTATKVREEDAAEYIAGYALANDVSLPEESFYRPA--IKAKCRDGFCPIG 119

Query: 183 PYLVTKDEIQXXXXXXXXXXXXGHRHQTGNTNQMIFNFNFLVAHITSFITLMPGD 237
             +     +             G      NT+ +  N   L++ ++ F TL PGD
Sbjct: 120 ETVA----LSNVDNLTIYTEINGRPADHWNTSDLQRNAAQLLSALSEFATLNPGD 170


>HPAG_ECOLX RecName: Full=4-hydroxyphenylacetate degradation
           bifunctional isomerase/decarboxylase;Includes:  RecName:
           Full=2-hydroxyhepta-2,4-diene-1,7-dioate isomerase;
          Length = 429

 Score =  118 bits (296), Expect = 5e-29
 Identities = 59/168 (35%), Positives = 94/168 (55%)

Query: 71  GNFFAIGLNYVEHAKETGAKTPDNPVLFNKSVHSIVGPNDNVIIPKTSKKLDHEVEIAFV 130
           G  FA+GLNY +HA E   K P+ P++F K+ +++ G N   + P   + + +E E+  V
Sbjct: 223 GTLFALGLNYADHASELEFKPPEEPLVFLKAPNTLTGDNQTSVRPNNIEYMHYEAELVVV 282

Query: 131 IGKKAKRVLEKDAQDYIFGYCICNDISEREWQKEKGGQWVKGKSGDTFGPLGPYLVTKDE 190
           IGK+A+ V E DA DY+ GY +CND + R++ +      ++ KS D   P+   +V K+ 
Sbjct: 283 IGKQARNVSEADAMDYVAGYTVCNDYAIRDYLENYYRPNLRVKSRDGLTPMLSTIVPKEA 342

Query: 191 IQXXXXXXXXXXXXGHRHQTGNTNQMIFNFNFLVAHITSFITLMPGDI 238
           I             G   Q G T  +IF+  FL+A+++ F+TL PGD+
Sbjct: 343 IPDPHNLTLRTFVNGELRQQGTTADLIFSVPFLIAYLSEFMTLNPGDM 390



 Score = 58.2 bits (139), Expect = 9e-11
 Identities = 48/175 (27%), Positives = 78/175 (44%), Gaps = 15/175 (8%)

Query: 71  GNFFAIGLNY-------VEHAKETGAKTPDNP-VLFNKSVHSIVGPNDNVIIPKTSKKLD 122
           G  FA+ LN+        E  +++  K P    V F K  ++++G  + +  P+  K L 
Sbjct: 3   GTIFAVALNHRSQLDAWQEAFQQSPYKAPPKTAVWFIKPRNTVIGCGEPIPFPQGEKVLS 62

Query: 123 HEVEIAFVIGKKAKRVLEKDAQDYIFGYCICNDISEREWQKEKGGQWVKGKSGDTFGPLG 182
               +A ++GK A +V E+DA +YI GY + ND+S  E    +    +K K  D F P+G
Sbjct: 63  GAT-VALIVGKTATKVREEDAAEYIAGYALANDVSLPEESFYRPA--IKAKCRDGFCPIG 119

Query: 183 PYLVTKDEIQXXXXXXXXXXXXGHRHQTGNTNQMIFNFNFLVAHITSFITLMPGD 237
             +     +             G      NT  +  N   L++ ++ F TL PGD
Sbjct: 120 ETVA----LSNVDNLTIYTEINGRPADHWNTADLQRNAAQLLSALSEFATLNPGD 170


>FAHD1_DICDI RecName: Full=Fumarylacetoacetate hydrolase
           domain-containing protein 1 homolog;         EC=3.-.-.-;
          Length = 218

 Score =  108 bits (270), Expect = 6e-26
 Identities = 64/168 (38%), Positives = 88/168 (52%), Gaps = 5/168 (2%)

