BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= AAZ21850.1 pubi0 ribA GIB00256CH01 "GTP cyclohydrolase II
/3,4-dihydroxy-2-butanone .."
         (366 letters)

Database: sws57.9x 
           510,076 sequences; 179,409,320 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

RIBBA_AQUAE RecName: Full=Riboflavin biosynthesis protein ribBA;...   234   1e-63
RIBB_PHOLE RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   231   6e-63
RIBBA_BACSK RecName: Full=Riboflavin biosynthesis protein ribBA;...   226   2e-61
RIBBA_BACSU RecName: Full=Riboflavin biosynthesis protein ribBA;...   223   2e-60
RIBBA_SYNWW RecName: Full=Riboflavin biosynthesis protein ribBA;...   219   2e-59
RIBBA_UNCTG RecName: Full=Riboflavin biosynthesis protein ribBA;...   218   7e-59
RIBB_PHOPO RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   217   1e-58
RIBBA_BACCR RecName: Full=Riboflavin biosynthesis protein ribBA;...   217   1e-58
RIBB_PSESM RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   216   2e-58
RIBBA_BACC4 RecName: Full=Riboflavin biosynthesis protein ribBA;...   216   2e-58
RIBBA_BACWK RecName: Full=Riboflavin biosynthesis protein ribBA;...   216   3e-58
RIBBA_BACC2 RecName: Full=Riboflavin biosynthesis protein ribBA;...   214   7e-58
RIBBA_THEPX RecName: Full=Riboflavin biosynthesis protein ribBA;...   214   1e-57
RIBBA_BACA2 RecName: Full=Riboflavin biosynthesis protein ribBA;...   214   1e-57
RIBBA_BACHK RecName: Full=Riboflavin biosynthesis protein ribBA;...   214   1e-57
RIBBA_BACC3 RecName: Full=Riboflavin biosynthesis protein ribBA;...   214   1e-57
RIBBA_BACAN RecName: Full=Riboflavin biosynthesis protein ribBA;...   214   1e-57
RIBBA_BACAH RecName: Full=Riboflavin biosynthesis protein ribBA;...   214   1e-57
RIBBA_BACAC RecName: Full=Riboflavin biosynthesis protein ribBA;...   214   1e-57
RIBBA_BACAA RecName: Full=Riboflavin biosynthesis protein ribBA;...   214   1e-57
RIBBA_THEP3 RecName: Full=Riboflavin biosynthesis protein ribBA;...   213   3e-57
RIBBA_BACC0 RecName: Full=Riboflavin biosynthesis protein ribBA;...   213   3e-57
RIBBA_BACAM RecName: Full=Riboflavin biosynthesis protein ribBA;...   213   3e-57
RIBBA_BACCQ RecName: Full=Riboflavin biosynthesis protein ribBA;...   212   4e-57
RIBBA_BACC7 RecName: Full=Riboflavin biosynthesis protein ribBA;...   212   4e-57
RIBB_NEIMB RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   212   5e-57
RIBBA_PROVI RecName: Full=Riboflavin biosynthesis protein ribBA;...   212   5e-57
RIBBA_BACCZ RecName: Full=Riboflavin biosynthesis protein ribBA;...   212   5e-57
RIBBA_BACC1 RecName: Full=Riboflavin biosynthesis protein ribBA;...   211   6e-57
RIBB_NEIMA RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   211   8e-57
RIBBA_BREBN RecName: Full=Riboflavin biosynthesis protein ribBA;...   209   4e-56
RIBBA_GEOSW RecName: Full=Riboflavin biosynthesis protein ribBA;...   204   1e-54
RIBBA_SYNY3 RecName: Full=Riboflavin biosynthesis protein ribBA;...   203   2e-54
RIBB_DEHMU RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   202   3e-54
RIBBA_CHLPN RecName: Full=Riboflavin biosynthesis protein ribBA;...   202   5e-54
RIBBA_PELLD RecName: Full=Riboflavin biosynthesis protein ribBA;...   200   2e-53
RIBBA_CHLMU RecName: Full=Riboflavin biosynthesis protein ribBA;...   199   2e-53
RIBBA_CLONN RecName: Full=Riboflavin biosynthesis protein ribBA;...   199   3e-53
RIBB_WOLSU RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   197   9e-53
RIBBA_CYTH3 RecName: Full=Riboflavin biosynthesis protein ribBA;...   195   6e-52
RIBBA_CHLTR RecName: Full=Riboflavin biosynthesis protein ribBA;...   195   6e-52
RIBBA_BACCN RecName: Full=Riboflavin biosynthesis protein ribBA;...   195   6e-52
RIBB_HELPY RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   194   1e-51
RIBBA_SALTO RecName: Full=Riboflavin biosynthesis protein ribBA;...   192   3e-51
RIBB_HELPJ RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   192   4e-51
RIBBA_STAES RecName: Full=Riboflavin biosynthesis protein ribBA;...   192   4e-51
RIBBA_STAEQ RecName: Full=Riboflavin biosynthesis protein ribBA;...   191   7e-51
RIBBA_BACFR RecName: Full=Riboflavin biosynthesis protein ribBA;...   191   7e-51
RIBBA_BACFN RecName: Full=Riboflavin biosynthesis protein ribBA;...   191   7e-51
RIBBA_ACTPJ RecName: Full=Riboflavin biosynthesis protein ribBA;...   191   7e-51
RIBBA_ACTP7 RecName: Full=Riboflavin biosynthesis protein ribBA;...   191   7e-51
RIBB_CAMJE RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   191   9e-51
RIBB_PSEAE RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   191   1e-50
RIBB_HELHP RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   190   1e-50
RIBBA_ACTPL RecName: Full=Riboflavin biosynthesis protein ribBA;...   190   2e-50
RIBBA_ACTP2 RecName: Full=Riboflavin biosynthesis protein ribBA;...   190   2e-50
RIBBA_SALAI RecName: Full=Riboflavin biosynthesis protein ribBA;...   189   3e-50
RIBBA_PELPB RecName: Full=Riboflavin biosynthesis protein ribBA;...   189   3e-50
RIBBA_MYCUA RecName: Full=Riboflavin biosynthesis protein ribBA;...   188   6e-50
RIBBA_PROA2 RecName: Full=Riboflavin biosynthesis protein ribBA;...   187   1e-49
RIBBA_STAHJ RecName: Full=Riboflavin biosynthesis protein ribBA;...   186   3e-49
RIBBA_MYCMM RecName: Full=Riboflavin biosynthesis protein ribBA;...   186   3e-49
RIBBA_BACV8 RecName: Full=Riboflavin biosynthesis protein ribBA;...   186   4e-49
RIBBA_MYCTU RecName: Full=Riboflavin biosynthesis protein ribBA;...   185   5e-49
RIBBA_MYCTA RecName: Full=Riboflavin biosynthesis protein ribBA;...   185   5e-49
RIBBA_MYCBT RecName: Full=Riboflavin biosynthesis protein ribBA;...   185   5e-49
RIBBA_MYCBP RecName: Full=Riboflavin biosynthesis protein ribBA;...   185   5e-49
RIBBA_MYCBO RecName: Full=Riboflavin biosynthesis protein ribBA;...   185   5e-49
RIBBA_MYCVP RecName: Full=Riboflavin biosynthesis protein ribBA;...   184   8e-49
RIBBA_MYCPA RecName: Full=Riboflavin biosynthesis protein ribBA;...   184   8e-49
RIBBA_MYCA1 RecName: Full=Riboflavin biosynthesis protein ribBA;...   184   8e-49
RIBBA_MYCGI RecName: Full=Riboflavin biosynthesis protein ribBA;...   182   4e-48
RIBBA_STAAN RecName: Full=Riboflavin biosynthesis protein ribBA;...   182   5e-48
RIBBA_STAAM RecName: Full=Riboflavin biosynthesis protein ribBA;...   182   5e-48
RIBBA_PORGI RecName: Full=Riboflavin biosynthesis protein ribBA;...   182   5e-48
RIBBA_PORG3 RecName: Full=Riboflavin biosynthesis protein ribBA;...   182   5e-48
RIBBA_BACTN RecName: Full=Riboflavin biosynthesis protein ribBA;...   182   5e-48
RIBBA_STAS1 RecName: Full=Riboflavin biosynthesis protein ribBA;...   181   9e-48
RIBBA_STAAW RecName: Full=Riboflavin biosynthesis protein ribBA;...   181   9e-48
RIBBA_STAAS RecName: Full=Riboflavin biosynthesis protein ribBA;...   181   9e-48
RIBBA_STAAR RecName: Full=Riboflavin biosynthesis protein ribBA;...   181   9e-48
RIBBA_STAAC RecName: Full=Riboflavin biosynthesis protein ribBA;...   181   1e-47
RIBBA_ARATH RecName: Full=Riboflavin biosynthesis protein ribBA,...   180   2e-47
RIBB_TOLAT RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   170   2e-44
RIBB_VIBFI RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   170   2e-44
RIBB_HAEIE RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   170   2e-44
RIBB_VIBHA RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   169   3e-44
RIBBA_MYCA9 RecName: Full=Riboflavin biosynthesis protein ribBA;...   169   4e-44
RIBB_HAEIG RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   169   5e-44
RIBB_PASMU RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   168   6e-44
RIBB_HAEIN RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   168   8e-44
RIBB_HAEI8 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   167   1e-43
RIBB_WIGBR RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   167   1e-43
RIBB_CLOBL RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   167   1e-43
RIBBA_RHOE4 RecName: Full=Riboflavin biosynthesis protein ribBA;...   167   1e-43
RIBBA_NOCFA RecName: Full=Riboflavin biosynthesis protein ribBA;...   167   1e-43
RIBB_VIBPA RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   166   3e-43
RIBB_PSEHT RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   166   3e-43
RIBB_CLOBH RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   166   3e-43
RIBB_CLOB1 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   166   3e-43
RIBB_BLOFL RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   166   4e-43
RIBB_SODGM RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   165   5e-43
RIBB_SHISS RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   165   7e-43
RIBB_SHIFL RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   165   7e-43
RIBB_SHIF8 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   165   7e-43
RIBB_SHIDS RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   165   7e-43
RIBB_SHIBS RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   165   7e-43
RIBB_SHIB3 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   165   7e-43
RIBB_ECOUT RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   165   7e-43
RIBB_ECOSM RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   165   7e-43
RIBB_ECOSE RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   165   7e-43
RIBB_ECOLU RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   165   7e-43
RIBB_ECOLI RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   165   7e-43
RIBB_ECOLC RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   165   7e-43
RIBB_ECOL6 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   165   7e-43
RIBB_ECOL5 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   165   7e-43
RIBB_ECOK1 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   165   7e-43
RIBB_ECOHS RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   165   7e-43
RIBB_ECODH RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   165   7e-43
RIBB_ECOBW RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   165   7e-43
RIBB_ECO8A RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   165   7e-43
RIBB_ECO81 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   165   7e-43
RIBB_ECO7I RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   165   7e-43
RIBB_ECO5E RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   165   7e-43
RIBB_ECO57 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   165   7e-43
RIBB_ECO55 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   165   7e-43
RIBB_ECO45 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   165   7e-43
RIBB_ECO27 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   165   7e-43
RIBB_ECO24 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   165   7e-43
RIBB_ESCF3 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   164   9e-43
RIBB_VIBVY RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   164   1e-42
RIBB_VIBVU RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   164   1e-42
RIBB_VIBSL RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   164   1e-42
RIBB_DESPS RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   164   1e-42
RIBB_CITK8 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   163   2e-42
RIBB_BAUCH RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   163   2e-42
RIBB_PECCP RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   163   3e-42
RIBB_KLEP7 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   162   3e-42
RIBB_KLEP3 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   162   3e-42
RIBBA_PARD8 RecName: Full=Riboflavin biosynthesis protein ribBA;...   162   3e-42
RIBB_ERWCT RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   162   4e-42
RIBB_SHEFN RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   162   6e-42
RIBB_RALEJ RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   162   6e-42
RIBB_HAES1 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   162   6e-42
RIBB_MANSM RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   160   1e-41
RIBB_EDWI9 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   160   1e-41
RIBB_DESAA RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   160   2e-41
RIBB_AGRT5 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   160   2e-41
RIBB_SALTY RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   160   2e-41
RIBB_SALTI RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   160   2e-41
RIBB_SALSV RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   160   2e-41
RIBB_SALPC RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   160   2e-41
RIBB_SALPB RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   160   2e-41
RIBB_SALNS RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   160   2e-41
RIBB_SALHS RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   160   2e-41
RIBB_SALG2 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   160   2e-41
RIBB_SALEP RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   160   2e-41
RIBB_SALDC RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   160   2e-41
RIBB_SALCH RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   160   2e-41
RIBB_SALA4 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   160   2e-41
RIBB_HAES2 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   159   3e-41
RIBBA_RHOSR RecName: Full=Riboflavin biosynthesis protein ribBA;...   159   3e-41
RIBB_SALPK RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   159   4e-41
RIBB_SALPA RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   159   4e-41
RIBB_PROMH RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   159   4e-41
RIBB_BUCAT RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   159   4e-41
RIBB_BUCAI RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   159   4e-41
RIBB_BUCA5 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   159   4e-41
RIBB_SHESH RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   159   5e-41
RIBB_HAMD5 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   158   6e-41
RIBB_SALAR RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   158   8e-41
RIBB_PELCD RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   157   1e-40
RIBB_ENT38 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   157   1e-40
RIBB_DESAD RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   157   1e-40
RIBB_SERP5 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   157   2e-40
RIBB_YERE8 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   156   2e-40
RIBB_SHEWM RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   156   3e-40
RIBB_DESDG RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   156   3e-40
RIBB_DESRM RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   155   4e-40
RIBB_SHESW RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   155   5e-40
RIBB_SHEPC RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   155   5e-40
RIBBA_CORAM RecName: Full=Riboflavin biosynthesis protein ribBA;...   155   5e-40
RIBB_PELPD RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   154   9e-40
RIBB_SHELP RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   154   1e-39
RIBB_PHOLL RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   154   1e-39
RIBB_ENTS8 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   154   1e-39
RIBB_SHEPW RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   154   2e-39
RIBB_SHEPA RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   154   2e-39
RIBB_SHESA RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   153   2e-39
RIBB_SHEON RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   153   2e-39
RIBB_METLZ RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   153   2e-39
RIBB_DESAH RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   153   2e-39
RIBB_YERPY RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   153   3e-39
RIBB_YERPS RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   153   3e-39
RIBB_YERPP RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   153   3e-39
RIBB_YERPN RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   153   3e-39
RIBB_YERPG RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   153   3e-39
RIBB_YERPE RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   153   3e-39
RIBB_YERPB RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   153   3e-39
RIBB_YERPA RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   153   3e-39
RIBB_YERP3 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   153   3e-39
RIBB_SHESR RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   153   3e-39
RIBB_SHESM RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   153   3e-39
RIBB_SHEHH RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   153   3e-39
RIBB_ERWT9 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   153   3e-39
RIBB_SHEB9 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   152   3e-39
RIBB_SHEB2 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   152   3e-39
RIBB_SHEB8 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   152   4e-39
RIBB_SHEB5 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   152   4e-39
RIBB_RHORT RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   152   4e-39
RIBB_PHOPR RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   152   4e-39
RIBB_BUCAP RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   150   2e-38
RIBB_BORPE RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   150   2e-38
RIBB_BORPA RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   150   2e-38
RIBB_BORBR RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   150   2e-38
RIBB_DESVV RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   149   3e-38
RIBB_DESVH RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   149   3e-38
RIBB_RALSO RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   149   4e-38
RIBB_VIBC3 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   147   1e-37
RIBB_VIBCM RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   147   2e-37
RIBB_VIBCH RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   147   2e-37
RIBB_OCEIH RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   147   2e-37
RIBBA_CORGL RecName: Full=Riboflavin biosynthesis protein ribBA;...   146   2e-37
RIBBA_CORGB RecName: Full=Riboflavin biosynthesis protein ribBA;...   146   2e-37
RIBB_AERHH RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   144   1e-36
RIBB_CHLT3 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   143   2e-36
RIBB_BUCBP RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   142   5e-36
RIBB_AERS4 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   142   6e-36
RIBB_CHLL2 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   141   1e-35
RIBB_PSEPK RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   139   3e-35
RIB3_SCHPO RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   133   2e-33
RIBB_CHRVO RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   131   8e-33
RIBB_DESDA RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   130   2e-32
RIB3_YEAST RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   128   9e-32
RIB3_CANAL RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   121   8e-30
RIB3_MAGGR RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...   112   4e-27
RIBBA_THEMA RecName: Full=Riboflavin biosynthesis protein ribBA;...    97   2e-22
RIBB_METJA RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...    84   2e-18
RIBA_ARCFU RecName: Full=GTP cyclohydrolase-2;         EC=3.5.4....    82   1e-17
RIBB_METTH RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...    75   7e-16
RIBB_METAC RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...    67   3e-13
RIBB_METMA RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...    64   2e-12
RIBB_ARCFU RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate sy...    51   1e-08
RSE1_CANAL RecName: Full=Pre-mRNA-splicing factor RSE1;                43   5e-06
RIBA_PHOPO RecName: Full=GTP cyclohydrolase-2;         EC=3.5.4....    38   1e-04
RIBA_HELAH RecName: Full=GTP cyclohydrolase-2;         EC=3.5.4....    36   5e-04
ISPH_CLOPE RecName: Full=4-hydroxy-3-methylbut-2-enyl diphosphat...    36   6e-04

>RIBBA_AQUAE RecName: Full=Riboflavin biosynthesis protein
           ribBA;Includes:  RecName: Full=3,4-dihydroxy-2-butanone
           4-phosphate synthase;
          Length = 406

 Score =  234 bits (596), Expect = 1e-63
 Identities = 146/374 (39%), Positives = 214/374 (57%), Gaps = 18/374 (4%)

Query: 6   YASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDS 65
           + ++E  I   ++G M I+VDD  RENEGDL+++    + + INFMAKYGRGLICL+L  
Sbjct: 9   FNTVEEAIEDIRQGKMVIVVDDPDRENEGDLVMAAEKVTPEAINFMAKYGRGLICLSLTP 68

Query: 66  VQAKRLNLSLMSPINQSRNKTAFTISIEA--KKGITTGISAKDRXXXXXXXXXXXXXXXD 123
            + ++L+L  M+P+N     T F +SI+A  K G TTGISA DR               D
Sbjct: 69  ERCEQLDLHPMTPMNTDPKGTYFCVSIDAHPKHGTTTGISAYDRALTIKLAISPDAKPSD 128

Query: 124 IVSPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFD 183
            V PGHVFP+ A+ GGVL RAGHTEASVD+++LA    + VICEIM +DGTMA+  DL +
Sbjct: 129 FVRPGHVFPLKARPGGVLERAGHTEASVDLARLAGLYPAGVICEIMKDDGTMARVPDLME 188

Query: 184 FANKHNLKIGKIEDLIAYRXXXXXXXXXXXQSDIKVKNQKYKIRIYENLLDGSEHFALIK 243
           FA KHNLKI  I DLI YR            + +      +KI  Y + L G E  AL  
Sbjct: 189 FAKKHNLKIITIADLIKYRLRRETLVEKVASAHLPTPWGVFKIHAYRHKLTGEEQVALTM 248

Query: 244 GNIKKGIIPRVRV----ISSNVVQNYLINQQLPNSFDKTLNYFKKFNNCVLVFIKDTNLK 299
           G  K+     VRV    ++ +V +++  + +     +K L    K    VLV+I     +
Sbjct: 249 GEWKEDEPVLVRVHSECLTGDVFRSFRCDCR--PQLEKALEMIAKEGKGVLVYILGHEGR 306

Query: 300 --SVTQTLKDY--KNKNF-YKKGNDKL-----IRNYGIGAQIIKDLKIKNMILITKSLKK 349
              +   +K Y  + K +   + N+KL     +R+YGIGAQI++DL ++ M L+T + +K
Sbjct: 307 GIGIANKIKAYELQEKGYDTVEANEKLGYPPDLRDYGIGAQILRDLGVRKMKLMTNNPRK 366

Query: 350 VIGLEGYDIKITKQ 363
           ++ LEG+ +++ ++
Sbjct: 367 IVALEGFGLEVVER 380


>RIBB_PHOLE RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 364

 Score =  231 bits (590), Expect = 6e-63
 Identities = 136/357 (38%), Positives = 201/357 (56%), Gaps = 1/357 (0%)

Query: 7   ASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSV 66
           +S + II+  ++G M IL+DDE RENEGDLII++   + + INFMA +GRGLICL L   
Sbjct: 4   SSAKEIIDDIRQGRMVILMDDESRENEGDLIIASEMVTPEAINFMATHGRGLICLTLSKA 63

Query: 67  QAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVS 126
           + K LNL LM   N     T FTISIEA K +TTGISA DR               DIV 
Sbjct: 64  RCKTLNLPLMVQGNNDNFSTPFTISIEAAKYVTTGISASDRAKTVLAAVAPNAKSTDIVM 123

Query: 127 PGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFAN 186
           PGH+FP++A+DGGVL+RAGHTEA  D+++LA    S+VI EI+NEDG+MA+   L  FA 
Sbjct: 124 PGHIFPLMAQDGGVLIRAGHTEAGCDVARLAGLEPSSVIVEILNEDGSMARRPQLEIFAE 183

Query: 187 KHNLKIGKIEDLIAYRXXXXXXXXXXXQSDIKVKNQKYKIRIYENLLDGSEHFALIKGNI 246
           KH LK+G I DLI YR           + ++  +   + +  Y + +D   HFAL KG I
Sbjct: 184 KHGLKLGTIADLIEYRTQQESHIERISEYELNTEYGIFTLVTYRDTIDNQAHFALCKGEI 243

Query: 247 KKGIIPRVRVISSNVVQNYLINQQLPNSFDKTLNYFKKFNNCVLVFIKDTNLKSVTQTLK 306
           +      VRV   + +++ L       S +  +   +  +  +++  +  + K++ + L 
Sbjct: 244 QAKAATLVRVHVKDTLKDILQVGLSQWSLEAAMQRIQTEDGVLVIISQQESPKTLFEKLD 303

Query: 307 DY-KNKNFYKKGNDKLIRNYGIGAQIIKDLKIKNMILITKSLKKVIGLEGYDIKITK 362
            Y K +           RN G+G+QI+ DL +K + L++ S +    L G+ +++ +
Sbjct: 304 MYAKEQPNSPHSGIVQSRNIGLGSQILADLGVKKIRLLSNSNQGYRALSGFGLEVVE 360


>RIBBA_BACSK RecName: Full=Riboflavin biosynthesis protein
           ribBA;Includes:  RecName: Full=3,4-dihydroxy-2-butanone
           4-phosphate synthase;
          Length = 397

 Score =  226 bits (577), Expect = 2e-61
 Identities = 141/369 (38%), Positives = 205/369 (55%), Gaps = 12/369 (3%)

Query: 6   YASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDS 65
           + SI+  I   K GGM ++VDDE RENEGD +     +S + INFMA +GRGLIC+ L  
Sbjct: 2   FESIDEAITQLKAGGMILVVDDEDRENEGDFLALAETASPETINFMATHGRGLICVPLTE 61

Query: 66  VQAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIV 125
            QA+RL L  M   +   + TAFT+S++     TTGISA +R               D  
Sbjct: 62  EQAERLQLGQMVSHSTDPHGTAFTVSVDHSH-TTTGISAFERAETVRALADANAQPSDFK 120

Query: 126 SPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFA 185
            PGHVFP++AK+GGVL RAGHTEA+VD +KL     + VICE+MNEDG+MA+  +L   A
Sbjct: 121 RPGHVFPLVAKNGGVLRRAGHTEAAVDFAKLCGAKPAGVICEVMNEDGSMARVPELRIIA 180

Query: 186 NKHNLKIGKIEDLIAYRXXXXXXXXXXXQSDIKVKNQKYKIRIYENLLDGSEHFALIKGN 245
           ++HNL +  I+DLIAYR              +  +   +K   Y N +DG E  AL+KG+
Sbjct: 181 DQHNLPLVTIKDLIAYRRKTEKVVTREVAISLPTEYGDFKAVGYTNTIDGKESVALVKGD 240

Query: 246 IKKGIIPRVRVISSNVVQNYLINQQLP--NSFDKTLNYFKKFNNCVLVFIKDTNLK-SVT 302
           +  G    VRV S  +  +   +++          L   +     VL+++K       + 
Sbjct: 241 VGNGEPVLVRVHSECLTGDVFGSKRCDCGPQLHAALKQIEAEGRGVLLYMKQEGRGIGLI 300

Query: 303 QTLKDYK-NKNFYK--KGNDKL-----IRNYGIGAQIIKDLKIKNMILITKSLKKVIGLE 354
              + YK  +  Y   + N++L     +R YGIGAQI++DL I++M L+T + +K+ GLE
Sbjct: 301 NKFRAYKLQEEGYDTVEANERLGFPADLREYGIGAQILRDLGIRDMRLLTNNPRKIAGLE 360