Query: 75  AIGLNYVEHAKETGAKTPDNPVLFNKSVHSIVGPNDNVI-IPKTSKKLDHEVEIAFVIGK 133
           A+G NY +HAKE G + P  P  F K   S +      I IP  S  + HEVE+  VIGK
Sbjct: 13  AVGRNYAQHAKELGNEIPSEPFFFLKPTSSYLLQGTGPIEIPLESSDIHHEVELGIVIGK 72

Query: 134 KAKRVLEKDAQDYIFGYCICNDISEREWQ---KEKGGQWVKGKSGDTFGPLGPYLVTKDE 190
           K + +  K A DY+ GY +  D++ R+ Q   K K   W   K  DTF P+  + + KD+
Sbjct: 73  KGRDIDLKSAMDYVSGYTLALDMTSRDQQSIAKAKSLPWTVSKGYDTFCPISGF-IPKDK 131

Query: 191 IQXXXXXXXXXXXXGHRHQTGNTNQMIFNFNFLVAHITSFITLMPGDI 238
           I+            G   Q GNTNQMIF+   L+ +I+S +TL  GD+
Sbjct: 132 IKDLNNVELWCSVDGQIKQKGNTNQMIFDVPHLIQYISSIMTLESGDL 179


>FAHD1_BOVIN RecName: Full=Fumarylacetoacetate hydrolase
           domain-containing protein 1;         EC=3.-.-.-;
          Length = 221

 Score =  108 bits (270), Expect = 6e-26
 Identities = 65/209 (31%), Positives = 104/209 (49%), Gaps = 11/209 (5%)

Query: 72  NFFAIGLNYVEHAKETGAKTPDNPVLFNKSVHSIVGPNDNVIIPKTSKKLDHEVEIAFVI 131
           N   +G NY +H +E  +  P  PVLF K   +       V++P  ++ L HE+E+A V+
Sbjct: 16  NIVCVGRNYADHVREMQSAAPSEPVLFLKPSTAYAPEGSPVLVPAYTRNLHHELELAVVM 75

Query: 132 GKKAKRVLEKDAQDYIFGYCICNDISEREWQ---KEKGGQWVKGKSGDTFGPLGPYLVTK 188
           GK+ + V E  A DY+ GY +C D++ R+ Q   K+KG  W   KS     P+  + V K
Sbjct: 76  GKRCRAVSEAAAMDYVAGYALCLDMTARDVQDECKKKGLPWTLAKSFTASCPVSAF-VPK 134

Query: 189 DEIQXXXXXXXXXXXXGHRHQTGNTNQMIFNFNFLVAHITSFITLMPGDIXXXXXXXXXX 248
           ++I             G   Q G T+ MIF+  +++++++  +TL  GDI          
Sbjct: 135 EKIPDPHNLKLWLKVNGELRQEGETSSMIFSIPYIISYVSKIMTLEEGDIILTGTPK--- 191

Query: 249 LGMDPPVFLKEGDEMKLNIDSLGSQNSKV 277
            G+ P   +KE DE++  I  + S   KV
Sbjct: 192 -GVGP---VKENDEIQAGIHGVLSMKFKV 216


>FAHD1_MOUSE RecName: Full=Fumarylacetoacetate hydrolase
           domain-containing protein 1;         EC=3.-.-.-;
          Length = 227

 Score =  105 bits (263), Expect = 4e-25
 Identities = 64/209 (30%), Positives = 103/209 (49%), Gaps = 11/209 (5%)

Query: 72  NFFAIGLNYVEHAKETGAKTPDNPVLFNKSVHSIVGPNDNVIIPKTSKKLDHEVEIAFVI 131
           N   +G NY +H KE  +     PVLF K   +       V++P   + L HEVE+  ++
Sbjct: 22  NIVCVGRNYADHVKEMRSTVLSEPVLFLKPSTAYAPEGSPVLMPAYCRNLHHEVELGVLL 81

Query: 132 GKKAKRVLEKDAQDYIFGYCICNDISEREWQ---KEKGGQWVKGKSGDTFGPLGPYLVTK 188
           GK+ + + E  A DY+ GY +C D++ R+ Q   K+KG  W   KS  +  P+  + V K
Sbjct: 82  GKRGEAIPEAAAMDYVAGYALCLDMTARDVQEECKKKGLPWTLAKSFTSSCPVSAF-VPK 140