Query: 355 GYDIKITKQ 363
           GYD+ I ++
Sbjct: 361 GYDLNIVER 369


>RIBBA_BACSU RecName: Full=Riboflavin biosynthesis protein
           ribBA;Includes:  RecName: Full=3,4-dihydroxy-2-butanone
           4-phosphate synthase;
          Length = 398

 Score =  223 bits (568), Expect = 2e-60
 Identities = 140/370 (37%), Positives = 201/370 (54%), Gaps = 19/370 (5%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           IE  ++  KKG + I+VDDE RENEGD +     ++ + INFMA +GRGLIC  L    A
Sbjct: 5   IEEALDALKKGEVIIVVDDEDRENEGDFVALAEHATPEVINFMATHGRGLICTPLSEEIA 64

Query: 69  KRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPG 128
            RL+L  M   N   + TAFT+SI+ ++   TGISA++R               D   PG
Sbjct: 65  DRLDLHPMVEHNTDSHHTAFTVSIDHRE-TKTGISAQERSFTVQALLDSKSVPSDFQRPG 123

Query: 129 HVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKH 188
           H+FP+IAK GGVL RAGHTEA+VD+++      + VICEIMNEDGTMA+  +L + A KH
Sbjct: 124 HIFPLIAKKGGVLKRAGHTEAAVDLAEACGSPGAGVICEIMNEDGTMARVPELIEIAKKH 183

Query: 189 NLKIGKIEDLIAYRXXXXXXXXXXXQSDIKVKNQKYKIRIYENLLDGSEHFALIKGNIKK 248
            LK+  I+DLI YR              +      +K+  Y N +DG EH A + G++  
Sbjct: 184 QLKMITIKDLIQYRYNLTTLVEREVDITLPTDFGTFKVYGYTNEVDGKEHVAFVMGDVPF 243

Query: 249 GIIP-RVRVISSNVVQNYLINQQLP--NSFDKTLNYFKKFNNCVLVFIKDTNLK-SVTQT 304
           G  P  VRV S  +  +   + +          LN        VL++++       +   
Sbjct: 244 GEEPVLVRVHSECLTGDVFGSHRCDCGPQLHAALNQIAAEGRGVLLYLRQEGRGIGLINK 303

Query: 305 LKDYKNKNFYKKGNDKL-----------IRNYGIGAQIIKDLKIKNMILITKSLKKVIGL 353
           LK YK     ++G D +           +RNYGIGAQI++DL ++NM L+T + +K+ GL
Sbjct: 304 LKAYK---LQEQGYDTVEANEALGFLPDLRNYGIGAQILRDLGVRNMKLLTNNPRKIAGL 360

Query: 354 EGYDIKITKQ 363
           EGY + I+++
Sbjct: 361 EGYGLSISER 370


>RIBBA_SYNWW RecName: Full=Riboflavin biosynthesis protein
           ribBA;Includes:  RecName: Full=3,4-dihydroxy-2-butanone
           4-phosphate synthase;
          Length = 398

 Score =  219 bits (559), Expect = 2e-59
 Identities = 132/375 (35%), Positives = 206/375 (54%), Gaps = 18/375 (4%)

Query: 6   YASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDS 65
           ++SIE +I   K+G M +LVDDE RENEGD+II+   +  + INFMA + +GLIC+ +  
Sbjct: 2   FSSIEEVIQDIKEGKMIVLVDDEDRENEGDVIIAAEKAGPEAINFMATHAKGLICMPIIG 61

Query: 66  VQAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIV 125
            +   L +  M   N   ++TAFT++++ + G TTGISA +R               D  
Sbjct: 62  ERLDELEIHDMVTENTDNHETAFTVTVDYR-GTTTGISAFERAATVKALIDSVSKPSDFR 120

Query: 126 SPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFA 185
            PGH+FP+  ++GGVL RAGHTE S+D+++LA    +AVICE+MNEDGTMA+   L +FA
Sbjct: 121 KPGHIFPLRYREGGVLRRAGHTEGSIDLTRLAGLYPAAVICEVMNEDGTMARLPQLLEFA 180

Query: 186 NKHNLKIGKIEDLIAYRXXXXXXXXXXXQSDIKVKNQKYKIRIYENLLDGSEHFALIKGN 245
            +HNLK+  I DLI YR            + +      +    YE+LLD   H AL+KG 
Sbjct: 181 RQHNLKLASIADLIEYRRRKEKLVVRVTDAQLPTMYGDFVAVAYESLLDNKGHIALVKGE 240

Query: 246 IKKGIIPRVRVISSNVVQNYLINQQLP--NSFDKTLNYFKKFNNCVLVFIKDTNLK-SVT 302
            ++     VRV S  +  +   +++       +  ++        VL++++       + 
Sbjct: 241 WEEDEPILVRVHSECLTGDVFGSRRCDCGEQLETAMSMIASEGKGVLLYMRQEGRGIGLL 300

Query: 303 QTLKDYKNKNFYKKGNDKL-----------IRNYGIGAQIIKDLKIKNMILITKSLKKVI 351
             +K YK ++    G D +           +R+YGIGAQI+ DL ++ M L+T + KK+ 
Sbjct: 301 NKIKAYKLQD---NGRDTVEANLELGFPADLRDYGIGAQILVDLGVRKMRLMTNNPKKIR 357

Query: 352 GLEGYDIKITKQEII 366
           GLEGY +++ ++  I
Sbjct: 358 GLEGYGLEVVERVAI 372


>RIBBA_UNCTG RecName: Full=Riboflavin biosynthesis protein
           ribBA;Includes:  RecName: Full=3,4-dihydroxy-2-butanone
           4-phosphate synthase;
          Length = 403

 Score =  218 bits (555), Expect = 7e-59
 Identities = 136/377 (36%), Positives = 201/377 (53%), Gaps = 17/377 (4%)

Query: 1   MKKNNYASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLIC 60
           MK   +ASI   +   K G M I+VDD  RENEGDLI +   +S + INFM KY RGLIC
Sbjct: 1   MKNKVFASIGDAVKDIKVGRMVIVVDDPGRENEGDLICAAEKASPEVINFMTKYARGLIC 60

Query: 61  LALDSVQAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXX 120
           + +   + K L +  M      +   +FT+S++ K G TTGISA DR             
Sbjct: 61  VPMKHERLKELEIENMVEKPTEKKGCSFTVSVDYKIGTTTGISAYDRSVTVRKLIDKTAK 120

Query: 121 XXDIVSPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQD 180
             D   PGH+FP+  K+GGVL R GHTEA+VD+ +LA    + +ICEIMN DGTMA+  D
Sbjct: 121 HEDFARPGHIFPLRCKEGGVLARTGHTEAAVDLVRLAGFYPAGIICEIMNNDGTMARMSD 180

Query: 181 LFDFANKHNLKIGKIEDLIAYRXXXXXXXXXXXQSDIKVKNQKYKIRIYENLLDGSEHFA 240
           L  FA KH+L I  I +L+ YR             D+  +   +K+ ++E+L+    H A
Sbjct: 181 LIKFAKKHDLHIITIGELVNYRRRTEKFISEIVNVDLPTRYGDFKLVLFEDLITKDSHIA 240

Query: 241 LIKGNIKKGIIPRVRVISSNVVQN--YLINQQLPNSFDKTLNYFKKFNNCVLVFI-KDTN 297
           ++KG +K      VRV SS    +  + +     +  +  L    +    V+++I ++  
Sbjct: 241 VVKGVVKNRQNVLVRVHSSCETGDIFHSLRCDCGDQLETALKAVGEAEQGVVLYIHQEGR 300

Query: 298 LKSVTQTLKDYKNKNFYKKGNDKL-----------IRNYGIGAQIIKDLKIKNMILITKS 346
              +   LK Y+     +KG D +           +R+YGIGAQ++ +L IK++ L+T +
Sbjct: 301 GIGLANKLKAYR---LQEKGMDTVEANKALGFDPDLRDYGIGAQMLSELGIKSINLMTNN 357

Query: 347 LKKVIGLEGYDIKITKQ 363
             K+ GLE Y +KITK+
Sbjct: 358 PGKINGLESYGLKITKR 374


>RIBB_PHOPO RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 363

 Score =  217 bits (552), Expect = 1e-58
 Identities = 139/334 (41%), Positives = 197/334 (58%)

Query: 7   ASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSV 66
           ++ + II    +G M IL+DDE RENEGDLII++   + + INFMA YGRGLICL L+  
Sbjct: 4   STAQEIIEDIHQGKMVILMDDEDRENEGDLIIASDKVTPEAINFMATYGRGLICLTLNKE 63

Query: 67  QAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVS 126
           +  +L L +M   N  +  T FTISIEA  G+TTGIS  DR               DIV 
Sbjct: 64  RCLQLELPMMVKSNTDKFATPFTISIEAASGVTTGISVNDRXXXXXXXXXXXXXXKDIVM 123

Query: 127 PGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFAN 186
           PGH+FP++A+DGGVL RAGHTEA  D+++LA    S+VI EI+N+DGTMA+   L  FA 
Sbjct: 124 PGHIFPLMAQDGGVLARAGHTEAGCDVARLAGLEPSSVIVEILNDDGTMARRPQLEVFAK 183

Query: 187 KHNLKIGKIEDLIAYRXXXXXXXXXXXQSDIKVKNQKYKIRIYENLLDGSEHFALIKGNI 246
           KH LK+G + DLI YR           +  +  +  ++ +  Y + ++   H+AL KGNI
Sbjct: 184 KHGLKLGTVADLIEYRNKYETMIERISECKLNTEFGEFDMITYRDKINHQIHYALQKGNI 243

Query: 247 KKGIIPRVRVISSNVVQNYLINQQLPNSFDKTLNYFKKFNNCVLVFIKDTNLKSVTQTLK 306
           +      VRV   +  ++ L       +    +      N  +++  K  + + V   ++
Sbjct: 244 EPNSQTLVRVHLQDTFKDILQTGSTRWTLPAAMERISSENGVLVIVTKQEDPEMVISKIQ 303

Query: 307 DYKNKNFYKKGNDKLIRNYGIGAQIIKDLKIKNM 340
           +   +N      +   R  G+G+QI+ DL I+ M
Sbjct: 304 NLALENKETPVVNSQSRQVGLGSQILSDLGIRKM 337


>RIBBA_BACCR RecName: Full=Riboflavin biosynthesis protein
           ribBA;Includes:  RecName: Full=3,4-dihydroxy-2-butanone
           4-phosphate synthase;
          Length = 397

 Score =  217 bits (552), Expect = 1e-58
 Identities = 137/366 (37%), Positives = 202/366 (55%), Gaps = 12/366 (3%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           IE  +   KKG + I+ DDE RENEGD I      + + INFM  +GRGL+C+ +    A
Sbjct: 5   IEEALEDLKKGKVVIVCDDENRENEGDFIALAEYITPETINFMITHGRGLVCVPITEGYA 64

Query: 69  KRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPG 128
           +RL L  M   N   + TAFT+SI+     TTGISA +R               D   PG
Sbjct: 65  ERLQLEPMVSHNTDSHHTAFTVSID-HVSTTTGISAHERATTIQELLNPASKGADFNRPG 123

Query: 129 HVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKH 188
           H+FP+IAK+GGVL RAGHTEA+VD++KL     + VICEI+NEDGTMA+  DL + A + 
Sbjct: 124 HIFPLIAKEGGVLRRAGHTEAAVDLAKLCGAEPAGVICEIINEDGTMARVPDLIECAKQF 183

Query: 189 NLKIGKIEDLIAYRXXXXXXXXXXXQSDIKVKNQKYKIRIYENLLDGSEHFALIKGNIKK 248
           ++K+  IEDLIAYR           +  +      +    Y N LD  EH AL+KG+I  
Sbjct: 184 DIKMITIEDLIAYRRHHETLVTREAEITLPTDFGTFHAIGYSNSLDTKEHIALVKGDIST 243

Query: 249 GIIPRVRVISSNVVQNYLINQQLP--NSFDKTLNYFKKFNNCVLVFIKDTNLK-SVTQTL 305
           G    VRV S  +  +   + +          L   ++    VL++++       +   L
Sbjct: 244 GEPVLVRVHSECLTGDVFGSHRCDCGPQLHAALAQIEREGKGVLLYMRQEGRGIGLLNKL 303

Query: 306 KDYK--NKNF-YKKGNDKL-----IRNYGIGAQIIKDLKIKNMILITKSLKKVIGLEGYD 357
           + YK   + F   + N+KL     +R+YGIGAQI+KDL ++++ L+T + +K+ GL+GYD
Sbjct: 304 RAYKLQEEGFDTVEANEKLGFPADLRDYGIGAQILKDLGLQSLRLLTNNPRKIAGLQGYD 363

Query: 358 IKITKQ 363
           +++ ++
Sbjct: 364 LEVVER 369


>RIBB_PSESM RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 369

 Score =  216 bits (551), Expect = 2e-58
 Identities = 131/358 (36%), Positives = 200/358 (55%), Gaps = 8/358 (2%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           IE II   ++G M +LVDDE RENEGDL+++    +A+ I+FMA+  RGLICL L     
Sbjct: 6   IEDIIEDYRQGKMVLLVDDEDRENEGDLLLAADCCTAQAISFMAREARGLICLTLTDEHC 65

Query: 69  KRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPG 128
           K L L  M P N S   TAFT+SIEA  G+TTGISA DR               D+V PG
Sbjct: 66  KSLGLEQMVPSNGSVFATAFTVSIEATTGVTTGISAADRARTVQAAVNPGAVPDDLVQPG 125

Query: 129 HVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKH 188
           H+FP+ A+DGGVL RAGHTEA  D++++A    ++VI E+MN+DGTMA+  DL  FA KH
Sbjct: 126 HIFPLRARDGGVLTRAGHTEAGCDLARMAGFTPASVIVEVMNDDGTMARRPDLELFAEKH 185

Query: 189 NLKIGKIEDLIAYRXXXXXXXXXXXQSDIKVKNQKYKIRIYENLLDGSEHFALIKGNIKK 248
            ++IG I DLI YR           + ++   +  +++  YE+ ++G  H A++ G+I++
Sbjct: 186 GIRIGTIADLIHYRLSTEHTIVRIGERELPTVHGTFRLFSYEDRIEGGVHMAMVMGDIRR 245

Query: 249 GIIPRVRVISSNVVQNYLINQQLPNSFDKTL-----NYFKKFNNCVLVFIKDTNLKSVTQ 303
                VRV   + +++ L+  +     + TL        ++    V+V     + +++ +
Sbjct: 246 EDPTLVRVHVVDPLRD-LVGAEYTGPANWTLWAALQRVAEEGCGVVVVLANHESSQALLE 304

Query: 304 TLKDY-KNKNFYKKGNDKLIRNYGIGAQIIKDLKIKNMILITKSLKKVIGLEGYDIKI 360
            +    +    Y +   ++    G GAQI++DL I  +  +   L K  GL GYD+++
Sbjct: 305 RIPQLTQPPRQYTRSQSRIYSEVGTGAQILQDLGIGKLRHLGPPL-KYAGLTGYDLEV 361


>RIBBA_BACC4 RecName: Full=Riboflavin biosynthesis protein
           ribBA;Includes:  RecName: Full=3,4-dihydroxy-2-butanone
           4-phosphate synthase;
          Length = 397

 Score =  216 bits (551), Expect = 2e-58
 Identities = 137/366 (37%), Positives = 202/366 (55%), Gaps = 12/366 (3%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           IE  +   KKG + I+ DDE RENEGD I      + + INFM  +GRGL+C+ +    A
Sbjct: 5   IEEALEDLKKGKVVIVCDDENRENEGDFIALAEYITPETINFMITHGRGLVCVPITEGYA 64

Query: 69  KRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPG 128
           +RL L  M   N   + TAFT+SI+     TTGISA +R               D   PG
Sbjct: 65  ERLQLEPMVSHNTDSHHTAFTVSID-HVSTTTGISAHERATTIQELLNPASKGADFNRPG 123

Query: 129 HVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKH 188
           H+FP+IAK+GGVL RAGHTEA+VD++KL     + VICEI+NEDGTMA+  DL + A + 
Sbjct: 124 HIFPLIAKEGGVLRRAGHTEAAVDLAKLCGAEPAGVICEIINEDGTMARVPDLIECAKQF 183

Query: 189 NLKIGKIEDLIAYRXXXXXXXXXXXQSDIKVKNQKYKIRIYENLLDGSEHFALIKGNIKK 248
           ++K+  IEDLIAYR           +  +      +    Y N LD  EH AL+KG+I  
Sbjct: 184 DIKMITIEDLIAYRRHHETLVTREVEITLPTDFGTFHAIGYSNSLDTKEHIALVKGDIST 243

Query: 249 GIIPRVRVISSNVVQNYLINQQLP--NSFDKTLNYFKKFNNCVLVFIKDTNLK-SVTQTL 305
           G    VRV S  +  +   + +          L   ++    VL++++       +   L
Sbjct: 244 GEPVLVRVHSECLTGDVFGSHRCDCGPQLHAALAQIEREGKGVLLYMRQEGRGIGLLNKL 303

Query: 306 KDYK--NKNF-YKKGNDKL-----IRNYGIGAQIIKDLKIKNMILITKSLKKVIGLEGYD 357
           + YK   + F   + N+KL     +R+YGIGAQI+KDL ++++ L+T + +K+ GL+GYD
Sbjct: 304 RAYKLQEEGFDTVEANEKLGFPADLRDYGIGAQILKDLGLQSLRLLTNNPRKIAGLQGYD 363

Query: 358 IKITKQ 363
           +++ ++
Sbjct: 364 LEVIER 369


>RIBBA_BACWK RecName: Full=Riboflavin biosynthesis protein
           ribBA;Includes:  RecName: Full=3,4-dihydroxy-2-butanone
           4-phosphate synthase;
          Length = 397

 Score =  216 bits (549), Expect = 3e-58
 Identities = 136/366 (37%), Positives = 200/366 (54%), Gaps = 12/366 (3%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           IE  +   K+G + I+ DDE RENEGD I      + + INFM  +GRGL+C+ +    A
Sbjct: 5   IEEALEDLKQGKVVIVCDDENRENEGDFIALAEYITPETINFMITHGRGLVCVPITEEYA 64

Query: 69  KRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPG 128
           +RL L  M   N   + TAFT+SI+     TTGISA +R               D   PG
Sbjct: 65  ERLQLEPMVSHNTDSHHTAFTVSID-HVSTTTGISAHERATTIQELLNPASKGSDFNRPG 123

Query: 129 HVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKH 188
           H+FP+IAK+GGVL RAGHTEA+VD++KL     + VICEI+NEDGTMA+  DL + A + 
Sbjct: 124 HIFPLIAKEGGVLRRAGHTEAAVDLAKLCGAEPAGVICEIINEDGTMARVPDLLECAKQF 183

Query: 189 NLKIGKIEDLIAYRXXXXXXXXXXXQSDIKVKNQKYKIRIYENLLDGSEHFALIKGNIKK 248
           ++K+  IEDLIAYR           +  +      +    Y N LD  EH AL+KG+I  
Sbjct: 184 DIKMITIEDLIAYRRHHETLVTREVEITLPTDFGTFHAIGYSNSLDMKEHIALVKGDIST 243

Query: 249 GIIPRVRVISSNVVQNYL--INQQLPNSFDKTLNYFKKFNNCVLVFIKDTNLK-SVTQTL 305
           G    VRV S  +  +                L   ++    VL++++       +   L
Sbjct: 244 GEPVLVRVHSECLTGDVFGSCRCDCGPQLHAALAQIEREGKGVLLYMRQEGRGIGLLNKL 303

Query: 306 KDYKNKN---FYKKGNDKL-----IRNYGIGAQIIKDLKIKNMILITKSLKKVIGLEGYD 357
           + YK +       + N+KL     +R+YGIGAQI+KDL ++++ L+T + +K+ GL+GYD
Sbjct: 304 RAYKLQEEGLDTVEANEKLGFPADLRDYGIGAQILKDLGLQSLRLLTNNPRKIAGLQGYD 363

Query: 358 IKITKQ 363
           +++T++
Sbjct: 364 LEVTER 369


>RIBBA_BACC2 RecName: Full=Riboflavin biosynthesis protein
           ribBA;Includes:  RecName: Full=3,4-dihydroxy-2-butanone
           4-phosphate synthase;
          Length = 397

 Score =  214 bits (546), Expect = 7e-58
 Identities = 136/366 (37%), Positives = 202/366 (55%), Gaps = 12/366 (3%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           IE  +   K+G + I+ DDE RENEGD I      + + INFM  +GRGL+C+ +    A
Sbjct: 5   IEEALEDLKQGKVVIVCDDENRENEGDFIALAEYITPETINFMITHGRGLVCVPITEGYA 64

Query: 69  KRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPG 128
           +RL L  M   N   + TAFT+SI+     TTGISA +R               D   PG
Sbjct: 65  ERLQLEPMVSHNTDSHHTAFTVSID-HVSTTTGISAHERATTIQELLNPASKGTDFNRPG 123

Query: 129 HVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKH 188
           H+FP+IAK+GGVL RAGHTEA+VD++KL     + VICEI+NEDGTMA+  DL + A + 
Sbjct: 124 HIFPLIAKEGGVLRRAGHTEAAVDLAKLCGAEPAGVICEIINEDGTMARVPDLIECAKQF 183

Query: 189 NLKIGKIEDLIAYRXXXXXXXXXXXQSDIKVKNQKYKIRIYENLLDGSEHFALIKGNIKK 248
           ++K+  IEDLIAYR           +  +      +    Y N LD  EH AL+KG+I  
Sbjct: 184 DIKMITIEDLIAYRRHHETLVTREVEITLPTDFGTFHAIGYSNSLDTKEHIALVKGDISI 243

Query: 249 GIIPRVRVISSNVVQNYLINQQLP--NSFDKTLNYFKKFNNCVLVFIKDTNLK-SVTQTL 305
           G    VRV S  +  +   + +          L   ++    VL++++       +   L
Sbjct: 244 GEPVLVRVHSECLTGDVFGSHRCDCGPQLHAALAQIEREGKGVLLYMRQEGRGIGLLNKL 303

Query: 306 KDYK--NKNF-YKKGNDKL-----IRNYGIGAQIIKDLKIKNMILITKSLKKVIGLEGYD 357
           + YK   + F   + N+KL     +R+YGIGAQI+KDL ++++ L+T + +K+ GL+GYD
Sbjct: 304 RAYKLQEEGFDTVEANEKLGFPADLRDYGIGAQILKDLGLQSLRLLTNNPRKIAGLQGYD 363

Query: 358 IKITKQ 363
           +++ ++
Sbjct: 364 LEVVER 369


>RIBBA_THEPX RecName: Full=Riboflavin biosynthesis protein
           ribBA;Includes:  RecName: Full=3,4-dihydroxy-2-butanone
           4-phosphate synthase;
          Length = 396

 Score =  214 bits (545), Expect = 1e-57
 Identities = 134/374 (35%), Positives = 199/374 (53%), Gaps = 30/374 (8%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           IE  I   K+G M I+VDDE RENEGDL+++    + ++INFM KYGRGL+C+ +   + 
Sbjct: 5   IEDAIEDIKQGKMIIVVDDENRENEGDLVMAAEKVTGEHINFMIKYGRGLVCVPMTEKRL 64

Query: 69  KRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPG 128
             L +  M   N    +TAFT+S++ K+  TTGISA +R               D   PG
Sbjct: 65  NELGIYQMVENNTDHKETAFTVSVDYKE-CTTGISAFERALTVKKLVDDNSKPEDFTKPG 123

Query: 129 HVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKH 188
           H+FP+ AKDGGVLVRAGHTEA+VD++ LA    + VICEI+ +DG MA+  DL +FA K 
Sbjct: 124 HIFPLRAKDGGVLVRAGHTEAAVDLAVLAGLKPAGVICEIIKDDGNMARLPDLLEFAKKF 183

Query: 189 NLKIGKIEDLIAYRXXXXXXXXXXXQSDIKVKNQKYKIRIYENLLDGSEHFALIKGNIKK 248
            L+I  IEDLI YR           Q+ +  K   ++I  YE +L G +H ALIKG++ K
Sbjct: 184 GLRIISIEDLIKYRMKNEILVRRVAQAKLPTKYGNFEIVGYEEILTGKQHVALIKGDVNK 243

Query: 249 GIIPRVRVISSNVVQNYL------INQQLPNSFDK------TLNYFKK-------FNNCV 289
             +  VR+ S  +  + L         QL  + ++       L Y ++        N   
Sbjct: 244 EPV-LVRIHSECLTGDILGSLRCDCGDQLHAAMERIGQEGGILVYLRQEGRGIGLLNKIK 302

Query: 290 LVFIKDTNLKSVTQTLKDYKNKNFYKKGNDKLIRNYGIGAQIIKDLKIKNMILITKSLKK 349
              ++D  L +V   +         K G    +R Y I AQI+KD+ +K + ++T + +K
Sbjct: 303 AYHLQDQGLDTVEANI---------KLGFPPDLREYNIAAQILKDIGVKKIRIMTNNPQK 353