Query: 189 DEIQXXXXXXXXXXXXGHRHQTGNTNQMIFNFNFLVAHITSFITLMPGDIXXXXXXXXXX 248
           ++I             G   Q G T+ MIF+  +++++++  ITL  GD+          
Sbjct: 141 EKIPDPHALRLWLKVNGELRQEGKTSSMIFSIPYIISYVSKIITLEEGDLILTGTPK--- 197

Query: 249 LGMDPPVFLKEGDEMKLNIDSLGSQNSKV 277
            G+ P   +KE DE++  ID + S   KV
Sbjct: 198 -GVGP---VKENDEIEAGIDGVVSMRFKV 222


>FAHD1_HUMAN RecName: Full=Fumarylacetoacetate hydrolase
           domain-containing protein 1;         EC=3.-.-.-;AltName:
           Full=YISK-like;
          Length = 224

 Score =  103 bits (258), Expect = 1e-24
 Identities = 64/209 (30%), Positives = 102/209 (48%), Gaps = 11/209 (5%)

Query: 72  NFFAIGLNYVEHAKETGAKTPDNPVLFNKSVHSIVGPNDNVIIPKTSKKLDHEVEIAFVI 131
           N   +G NY +H +E  +     PVLF K   +       +++P  ++ L HE+E+  V+
Sbjct: 19  NIVCVGRNYADHVREMRSAVLSEPVLFLKPSTAYAPEGSPILMPAYTRNLHHELELGVVM 78

Query: 132 GKKAKRVLEKDAQDYIFGYCICNDISEREWQ---KEKGGQWVKGKSGDTFGPLGPYLVTK 188
           GK+ + V E  A DY+ GY +C D++ R+ Q   K+KG  W   KS     P+  + V K
Sbjct: 79  GKRCRAVPEAAAMDYVGGYALCLDMTARDVQDECKKKGLPWTLAKSFTASCPVSAF-VPK 137

Query: 189 DEIQXXXXXXXXXXXXGHRHQTGNTNQMIFNFNFLVAHITSFITLMPGDIXXXXXXXXXX 248
           ++I             G   Q G T+ MIF+  +++++++  ITL  GDI          
Sbjct: 138 EKIPDPHKLKLWLKVNGELRQEGETSSMIFSIPYIISYVSKIITLEEGDIILTGTPK--- 194

Query: 249 LGMDPPVFLKEGDEMKLNIDSLGSQNSKV 277
            G+ P   +KE DE++  I  L S   KV
Sbjct: 195 -GVGP---VKENDEIEAGIHGLVSMTFKV 219


>FAHD1_RAT RecName: Full=Fumarylacetoacetate hydrolase
           domain-containing protein 1;         EC=3.-.-.-;
          Length = 221

 Score =  102 bits (255), Expect = 3e-24
 Identities = 62/209 (29%), Positives = 100/209 (47%), Gaps = 11/209 (5%)

Query: 72  NFFAIGLNYVEHAKETGAKTPDNPVLFNKSVHSIVGPNDNVIIPKTSKKLDHEVEIAFVI 131
           N   +G NY +H KE  +     PVLF K   +       V++P   + L HEVE+  ++
Sbjct: 16  NIVCVGRNYADHVKEMRSTVLSEPVLFLKPSTAYAPEGSPVLMPAYCRNLHHEVELGVLL 75

Query: 132 GKKAKRVLEKDAQDYIFGYCICNDISEREWQ---KEKGGQWVKGKSGDTFGPLGPYLVTK 188
           G++ + V E  A DY+ GY +C D++ R+ Q   K+KG  W   KS  +  P+  + V K
Sbjct: 76  GRRGEAVPEAAAMDYVAGYALCLDMTARDVQDECKKKGLPWTLAKSFTSSCPVSAF-VPK 134

Query: 189 DEIQXXXXXXXXXXXXGHRHQTGNTNQMIFNFNFLVAHITSFITLMPGDIXXXXXXXXXX 248
           ++I             G   Q G T+ MIF+  +++++++  ITL  GD+          
Sbjct: 135 EKIPDPHALRLWLKVNGELRQEGKTSSMIFSIPYIISYVSKIITLEEGDLILTGTPKGVG 194