Query: 350 VIGLEGYDIKITKQ 363
           +  L  Y + + ++
Sbjct: 354 ITELSDYGLDVVER 367


>RIBBA_BACA2 RecName: Full=Riboflavin biosynthesis protein
           ribBA;Includes:  RecName: Full=3,4-dihydroxy-2-butanone
           4-phosphate synthase;
          Length = 398

 Score =  214 bits (545), Expect = 1e-57
 Identities = 134/370 (36%), Positives = 199/370 (53%), Gaps = 19/370 (5%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           IE  +   KKG + I+VDDE RENEGD +     ++ + +NFMA +GRGLIC  L    A
Sbjct: 5   IEEALEALKKGEVIIVVDDEDRENEGDFVALAEHATPEVVNFMATHGRGLICTPLSEDIA 64

Query: 69  KRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPG 128
            RL+L  M   N   ++TAFT+SI+ +    TGISA++R               D   PG
Sbjct: 65  GRLDLHPMVDHNTDSHETAFTVSIDHRL-TKTGISAQERSFTIQALLNEESVSDDFQRPG 123

Query: 129 HVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKH 188
           H+FP+IAK GGVL RAGHTEA+VD++K      + VICEIMNEDGTMA+  +L + A +H
Sbjct: 124 HIFPLIAKKGGVLKRAGHTEAAVDLAKACGSQGAGVICEIMNEDGTMARVPELAEIAERH 183

Query: 189 NLKIGKIEDLIAYRXXXXXXXXXXXQSDIKVKNQKYKIRIYENLLDGSEHFALIKGNIKK 248
            LK+  I+DLI YR              +      +++  Y N +DG EH A + G++  
Sbjct: 184 QLKMITIKDLIEYRYNITTLVNREVDITLPTDFGTFRVYGYTNEVDGKEHLAFVMGDVPF 243

Query: 249 GIIP-RVRVISSNVVQNYLINQQLP--NSFDKTLNYFKKFNNCVLVFIKDTNLK-SVTQT 304
              P  VRV S  +  +   + +          L    +    VL++++       +   
Sbjct: 244 NSEPVLVRVHSECLTGDVFASHRCDCGPQLHAALAQIAEEGRGVLLYLRQEGRGIGLINK 303

Query: 305 LKDYKNKNFYKKGNDKL-----------IRNYGIGAQIIKDLKIKNMILITKSLKKVIGL 353
           LK Y+     ++G D +           +RNYGIGAQI++DL +++M L+T + +K+ GL
Sbjct: 304 LKAYR---LQEQGYDTVEANEALGFLPDLRNYGIGAQILRDLGVQHMKLLTNNPRKIAGL 360

Query: 354 EGYDIKITKQ 363
           EGY + I+++
Sbjct: 361 EGYGLSISER 370


>RIBBA_BACHK RecName: Full=Riboflavin biosynthesis protein
           ribBA;Includes:  RecName: Full=3,4-dihydroxy-2-butanone
           4-phosphate synthase;
          Length = 397

 Score =  214 bits (544), Expect = 1e-57
 Identities = 136/366 (37%), Positives = 200/366 (54%), Gaps = 12/366 (3%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           IE  +   K+G + I+ DDE RENEGD I      + + INFM  +GRGL+C+ +    A
Sbjct: 5   IEEALEDLKQGKVVIVCDDENRENEGDFIALAEYITPETINFMITHGRGLVCVPITEGYA 64

Query: 69  KRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPG 128
           +RL L  M   N   + TAFT+SI+     TTGISA +R               D   PG
Sbjct: 65  ERLQLEPMVSHNTDSHHTAFTVSID-HVSTTTGISAHERATTIQQLLNPASKGADFNRPG 123

Query: 129 HVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKH 188
           H+FP+IAK+GGVL RAGHTEA+VD+++L     + VICEI+NEDGTMA+  DL   A + 
Sbjct: 124 HIFPLIAKEGGVLRRAGHTEAAVDLAQLCGAEPAGVICEIINEDGTMARVPDLLQCAKQF 183

Query: 189 NLKIGKIEDLIAYRXXXXXXXXXXXQSDIKVKNQKYKIRIYENLLDGSEHFALIKGNIKK 248
           ++K+  IEDLIAYR           +  +      ++   Y N LD  EH AL+KG+I  
Sbjct: 184 DIKMITIEDLIAYRRHHETLVTREVEITLPTDFGTFQAIGYSNSLDTKEHIALVKGDIST 243

Query: 249 GIIPRVRVISSNVVQNYL--INQQLPNSFDKTLNYFKKFNNCVLVFIKDTNLK-SVTQTL 305
           G    VRV S  +  +                L   ++    VL++++       +   L
Sbjct: 244 GEPVLVRVHSECLTGDVFGSCRCDCGPQLHAALAQIEREGKGVLLYMRQEGRGIGLLNKL 303

Query: 306 KDYK--NKNF-YKKGNDKL-----IRNYGIGAQIIKDLKIKNMILITKSLKKVIGLEGYD 357
           + YK   + F   + N+KL     +R+YGIGAQI+KDL ++++ L+T + +K+ GL+GYD
Sbjct: 304 RAYKLQEEGFDTVEANEKLGFPADLRDYGIGAQILKDLGLQHLRLLTNNPRKIAGLQGYD 363

Query: 358 IKITKQ 363
           + +T++
Sbjct: 364 LTVTER 369


>RIBBA_BACC3 RecName: Full=Riboflavin biosynthesis protein
           ribBA;Includes:  RecName: Full=3,4-dihydroxy-2-butanone
           4-phosphate synthase;
          Length = 397

 Score =  214 bits (544), Expect = 1e-57
 Identities = 136/366 (37%), Positives = 200/366 (54%), Gaps = 12/366 (3%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           IE  +   K+G + I+ DDE RENEGD I      + + INFM  +GRGL+C+ +    A
Sbjct: 5   IEEALEDLKQGKVVIVCDDENRENEGDFIALAEYITPETINFMITHGRGLVCVPITEGYA 64

Query: 69  KRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPG 128
           +RL L  M   N   + TAFT+SI+     TTGISA +R               D   PG
Sbjct: 65  ERLQLEPMVSHNTDSHHTAFTVSID-HVSTTTGISAHERATTIQQLLNPASKGADFNRPG 123

Query: 129 HVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKH 188
           H+FP+IAK+GGVL RAGHTEA+VD+++L     + VICEI+NEDGTMA+  DL   A + 
Sbjct: 124 HIFPLIAKEGGVLRRAGHTEAAVDLAQLCGAEPAGVICEIINEDGTMARVPDLLQCAKQF 183

Query: 189 NLKIGKIEDLIAYRXXXXXXXXXXXQSDIKVKNQKYKIRIYENLLDGSEHFALIKGNIKK 248
           ++K+  IEDLIAYR           +  +      ++   Y N LD  EH AL+KG+I  
Sbjct: 184 DIKMITIEDLIAYRRHHETLVTREVEITLPTDFGTFQAIGYSNSLDTKEHIALVKGDIST 243

Query: 249 GIIPRVRVISSNVVQNYL--INQQLPNSFDKTLNYFKKFNNCVLVFIKDTNLK-SVTQTL 305
           G    VRV S  +  +                L   ++    VL++++       +   L
Sbjct: 244 GEPVLVRVHSECLTGDVFGSCRCDCGPQLHAALAQIEREGKGVLLYMRQEGRGIGLLNKL 303

Query: 306 KDYK--NKNF-YKKGNDKL-----IRNYGIGAQIIKDLKIKNMILITKSLKKVIGLEGYD 357
           + YK   + F   + N+KL     +R+YGIGAQI+KDL ++++ L+T + +K+ GL+GYD
Sbjct: 304 RAYKLQEEGFDTVEANEKLGFPADLRDYGIGAQILKDLGLQHLRLLTNNPRKIAGLQGYD 363

Query: 358 IKITKQ 363
           + +T++
Sbjct: 364 LTVTER 369


>RIBBA_BACAN RecName: Full=Riboflavin biosynthesis protein
           ribBA;Includes:  RecName: Full=3,4-dihydroxy-2-butanone
           4-phosphate synthase;
          Length = 397

 Score =  214 bits (544), Expect = 1e-57
 Identities = 136/366 (37%), Positives = 200/366 (54%), Gaps = 12/366 (3%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           IE  +   K+G + I+ DDE RENEGD I      + + INFM  +GRGL+C+ +    A
Sbjct: 5   IEEALEDLKQGKVVIVCDDENRENEGDFIALAEYITPETINFMITHGRGLVCVPITEGYA 64

Query: 69  KRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPG 128
           +RL L  M   N   + TAFT+SI+     TTGISA +R               D   PG
Sbjct: 65  ERLQLEPMVSHNTDSHHTAFTVSID-HVSTTTGISAHERATTIQQLLNPASKGADFNRPG 123

Query: 129 HVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKH 188
           H+FP+IAK+GGVL RAGHTEA+VD+++L     + VICEI+NEDGTMA+  DL   A + 
Sbjct: 124 HIFPLIAKEGGVLRRAGHTEAAVDLAQLCGAEPAGVICEIINEDGTMARVPDLLQCAKQF 183

Query: 189 NLKIGKIEDLIAYRXXXXXXXXXXXQSDIKVKNQKYKIRIYENLLDGSEHFALIKGNIKK 248
           ++K+  IEDLIAYR           +  +      ++   Y N LD  EH AL+KG+I  
Sbjct: 184 DIKMITIEDLIAYRRHHETLVTREVEITLPTDFGTFQAIGYSNSLDTKEHIALVKGDIST 243

Query: 249 GIIPRVRVISSNVVQNYL--INQQLPNSFDKTLNYFKKFNNCVLVFIKDTNLK-SVTQTL 305
           G    VRV S  +  +                L   ++    VL++++       +   L
Sbjct: 244 GEPVLVRVHSECLTGDVFGSCRCDCGPQLHAALAQIEREGKGVLLYMRQEGRGIGLLNKL 303

Query: 306 KDYK--NKNF-YKKGNDKL-----IRNYGIGAQIIKDLKIKNMILITKSLKKVIGLEGYD 357
           + YK   + F   + N+KL     +R+YGIGAQI+KDL ++++ L+T + +K+ GL+GYD
Sbjct: 304 RAYKLQEEGFDTVEANEKLGFPADLRDYGIGAQILKDLGLQHLRLLTNNPRKIAGLQGYD 363

Query: 358 IKITKQ 363
           + +T++
Sbjct: 364 LTVTER 369


>RIBBA_BACAH RecName: Full=Riboflavin biosynthesis protein
           ribBA;Includes:  RecName: Full=3,4-dihydroxy-2-butanone
           4-phosphate synthase;
          Length = 397

 Score =  214 bits (544), Expect = 1e-57
 Identities = 136/366 (37%), Positives = 200/366 (54%), Gaps = 12/366 (3%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           IE  +   K+G + I+ DDE RENEGD I      + + INFM  +GRGL+C+ +    A
Sbjct: 5   IEEALEDLKQGKVVIVCDDENRENEGDFIALAEYITPETINFMITHGRGLVCVPITEGYA 64

Query: 69  KRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPG 128
           +RL L  M   N   + TAFT+SI+     TTGISA +R               D   PG
Sbjct: 65  ERLQLEPMVSHNTDSHHTAFTVSID-HVSTTTGISAHERATTIQQLLNPASKGADFNRPG 123

Query: 129 HVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKH 188
           H+FP+IAK+GGVL RAGHTEA+VD+++L     + VICEI+NEDGTMA+  DL   A + 
Sbjct: 124 HIFPLIAKEGGVLRRAGHTEAAVDLAQLCGAEPAGVICEIINEDGTMARVPDLLQCAKQF 183

Query: 189 NLKIGKIEDLIAYRXXXXXXXXXXXQSDIKVKNQKYKIRIYENLLDGSEHFALIKGNIKK 248
           ++K+  IEDLIAYR           +  +      ++   Y N LD  EH AL+KG+I  
Sbjct: 184 DIKMITIEDLIAYRRHHETLVTREVEITLPTDFGTFQAIGYSNSLDTKEHIALVKGDIST 243

Query: 249 GIIPRVRVISSNVVQNYL--INQQLPNSFDKTLNYFKKFNNCVLVFIKDTNLK-SVTQTL 305
           G    VRV S  +  +                L   ++    VL++++       +   L
Sbjct: 244 GEPVLVRVHSECLTGDVFGSCRCDCGPQLHAALAQIEREGKGVLLYMRQEGRGIGLLNKL 303

Query: 306 KDYK--NKNF-YKKGNDKL-----IRNYGIGAQIIKDLKIKNMILITKSLKKVIGLEGYD 357
           + YK   + F   + N+KL     +R+YGIGAQI+KDL ++++ L+T + +K+ GL+GYD
Sbjct: 304 RAYKLQEEGFDTVEANEKLGFPADLRDYGIGAQILKDLGLQHLRLLTNNPRKIAGLQGYD 363

Query: 358 IKITKQ 363
           + +T++
Sbjct: 364 LTVTER 369


>RIBBA_BACAC RecName: Full=Riboflavin biosynthesis protein
           ribBA;Includes:  RecName: Full=3,4-dihydroxy-2-butanone
           4-phosphate synthase;
          Length = 397

 Score =  214 bits (544), Expect = 1e-57
 Identities = 136/366 (37%), Positives = 200/366 (54%), Gaps = 12/366 (3%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           IE  +   K+G + I+ DDE RENEGD I      + + INFM  +GRGL+C+ +    A
Sbjct: 5   IEEALEDLKQGKVVIVCDDENRENEGDFIALAEYITPETINFMITHGRGLVCVPITEGYA 64

Query: 69  KRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPG 128
           +RL L  M   N   + TAFT+SI+     TTGISA +R               D   PG
Sbjct: 65  ERLQLEPMVSHNTDSHHTAFTVSID-HVSTTTGISAHERATTIQQLLNPASKGADFNRPG 123

Query: 129 HVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKH 188
           H+FP+IAK+GGVL RAGHTEA+VD+++L     + VICEI+NEDGTMA+  DL   A + 
Sbjct: 124 HIFPLIAKEGGVLRRAGHTEAAVDLAQLCGAEPAGVICEIINEDGTMARVPDLLQCAKQF 183

Query: 189 NLKIGKIEDLIAYRXXXXXXXXXXXQSDIKVKNQKYKIRIYENLLDGSEHFALIKGNIKK 248
           ++K+  IEDLIAYR           +  +      ++   Y N LD  EH AL+KG+I  
Sbjct: 184 DIKMITIEDLIAYRRHHETLVTREVEITLPTDFGTFQAIGYSNSLDTKEHIALVKGDIST 243

Query: 249 GIIPRVRVISSNVVQNYL--INQQLPNSFDKTLNYFKKFNNCVLVFIKDTNLK-SVTQTL 305
           G    VRV S  +  +                L   ++    VL++++       +   L
Sbjct: 244 GEPVLVRVHSECLTGDVFGSCRCDCGPQLHAALAQIEREGKGVLLYMRQEGRGIGLLNKL 303

Query: 306 KDYK--NKNF-YKKGNDKL-----IRNYGIGAQIIKDLKIKNMILITKSLKKVIGLEGYD 357
           + YK   + F   + N+KL     +R+YGIGAQI+KDL ++++ L+T + +K+ GL+GYD
Sbjct: 304 RAYKLQEEGFDTVEANEKLGFPADLRDYGIGAQILKDLGLQHLRLLTNNPRKIAGLQGYD 363

Query: 358 IKITKQ 363
           + +T++
Sbjct: 364 LTVTER 369


>RIBBA_BACAA RecName: Full=Riboflavin biosynthesis protein
           ribBA;Includes:  RecName: Full=3,4-dihydroxy-2-butanone
           4-phosphate synthase;
          Length = 397

 Score =  214 bits (544), Expect = 1e-57
 Identities = 136/366 (37%), Positives = 200/366 (54%), Gaps = 12/366 (3%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           IE  +   K+G + I+ DDE RENEGD I      + + INFM  +GRGL+C+ +    A
Sbjct: 5   IEEALEDLKQGKVVIVCDDENRENEGDFIALAEYITPETINFMITHGRGLVCVPITEGYA 64

Query: 69  KRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPG 128
           +RL L  M   N   + TAFT+SI+     TTGISA +R               D   PG
Sbjct: 65  ERLQLEPMVSHNTDSHHTAFTVSID-HVSTTTGISAHERATTIQQLLNPASKGADFNRPG 123

Query: 129 HVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKH 188
           H+FP+IAK+GGVL RAGHTEA+VD+++L     + VICEI+NEDGTMA+  DL   A + 
Sbjct: 124 HIFPLIAKEGGVLRRAGHTEAAVDLAQLCGAEPAGVICEIINEDGTMARVPDLLQCAKQF 183

Query: 189 NLKIGKIEDLIAYRXXXXXXXXXXXQSDIKVKNQKYKIRIYENLLDGSEHFALIKGNIKK 248
           ++K+  IEDLIAYR           +  +      ++   Y N LD  EH AL+KG+I  
Sbjct: 184 DIKMITIEDLIAYRRHHETLVTREVEITLPTDFGTFQAIGYSNSLDTKEHIALVKGDIST 243

Query: 249 GIIPRVRVISSNVVQNYL--INQQLPNSFDKTLNYFKKFNNCVLVFIKDTNLK-SVTQTL 305
           G    VRV S  +  +                L   ++    VL++++       +   L
Sbjct: 244 GEPVLVRVHSECLTGDVFGSCRCDCGPQLHAALAQIEREGKGVLLYMRQEGRGIGLLNKL 303

Query: 306 KDYK--NKNF-YKKGNDKL-----IRNYGIGAQIIKDLKIKNMILITKSLKKVIGLEGYD 357
           + YK   + F   + N+KL     +R+YGIGAQI+KDL ++++ L+T + +K+ GL+GYD
Sbjct: 304 RAYKLQEEGFDTVEANEKLGFPADLRDYGIGAQILKDLGLQHLRLLTNNPRKIAGLQGYD 363

Query: 358 IKITKQ 363
           + +T++
Sbjct: 364 LTVTER 369


>RIBBA_THEP3 RecName: Full=Riboflavin biosynthesis protein
           ribBA;Includes:  RecName: Full=3,4-dihydroxy-2-butanone
           4-phosphate synthase;
          Length = 396

 Score =  213 bits (541), Expect = 3e-57
 Identities = 134/374 (35%), Positives = 199/374 (53%), Gaps = 30/374 (8%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           IE  I   K+G M I+VDDE RENEGDL+++    + ++INFM KYGRGL+C+ +   + 
Sbjct: 5   IEDAIEDIKQGKMIIVVDDENRENEGDLVMAAEKVTGEHINFMIKYGRGLVCVPMTEKRL 64

Query: 69  KRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPG 128
             L +  M   N    +TAFT+S++ K+  TTGISA +R               D   PG
Sbjct: 65  NELGIYQMVENNTDHKETAFTVSVDYKE-CTTGISAFERALTVKKLVDDNSKPEDFTKPG 123

Query: 129 HVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKH 188
           H+FP+ AKDGGVLVRAGHTEA+VD++ LA    + VICEI+ +DG MA+  DL +FA K 
Sbjct: 124 HIFPLRAKDGGVLVRAGHTEAAVDLAVLAGLKPAGVICEIIKDDGNMARLPDLLEFAKKF 183

Query: 189 NLKIGKIEDLIAYRXXXXXXXXXXXQSDIKVKNQKYKIRIYENLLDGSEHFALIKGNIKK 248
            L+I  IEDLI YR           Q+ +  K   ++I  YE +L   +H ALIKG+I K
Sbjct: 184 GLRIISIEDLIKYRMKNEILVRRVAQAKLPTKYGNFEIVGYEEILTRKQHVALIKGDINK 243

Query: 249 GIIPRVRVISSNVVQNYL------INQQLPNSFDK------TLNYFKK-------FNNCV 289
             +  VR+ S  +  + L         QL  + ++       L Y ++        N   
Sbjct: 244 EPV-LVRIHSECLTGDILGSLRCDCGDQLHAAMERIGQEGGVLVYLRQEGRGIGLLNKIK 302

Query: 290 LVFIKDTNLKSVTQTLKDYKNKNFYKKGNDKLIRNYGIGAQIIKDLKIKNMILITKSLKK 349
              ++D  L +V   +         K G    +R Y I AQI+KD+ +K + ++T + +K
Sbjct: 303 AYHLQDQGLDTVEANI---------KLGFPPDLREYSIAAQILKDIGVKKIRIMTNNPQK 353

Query: 350 VIGLEGYDIKITKQ 363
           ++ L  Y + + ++
Sbjct: 354 IMELSDYGLDVVER 367


>RIBBA_BACC0 RecName: Full=Riboflavin biosynthesis protein
           ribBA;Includes:  RecName: Full=3,4-dihydroxy-2-butanone
           4-phosphate synthase;
          Length = 397

 Score =  213 bits (541), Expect = 3e-57
 Identities = 135/366 (36%), Positives = 200/366 (54%), Gaps = 12/366 (3%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           IE  +   K+G + I+ DDE RENEGD +      + + INFM  +GRGL+C+ +    A
Sbjct: 5   IEEALEDLKQGKVVIVCDDENRENEGDFMALAEYITPETINFMITHGRGLVCVPITEGYA 64

Query: 69  KRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPG 128
           +RL L  M   N   + TAFT+SI+     TTGISA +R               D   PG
Sbjct: 65  ERLQLEPMVSHNTDSHHTAFTVSID-HVSTTTGISAHERATTIQQLLNPASKGADFNRPG 123

Query: 129 HVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKH 188
           H+FP+IAK+GGVL RAGHTEA+VD+++L     + VICEI+NEDGTMA+  DL   A + 
Sbjct: 124 HIFPLIAKEGGVLRRAGHTEAAVDLAQLCGAEPAGVICEIINEDGTMARVPDLLQCAKQF 183

Query: 189 NLKIGKIEDLIAYRXXXXXXXXXXXQSDIKVKNQKYKIRIYENLLDGSEHFALIKGNIKK 248
           ++K+  IEDLIAYR           +  +      ++   Y N LD  EH AL+KG+I  
Sbjct: 184 DIKMITIEDLIAYRRHHETLVTREVEITLPTDFGTFQAIGYSNSLDTKEHIALVKGDIST 243

Query: 249 GIIPRVRVISSNVVQNYL--INQQLPNSFDKTLNYFKKFNNCVLVFIKDTNLK-SVTQTL 305
           G    VRV S  +  +                L   ++    VL++++       +   L
Sbjct: 244 GEPVLVRVHSECLTGDVFGSCRCDCGPQLHAALAQIEREGKGVLLYMRQEGRGIGLLNKL 303

Query: 306 KDYK--NKNF-YKKGNDKL-----IRNYGIGAQIIKDLKIKNMILITKSLKKVIGLEGYD 357
           + YK   + F   + N+KL     +R+YGIGAQI+KDL ++++ L+T + +K+ GL+GYD
Sbjct: 304 RAYKLQEEGFDTVEANEKLGFPADLRDYGIGAQILKDLGLQHLRLLTNNPRKIAGLQGYD 363

Query: 358 IKITKQ 363
           + +T++
Sbjct: 364 LTVTER 369


>RIBBA_BACAM RecName: Full=Riboflavin biosynthesis protein
           ribBA;Includes:  RecName: Full=3,4-dihydroxy-2-butanone
           4-phosphate synthase;
          Length = 398

 Score =  213 bits (541), Expect = 3e-57
 Identities = 134/368 (36%), Positives = 196/368 (53%), Gaps = 19/368 (5%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           IE  +   KKG + I+VDDE RENEGD +     ++ + +NFMA +GRGLIC  L    A
Sbjct: 5   IEEALEALKKGEVIIVVDDEDRENEGDFVALAEHATPEVVNFMATHGRGLICTPLSEDIA 64

Query: 69  KRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPG 128
            RL+L  M   N   ++TAFT+SI+ K    TGISA++R               D   PG
Sbjct: 65  GRLDLHPMVDHNTDSHETAFTVSIDHKL-TKTGISAQERSFTIQALLDEESVPGDFQRPG 123

Query: 129 HVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKH 188
           H+FP+IAK GGVL RAGHTEA+VD++K      + VICEIMNEDGTMA+  ++ + A  H
Sbjct: 124 HIFPLIAKKGGVLKRAGHTEAAVDLAKACGSQGADVICEIMNEDGTMARVPEISEIAKSH 183

Query: 189 NLKIGKIEDLIAYRXXXXXXXXXXXQSDIKVKNQKYKIRIYENLLDGSEHFALIKGNIKK 248
            LK+  I+DLI YR              +      +++  Y N +DG EH A + G++  
Sbjct: 184 QLKMITIKDLIEYRYNITTLVNREVDITLPTDFGTFRVYGYTNEVDGKEHLAFVMGDVPF 243

Query: 249 GIIP-RVRVISSNVVQNYLINQQLP--NSFDKTLNYFKKFNNCVLVFIKDTNLK-SVTQT 304
              P  VRV S  +  +   + +          L    +    VL++++       +   
Sbjct: 244 NSGPVLVRVHSECLTGDVFASHRCDCGPQLHAALRQIAEEGRGVLLYLRQEGRGIGLINK 303