Query: 249 LGMDPPVFLKEGDEMKLNIDSLGSQNSKV 277
                   +KE DE++  ID + S   KV
Sbjct: 195 A-------VKENDEIEAGIDGVVSMRFKV 216


>FAHD1_PONAB RecName: Full=Fumarylacetoacetate hydrolase
           domain-containing protein 1;         EC=3.-.-.-;
          Length = 224

 Score =  102 bits (255), Expect = 3e-24
 Identities = 63/209 (30%), Positives = 102/209 (48%), Gaps = 11/209 (5%)

Query: 72  NFFAIGLNYVEHAKETGAKTPDNPVLFNKSVHSIVGPNDNVIIPKTSKKLDHEVEIAFVI 131
           N   +G NY +H +E  +     PVLF K   +       +++P  ++ L HE+E+  V+
Sbjct: 19  NIVCVGRNYADHVREMRSAVLSEPVLFLKPSTAYAPEGSPILMPAYTRNLHHELELGVVM 78

Query: 132 GKKAKRVLEKDAQDYIFGYCICNDISEREWQ---KEKGGQWVKGKSGDTFGPLGPYLVTK 188
           G++ + V E  A DY+ GY +C D++ R+ Q   K+KG  W   KS     P+  + V K
Sbjct: 79  GRRCRAVPEAAAMDYVGGYALCLDMTARDVQDECKKKGLPWTLAKSFTASCPVSAF-VPK 137

Query: 189 DEIQXXXXXXXXXXXXGHRHQTGNTNQMIFNFNFLVAHITSFITLMPGDIXXXXXXXXXX 248
           ++I             G   Q G T+ MIF+  +++++++  ITL  GDI          
Sbjct: 138 EKIPDPHKLKLWLKVNGELRQEGETSSMIFSIPYIISYVSKIITLEEGDIILTGTPK--- 194

Query: 249 LGMDPPVFLKEGDEMKLNIDSLGSQNSKV 277
            G+ P   +KE DE++  I  L S   KV
Sbjct: 195 -GVGP---VKENDEIEAGIHGLVSMRFKV 219


>YO23_CAEEL RecName: Full=Uncharacterized protein ZK688.3;
          Length = 214

 Score =  101 bits (251), Expect = 9e-24
 Identities = 59/166 (35%), Positives = 85/166 (51%), Gaps = 4/166 (2%)

Query: 76  IGLNYVEHAKETGAKTPDNPVLFNKSVHSIVGPNDNVIIPKTSKKLDHEVEIAFVIGKKA 135
           +G NY +HA E G   P  P+LF K+V+S +   + ++ P   + L  EVE+  VI KKA
Sbjct: 17  VGRNYKDHALELGNAIPKKPMLFVKTVNSFIVEGEPIVAPPGCQNLHQEVELGVVISKKA 76

Query: 136 KRVLEKDAQDYIFGYCICNDISEREWQ---KEKGGQWVKGKSGDTFGPLGPYLVTKDEIQ 192
            R+ + DA DYI GY +  D++ R++Q   K+ G  W   KS D   P+G +L   D I 
Sbjct: 77  SRISKSDAMDYIGGYTVALDMTARDFQDEAKKAGAPWFLAKSFDGSCPIGGFLPVSD-IP 135

Query: 193 XXXXXXXXXXXXGHRHQTGNTNQMIFNFNFLVAHITSFITLMPGDI 238
                       G   Q   T+ MIF+   L+ + T F TL  GD+
Sbjct: 136 NPHDVELFCKINGKDQQRCRTDVMIFDIPTLLEYTTQFFTLEVGDV 181


>YCGM_ECOLI RecName: Full=Uncharacterized protein ycgM;
          Length = 219

 Score = 88.2 bits (217), Expect = 8e-20
 Identities = 57/196 (29%), Positives = 90/196 (45%), Gaps = 10/196 (5%)

Query: 76  IGLNYVEHAKETGAKTPDNPVLFNKSVHSIVGPNDNVIIPKTSKKLDHEVEIAFVIGKKA 135
           +G NY +H KE G+  P+ PVLF K   ++      + IP     + HEVE+A +IG   
Sbjct: 22  VGSNYAKHIKEMGSAVPEEPVLFIKPETALCDLRQPLAIPSDFGSVHHEVELAVLIGATL 81

Query: 136 KRVLEKDAQDYIFGYCICNDISEREWQ---KEKGGQWVKGKSGDTFGPLGPYLVTKDEIQ 192
           ++  E+  +  I GY +  D++ R+ Q   K+ G  W K K+ D   PL  ++   +   
Sbjct: 82  RQATEEHVRKAIAGYGVALDLTLRDVQGKMKKAGQPWEKAKAFDNSCPLSGFIPAAEFTG 141

Query: 193 XXXXXXXXXXXXGHRHQTGNTNQMIFNFNFLVAHITSFITLMPGDIXXXXXXXXXXLGMD 252
                       G + Q G T  MI     L+A+++ F TL  GD+           G+ 
Sbjct: 142 DPQNTTLSLSVNGEQRQQGTTADMIHKIVPLIAYMSKFFTLKAGDVVLTGTPD----GVG 197

Query: 253 PPVFLKEGDEMKLNID 268
           P   L+ GDE+ +  D
Sbjct: 198 P---LQSGDELTVTFD 210


>FMP41_YEAST RecName: Full=Uncharacterized mitochondrial hydrolase
           FMP41;         EC=3.-.-.-;
          Length = 259

 Score = 70.9 bits (172), Expect = 1e-14
 Identities = 54/198 (27%), Positives = 82/198 (41%), Gaps = 36/198 (18%)

Query: 76  IGLNYVEHAKETGAKTPDNPVLFNKSVHSIVGPNDNVIIPKT------------------ 117
           IG NY  H KE    TP  P  F K   SIV P  + ++  T                  
Sbjct: 15  IGRNYAAHIKELNNSTPKQPFFFLKPTSSIVTPLSSSLVKTTRPANSTFNGLNEDGTNPG 74

Query: 118 ------SKKLDHEVEIAFVIGKKAKRVLE---KDAQDYIFGYCICNDISEREWQ---KEK 165
                   K+ HE+E+A ++ K    V +   ++  D I G  +  D++ R  Q   K+K
Sbjct: 75  PIFIPRGVKVHHEIELALIVSKHLSNVTKMKPEEVYDSISGVALALDLTARNVQDEAKKK 134

Query: 166 GGQWVKGKSGDTFGPLGPYLVTKDEI-----QXXXXXXXXXXXXGHRHQTGNTNQMIFNF 220
           G  W   K  DTF P+   +V++++                   G   Q G TN M+   
Sbjct: 135 GLPWTISKGFDTFMPISA-IVSREKFSSYKSNLQDIFRVKCSVNGQLRQDGGTNLMLHPL 193

Query: 221 NFLVAHITSFITLMPGDI 238
           + ++ HI++ I+L PGDI
Sbjct: 194 HKILQHISTMISLEPGDI 211


>YOS9_SCHPO RecName: Full=Uncharacterized hydrolase C21C3.09c;      
             EC=3.-.-.-;
          Length = 221

 Score = 52.8 bits (125), Expect = 4e-09
 Identities = 46/178 (25%), Positives = 75/178 (42%), Gaps = 7/178 (3%)

Query: 67  ISKPGNFFAIGLNYVEHAKETGAKTPDNPVLFNKSVHSIVGPNDNVIIPKTSKKLDHEVE 126
           +S+ G    IG NY  H +E                 +IV P    +I        +EVE
Sbjct: 2   LSRAGKVVCIGRNYAAHIREXXXXXXXXXXXXXXXXSAIVEPGHGNLIIPPDVSAHYEVE 61

Query: 127 IAFVIGKK--AKRVLEKDAQ-DYIFGYCICNDISEREWQ---KEKGGQWVKGKSGDTFGP 180
           +  ++  +  A+R +  ++  D I  Y +  D++ R  Q   K+KG  W   K  DTF P
Sbjct: 62  LGLIMKDRLPARRPVSSNSWLDSIGAYFVGIDMTARNIQNEAKKKGLPWSFAKGYDTFLP 121