Query: 305 LKDYKNKNFYKKGNDKL-----------IRNYGIGAQIIKDLKIKNMILITKSLKKVIGL 353
           LK Y+     ++G D +           +RNYGIGAQI++DL +++M L+T + +K+ GL
Sbjct: 304 LKAYR---LQEQGYDTVEANEALGFLPDLRNYGIGAQILRDLGVQHMKLLTNNPRKIAGL 360

Query: 354 EGYDIKIT 361
           EGY + I+
Sbjct: 361 EGYGLSIS 368


>RIBBA_BACCQ RecName: Full=Riboflavin biosynthesis protein
           ribBA;Includes:  RecName: Full=3,4-dihydroxy-2-butanone
           4-phosphate synthase;
          Length = 397

 Score =  212 bits (540), Expect = 4e-57
 Identities = 135/366 (36%), Positives = 199/366 (54%), Gaps = 12/366 (3%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           IE  +   K+G + I+ DDE RENEGD I      + + INFM  +GRGL+C+ +    A
Sbjct: 5   IEEALEDLKQGKVVIVCDDENRENEGDFIALAEYITPETINFMITHGRGLVCVPITEGYA 64

Query: 69  KRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPG 128
           +RL L  M   N   + TAFT+SI+     TTGISA +R               D   PG
Sbjct: 65  ERLQLEPMVAHNTDSHHTAFTVSID-HVSTTTGISAHERATTIREMLNPASKGADFNRPG 123

Query: 129 HVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKH 188
           H+FP+IAK+GGVL RAGHTEA+VD+++L     + VICEI+NEDGTMA+  DL   A + 
Sbjct: 124 HIFPLIAKEGGVLRRAGHTEAAVDLAQLCGAEPAGVICEIINEDGTMARVPDLLQCAKQF 183

Query: 189 NLKIGKIEDLIAYRXXXXXXXXXXXQSDIKVKNQKYKIRIYENLLDGSEHFALIKGNIKK 248
           ++K+  IEDLIAYR           +  +      +    Y N LD  EH AL+KG+I  
Sbjct: 184 DIKMITIEDLIAYRRHHETLVTREVEITLPTDFGTFHAIGYSNSLDSKEHIALVKGDIST 243

Query: 249 GIIPRVRVISSNVVQNYL--INQQLPNSFDKTLNYFKKFNNCVLVFIKDTNLK-SVTQTL 305
           G    VRV S  +  +                L   ++    VL++++       +   L
Sbjct: 244 GDPVLVRVHSECLTGDVFGSCRCDCGPQLHAALAQIEREGKGVLLYMRQEGRGIGLLNKL 303

Query: 306 KDYK--NKNF-YKKGNDKL-----IRNYGIGAQIIKDLKIKNMILITKSLKKVIGLEGYD 357
           + YK   + F   + N+KL     +R+YGIGAQI+KDL ++++ L+T + +K+ GL+GYD
Sbjct: 304 RAYKLQEEGFDTVEANEKLGFPADLRDYGIGAQILKDLGLQHLRLLTNNPRKIAGLQGYD 363

Query: 358 IKITKQ 363
           +++ ++
Sbjct: 364 LEVIER 369


>RIBBA_BACC7 RecName: Full=Riboflavin biosynthesis protein
           ribBA;Includes:  RecName: Full=3,4-dihydroxy-2-butanone
           4-phosphate synthase;
          Length = 397

 Score =  212 bits (540), Expect = 4e-57
 Identities = 135/366 (36%), Positives = 199/366 (54%), Gaps = 12/366 (3%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           IE  +   K+G + I+ DDE RENEGD I      + + INFM  +GRGL+C+ +    A
Sbjct: 5   IEEALEDLKQGKVVIVCDDENRENEGDFIALAEYITPETINFMITHGRGLVCVPITEGYA 64

Query: 69  KRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPG 128
           +RL L  M   N   + TAFT+SI+     TTGISA +R               D   PG
Sbjct: 65  ERLQLEPMVAHNTDSHHTAFTVSID-HVSTTTGISAHERATTIREMLNPASKGADFNRPG 123

Query: 129 HVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKH 188
           H+FP+IAK+GGVL RAGHTEA+VD+++L     + VICEI+NEDGTMA+  DL   A + 
Sbjct: 124 HIFPLIAKEGGVLRRAGHTEAAVDLAQLCGAEPAGVICEIINEDGTMARVPDLLQCAKQF 183

Query: 189 NLKIGKIEDLIAYRXXXXXXXXXXXQSDIKVKNQKYKIRIYENLLDGSEHFALIKGNIKK 248
           ++K+  IEDLIAYR           +  +      +    Y N LD  EH AL+KG+I  
Sbjct: 184 DIKMITIEDLIAYRRHHETLVTREVEITLPTDFGTFHAIGYSNSLDSKEHIALVKGDIST 243

Query: 249 GIIPRVRVISSNVVQNYL--INQQLPNSFDKTLNYFKKFNNCVLVFIKDTNLK-SVTQTL 305
           G    VRV S  +  +                L   ++    VL++++       +   L
Sbjct: 244 GDPVLVRVHSECLTGDVFGSCRCDCGPQLHAALAQIEREGKGVLLYMRQEGRGIGLLNKL 303

Query: 306 KDYK--NKNF-YKKGNDKL-----IRNYGIGAQIIKDLKIKNMILITKSLKKVIGLEGYD 357
           + YK   + F   + N+KL     +R+YGIGAQI+KDL ++++ L+T + +K+ GL+GYD
Sbjct: 304 RAYKLQEEGFDTVEANEKLGFPADLRDYGIGAQILKDLGLQHLRLLTNNPRKIAGLQGYD 363

Query: 358 IKITKQ 363
           +++ ++
Sbjct: 364 LEVIER 369


>RIBB_NEIMB RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 363

 Score =  212 bits (539), Expect = 5e-57
 Identities = 131/360 (36%), Positives = 199/360 (55%), Gaps = 9/360 (2%)

Query: 4   NNYASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLAL 63
           ++ + I  I+   K G M I+ D E RENEGDL+++    + + INFM K+ RGL+CL +
Sbjct: 2   SHISPIPEILADIKAGKMVIITDAEDRENEGDLLMAAQFVTPEAINFMIKHARGLVCLPM 61

Query: 64  DSVQAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXD 123
           D    ++L L +M+  N ++  T FT+SIEA  GITTGISA DR               D
Sbjct: 62  DGEMVEKLGLPMMTQKNGAQYGTNFTVSIEAAHGITTGISAADRALTIQTAVSPTAKPED 121

Query: 124 IVSPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFD 183
           IV PGH+FP+ A+ GGVLVRAGHTEA VD++++     ++VICEI+N+DGTMA+  +L  
Sbjct: 122 IVQPGHIFPLRAQKGGVLVRAGHTEAGVDLAQMNGLIPASVICEIINDDGTMARMPELMK 181

Query: 184 FANKHNLKIGKIEDLIAYRXXXXXXXXXXXQSDIKVKNQKYKIRIYENLLDGSEHFALIK 243
           FA +H LKIG I DLI YR            + ++    +++  +Y + L G  H AL+K
Sbjct: 182 FAEEHKLKIGTIADLIEYRSRTESLLEDMGNAPVQTPWGEFQQHVYVDKLSGETHLALVK 241

Query: 244 GNIKKGIIPRVRVISSNVVQNYL-INQQLPNSFDKTLNYFKKFNNCVLVFIKDT--NLKS 300
           G         VRV     V +++  N +   S  K L + ++  + V++ +  T      
Sbjct: 242 GTPAADTETLVRVHEPFSVMDFIQANPRHSWSLPKALEHIQQAESGVVILLHRTEDGASL 301

Query: 301 VTQTLKDYKNKNFYKKGNDKLIRNYGIGAQIIKDLKIKNMILITKSLKKVIGLEGYDIKI 360
           + +TL   K  N   K + K   +YGIGAQI+  L +K + ++ +      GL G+ +++
Sbjct: 302 LDRTLP--KGANQAYKWDSK---SYGIGAQILAGLNVKKLRVLGQP-SSFTGLTGFGLEV 355


>RIBBA_PROVI RecName: Full=Riboflavin biosynthesis protein
           ribBA;Includes:  RecName: Full=3,4-dihydroxy-2-butanone
           4-phosphate synthase;
          Length = 410

 Score =  212 bits (539), Expect = 5e-57
 Identities = 130/378 (34%), Positives = 205/378 (54%), Gaps = 18/378 (4%)

Query: 1   MKKNNYASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLIC 60
           M+     +IES +    +G + I++DDE+RENEGD I +    + + INF+ K  RGL+C
Sbjct: 1   MENKRIDTIESALEDIGQGKLVIVIDDEERENEGDFIAAADKVTTEMINFITKEARGLLC 60

Query: 61  LALDSVQAKRLNLSLMSPINQSRNKTAFTISIEA-KKGITTGISAKDRXXXXXXXXXXXX 119
           +A+   +AK L L  M   N S+++T FT+S++A  +G+TTGIS  DR            
Sbjct: 61  VAVTMDRAKELQLEPMVQRNTSQHETNFTVSVDAIAEGVTTGISVYDRAMTIKMLGDETS 120

Query: 120 XXXDIVSPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQ 179
                  PGH+FP+ A DGGVL R GHTEA+VD+++LA  +   ++CEI++EDG+MA+  
Sbjct: 121 HADSFSRPGHIFPLRAMDGGVLRRVGHTEAAVDLARLAGCSPVGLLCEILHEDGSMARLA 180

Query: 180 DLFDFANKHNLKIGKIEDLIAYRXXXXXXXXXXXQSDIKVKNQKYKIRIYENLLDGSEHF 239
           DL     K  LK+  I+DL+A++           +S+I     ++++  YE+  D   H 
Sbjct: 181 DLMTIKEKFGLKLITIKDLVAFQMRRSKLVQRAVESNIPTAYGEFRLMAYESFTDQQNHM 240

Query: 240 ALIKGNIKKGIIPRVRVISSNVVQNYLINQQLP--NSFDKTLNYFKKFNNCVLVFI-KDT 296
           A +KG++       VRV S     +   + +    N     L   +K    VLV++ ++ 
Sbjct: 241 AFVKGDVSTDEPVLVRVHSQCATGDTFASLRCDCGNQLASALRMIEKEGRGVLVYLMQEG 300

Query: 297 NLKSVTQTLKDYKNKNFYKKGNDKL-----------IRNYGIGAQIIKDLKIKNMILITK 345
               +   LK Y   N    G D +           +R+YGIGAQI++DL ++ M L+T 
Sbjct: 301 RGIGLINKLKAY---NLQDDGFDTVEANEELGFKADLRDYGIGAQILQDLGVRKMRLMTN 357

Query: 346 SLKKVIGLEGYDIKITKQ 363
           + KKV+GLEGY ++I ++
Sbjct: 358 NPKKVVGLEGYGLEIVER 375


>RIBBA_BACCZ RecName: Full=Riboflavin biosynthesis protein
           ribBA;Includes:  RecName: Full=3,4-dihydroxy-2-butanone
           4-phosphate synthase;
          Length = 397

 Score =  212 bits (539), Expect = 5e-57
 Identities = 135/366 (36%), Positives = 199/366 (54%), Gaps = 12/366 (3%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           IE  +   K+G + I+ DDE RENEGD I      + + INFM  +GRGL+C+ +    A
Sbjct: 5   IEEALEDLKQGKVVIVCDDENRENEGDFIALAEYITPETINFMITHGRGLVCVPITEGYA 64

Query: 69  KRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPG 128
           +RL L  M   N   + TAFT+SI+     TTGISA +R               D   PG
Sbjct: 65  ERLQLEPMVSHNTDSHHTAFTVSID-HVSTTTGISAHERATTIQQLLNPASKGADFNRPG 123

Query: 129 HVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKH 188
           H+FP+IAK+GGVL RAGHTEA+VD+++L     + VICEI+NEDG MA+  DL   A + 
Sbjct: 124 HIFPLIAKEGGVLRRAGHTEAAVDLAQLCGAEPAGVICEIINEDGAMARVPDLLQCAKQF 183

Query: 189 NLKIGKIEDLIAYRXXXXXXXXXXXQSDIKVKNQKYKIRIYENLLDGSEHFALIKGNIKK 248
           ++K+  IEDLIAYR           +  +      ++   Y N LD  EH AL+KG+I  
Sbjct: 184 DIKMITIEDLIAYRRHHETLVTREVEITLPTDFGTFQAIGYSNSLDTKEHIALVKGDIST 243