Query: 181 LGPYLVTKDEIQXXXXXXXXXXXXGHRHQTGNTNQMIFNFNFLVAHITSFITLMPGDI 238
           +GP ++ K  I             G   Q  +T+ M+     + + IT  ++L PGD+
Sbjct: 122 VGP-IIPKHLIPDPHNVILELSLNGKVVQKDSTSLMLNKIPKIFSSITEAMSLNPGDL 178


>FAAA_RAT RecName: Full=Fumarylacetoacetase;         Short=FAA;     
              EC=3.7.1.2;AltName: Full=Fumarylacetoacetate
           hydrolase;AltName: Full=Beta-diketonase;
          Length = 419

 Score = 39.3 bits (90), Expect = 4e-05
 Identities = 26/71 (36%), Positives = 39/71 (54%), Gaps = 15/71 (21%)

Query: 118 SKKLDHEVEIAFVIG---KKAKRVLEKDAQDYIFGYCICNDISEREWQKEKGGQWVKGKS 174
           SK+LD E+E+AF +G   +  + +    AQ++IFG  + ND S R+ Q     QW     
Sbjct: 193 SKRLDMELEMAFFVGPGNRFGEPIPISKAQEHIFGMVLMNDWSARDIQ-----QW----- 242

Query: 175 GDTFGPLGPYL 185
              + PLGP+L
Sbjct: 243 --EYVPLGPFL 251


>FAAA_DICDI RecName: Full=Fumarylacetoacetase;         Short=FAA;   
                EC=3.7.1.2;AltName: Full=Fumarylacetoacetate
           hydrolase;AltName: Full=Beta-diketonase;
          Length = 427

 Score = 36.6 bits (83), Expect = 3e-04
 Identities = 24/79 (30%), Positives = 44/79 (55%), Gaps = 10/79 (12%)

Query: 121 LDHEVEIAFVIGKKAKRVLE----KDAQDYIFGYCICNDISERE---WQKEKGGQWVKGK 173
           LD E+E+  +IG ++ ++ E    + A+D+IFG  + ND S R+   W+    G ++   
Sbjct: 201 LDFELEMGALIGGESTKLGEPISIESAKDHIFGLVLLNDWSARDIQKWEYVPLGPFLAKN 260

Query: 174 SGDTFGPLGPYLVTKDEIQ 192
            G T   + P++VT + +Q
Sbjct: 261 FGST---ISPWVVTMEALQ 276


>FAAA_BOVIN RecName: Full=Fumarylacetoacetase;         Short=FAA;   
                EC=3.7.1.2;AltName: Full=Fumarylacetoacetate
           hydrolase;AltName: Full=Beta-diketonase;
          Length = 419

 Score = 36.2 bits (82), Expect = 4e-04
 Identities = 25/70 (35%), Positives = 36/70 (51%), Gaps = 15/70 (21%)

Query: 119 KKLDHEVEIAFVIG---KKAKRVLEKDAQDYIFGYCICNDISEREWQKEKGGQWVKGKSG 175
           K LD E+E+AF +G   K  + +    A ++IFG  + ND S R+ QK     W      
Sbjct: 194 KLLDFELEMAFFVGPGNKLGEPIPISKAHEHIFGMVLMNDWSARDIQK-----W------ 242

Query: 176 DTFGPLGPYL 185
             + PLGP+L
Sbjct: 243 -EYVPLGPFL 251


  Database: sws57.9x
    Posted date:  Nov 5, 2009 10:46 AM
  Number of letters in database: 179,409,320
  Number of sequences in database:  510,076
  
Lambda     K      H
   0.317    0.138    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 510076
Number of Hits to DB: 9,047,535,333
Number of extensions: 366817421
Number of successful extensions: 985885
Number of sequences better than 1.0e-03: 26528
Number of HSP's gapped: 951371
Number of HSP's successfully gapped: 30737
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.2 bits)