Query: 249 GIIPRVRVISSNVVQNYL--INQQLPNSFDKTLNYFKKFNNCVLVFIKDTNLK-SVTQTL 305
           G    VRV S  +  +                L   ++    VL++++       +   L
Sbjct: 244 GEPVLVRVHSECLTGDVFGSCRCDCGPQLHAALAQIEREGKGVLLYMRQEGRGIGLLNKL 303

Query: 306 KDYK--NKNF-YKKGNDKL-----IRNYGIGAQIIKDLKIKNMILITKSLKKVIGLEGYD 357
           + YK   + F   + N+KL     +R+YGIGAQI+KDL ++++ L+T + +K+ GL+GYD
Sbjct: 304 RAYKLQEEGFDTVEANEKLGFPADLRDYGIGAQILKDLGLQHLRLLTNNPRKIAGLQGYD 363

Query: 358 IKITKQ 363
           + +T++
Sbjct: 364 LTVTER 369


>RIBBA_BACC1 RecName: Full=Riboflavin biosynthesis protein
           ribBA;Includes:  RecName: Full=3,4-dihydroxy-2-butanone
           4-phosphate synthase;
          Length = 397

 Score =  211 bits (538), Expect = 6e-57
 Identities = 135/366 (36%), Positives = 199/366 (54%), Gaps = 12/366 (3%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           IE  +   K+G + I+ DDE RENEGD I      + + INFM  +GRGL+C+ +    A
Sbjct: 5   IEEALEDLKQGKVVIVCDDENRENEGDFIALAEYITPETINFMITHGRGLVCVPITEGYA 64

Query: 69  KRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPG 128
           +RL L  M   N   + TAFT+SI+     TTGISA +R               D   PG
Sbjct: 65  ERLQLEPMVAHNTDSHHTAFTVSID-HVSTTTGISAHERATTIREMLNPASKGADFNRPG 123

Query: 129 HVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKH 188
           H+FP+IAK+GGVL RAGHTEA+VD+++L     + VICEI+NEDGTMA+  DL   A + 
Sbjct: 124 HIFPLIAKEGGVLRRAGHTEAAVDLAQLCGAEPAGVICEIINEDGTMARVPDLLQCAKQF 183

Query: 189 NLKIGKIEDLIAYRXXXXXXXXXXXQSDIKVKNQKYKIRIYENLLDGSEHFALIKGNIKK 248
           ++K+  IEDLIAYR           +  +      +    Y N LD  EH AL+KG+I  
Sbjct: 184 DIKMITIEDLIAYRRHHETLVTREVEITLPTDFGTFHAIGYSNSLDTKEHIALVKGDIST 243

Query: 249 GIIPRVRVISSNVVQNYL--INQQLPNSFDKTLNYFKKFNNCVLVFIKDTNLK-SVTQTL 305
           G    VRV S  +  +                L   ++    VL++++       +   L
Sbjct: 244 GEPVLVRVHSECLTGDVFGSCRCDCGPQLHAALAQIEREGKGVLLYMRQEGRGIGLLNKL 303

Query: 306 KDYK--NKNF-YKKGNDKL-----IRNYGIGAQIIKDLKIKNMILITKSLKKVIGLEGYD 357
           + YK   + F   + N+KL     +R+YGIGAQI+KDL ++++ L+T + +K+ GL+GYD
Sbjct: 304 RAYKLQEEGFDTVEANEKLGFPADLRDYGIGAQILKDLGLQHLRLLTNNPRKIAGLQGYD 363

Query: 358 IKITKQ 363
           +++ ++
Sbjct: 364 LEVIER 369


>RIBB_NEIMA RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 363

 Score =  211 bits (537), Expect = 8e-57
 Identities = 132/360 (36%), Positives = 198/360 (55%), Gaps = 9/360 (2%)

Query: 4   NNYASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLAL 63
           ++ + I  I+   K G M I+ D E RENEGDL+++    + + INFM K+ RGL+CL +
Sbjct: 2   SHISPIPEILADIKVGKMVIITDAEDRENEGDLLMAAQFVTPEAINFMIKHARGLVCLPM 61

Query: 64  DSVQAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXD 123
           D    ++L L +M+  N ++  T FT+SIEA  GITTGISA DR               D
Sbjct: 62  DGEMVEKLGLPMMTQKNGAQYGTNFTVSIEAAHGITTGISAADRALTIQTAVSPTAKPED 121

Query: 124 IVSPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFD 183
           IV PGH+FP+ A+ GGVLVRAGHTEA VD++++     +AVICEI+N+DGTMA+  +L  
Sbjct: 122 IVQPGHIFPLRAQKGGVLVRAGHTEAGVDLAQMNGLIPAAVICEIINDDGTMARMPELMK 181

Query: 184 FANKHNLKIGKIEDLIAYRXXXXXXXXXXXQSDIKVKNQKYKIRIYENLLDGSEHFALIK 243
           FA +H LKIG I DLI YR            + ++    +++  +Y + L G  H AL+K
Sbjct: 182 FAEEHKLKIGTITDLIEYRSRTESLLEDMGNAPVQTPWGEFQQHVYVDKLSGETHLALVK 241

Query: 244 GNIKKGIIPRVRVISSNVVQNYL-INQQLPNSFDKTLNYFKKFNNCVLVFIKDT--NLKS 300
           G         VRV     V +++  N +   S  K L   ++  + V++ +  T      
Sbjct: 242 GTPSADTETLVRVHEPFSVMDFIQANPRHSWSLPKALERVQQAESGVVILLHRTEDGASL 301

Query: 301 VTQTLKDYKNKNFYKKGNDKLIRNYGIGAQIIKDLKIKNMILITKSLKKVIGLEGYDIKI 360
           + +TL   K  N   K + K   +YGIGAQI+  L +K + ++ +      GL G+ +++
Sbjct: 302 LDRTLP--KGANQAYKWDSK---SYGIGAQILAGLNVKKLRVLGQP-SSFTGLTGFGLEV 355


>RIBBA_BREBN RecName: Full=Riboflavin biosynthesis protein
           ribBA;Includes:  RecName: Full=3,4-dihydroxy-2-butanone
           4-phosphate synthase;
          Length = 399

 Score =  209 bits (531), Expect = 4e-56
 Identities = 133/371 (35%), Positives = 202/371 (54%), Gaps = 16/371 (4%)

Query: 6   YASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDS 65
           + SIE  +   ++G   I+VDDE RENEGD +     ++ + INFM  +GRGL+C+ +  
Sbjct: 2   FHSIEEALEDLRQGKAVIVVDDEDRENEGDFVCMAEAATPEMINFMVTHGRGLVCVPVTE 61

Query: 66  VQAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIV 125
             A RL L+ M   N  +  TAFT+SI+ +    TGISA +R               D  
Sbjct: 62  EHATRLQLAPMVNANTDKQGTAFTVSID-EGSTNTGISAHERSQTVLAMLDEQKDADDFR 120

Query: 126 SPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFA 185
            PGH+FP+IAK GGVL RAGHTEA+VD+++LA    + VICEIMNEDG+MA+   L + A
Sbjct: 121 RPGHIFPLIAKAGGVLRRAGHTEAAVDLARLAGGIPAGVICEIMNEDGSMARLPQLVEIA 180

Query: 186 NKHNLKIGKIEDLIAYRXXXXXXXXXXXQSDIKVKNQKYKIRIYENLLDGSEHFALIKGN 245
            + +LK+  I DLIAYR           +  +      ++I  Y N LDG EH ALIKG 
Sbjct: 181 RRFDLKLITIADLIAYRMRTESMVKKEIEVQLPTAYGDFRIAAYTNELDGKEHVALIKGE 240

Query: 246 I--KKGIIPRV--RVISSNVVQNYLINQQLPNSFDKTLNYFKKFNNCVLVFIKDTNLK-S 300
           I   + I+ RV    ++ ++  +Y  +          L   +     +L++++       
Sbjct: 241 IGPDEPILVRVHSECLTGDIFGSYRCD--CGPQLHAALEQIEANGRGILLYMRQEGRGIG 298

Query: 301 VTQTLKDYKNKN---FYKKGNDKL-----IRNYGIGAQIIKDLKIKNMILITKSLKKVIG 352
           +   L+ YK +       + N+KL     +R+YGIGAQI++DL ++ M L+T + +K+ G
Sbjct: 299 LINKLRAYKLQEEGLDTVEANEKLGFAADLRDYGIGAQILRDLGVQRMRLLTNNPRKIRG 358

Query: 353 LEGYDIKITKQ 363
           L GY + + ++
Sbjct: 359 LTGYGLAVEER 369


>RIBBA_GEOSW RecName: Full=Riboflavin biosynthesis protein
           ribBA;Includes:  RecName: Full=3,4-dihydroxy-2-butanone
           4-phosphate synthase;
          Length = 397

 Score =  204 bits (519), Expect = 1e-54
 Identities = 143/366 (39%), Positives = 209/366 (57%), Gaps = 12/366 (3%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           IE  I    +G + I+ DDE RENEGD +     ++ + INFM KYGRGL+C+ +    A
Sbjct: 5   IEEAIYELMQGKVIIVCDDEDRENEGDFVALAEKATPEVINFMIKYGRGLVCVPITEELA 64

Query: 69  KRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPG 128
            +L+L+ M   N   + TAFT+SI+ K   TTGISA +R               D   PG
Sbjct: 65  DKLDLAPMVNHNTDSHGTAFTVSIDYKS-TTTGISAYERSMTIQALLDPNAKASDFKRPG 123

Query: 129 HVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKH 188
           HVFP++AK GGVL RAGHTEA+VD+++L     + VICEI+ EDGTMA+  DL   A++ 
Sbjct: 124 HVFPLVAKKGGVLRRAGHTEAAVDLARLCGAKPAGVICEIIKEDGTMARVSDLRKIADEF 183

Query: 189 NLKIGKIEDLIAYRXXXXXXXXXXXQSDIKVKNQKYKIRIYENLLDGSEHFALIKGNIKK 248
           +LK+  I+DLI Y               +  +  K+K   Y N++DG EH AL+KG I  
Sbjct: 184 DLKMITIKDLIEYXXXXXXXXXXXXXXMLPTEFGKFKAIGYTNIVDGKEHVALVKGEIIP 243

Query: 249 GIIPRVRVISSNVVQNYL--INQQLPNSFDKTLNYFKKFNNCVLVFIKDTNLK-SVTQTL 305
                VRV S  +  +                L   ++    VL++++       +   L
Sbjct: 244 DEPTLVRVHSECLTGDVFGSCRCDCGPQLHAALRQIEEEGRGVLLYMRQEGRGIGLINKL 303

Query: 306 KDYK-NKNFYK--KGNDKL-----IRNYGIGAQIIKDLKIKNMILITKSLKKVIGLEGYD 357
           + YK  +  Y   + N++L     +R+YGIGAQI+KDL +  M L+T + +K+ GL+G+ 
Sbjct: 304 RAYKLQEQGYDTVEANERLGFPADLRDYGIGAQILKDLGVTKMRLLTNNPRKITGLKGHG 363

Query: 358 IKITKQ 363
           +++ ++
Sbjct: 364 LEVVER 369


>RIBBA_SYNY3 RecName: Full=Riboflavin biosynthesis protein
           ribBA;Includes:  RecName: Full=3,4-dihydroxy-2-butanone
           4-phosphate synthase;
          Length = 556

 Score =  203 bits (517), Expect = 2e-54
 Identities = 130/351 (37%), Positives = 198/351 (56%), Gaps = 15/351 (4%)

Query: 28  EKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQAKRLNLSLMSPINQSRNKTA 87
           E RENEGDLI +   ++   +NFMA   RGLICLA+   +   L+L LM   N   N+TA
Sbjct: 24  ENRENEGDLICAAQFATPALVNFMAVEARGLICLAMTGDRLDELDLPLMVSKNTDSNQTA 83

Query: 88  FTISIEAKK--GITTGISAKDRXXXXXXXXXXXXXXXDIVSPGHVFPIIAKDGGVLVRAG 145
           FT+SI+A    G+TTGISA+DR               D+  PGH+FP+ AK GGVL RAG
Sbjct: 84  FTVSIDAAPHLGVTTGISAEDRARTIQIAINPVTRPEDLSRPGHIFPLRAKTGGVLKRAG 143

Query: 146 HTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKHNLKIGKIEDLIAYRXXX 205
           HTEA+VD+S+LA    + VICEI N DG+MA+  +L ++A K++LK+  I DLI+YR   
Sbjct: 144 HTEAAVDLSRLAGLYPAGVICEIQNADGSMARLPELVEYARKYDLKLISIADLISYRLQH 203

Query: 206 XXXXXXXXQSDIKVKNQKYKIRIYENLLDGSEHFALIKGNIKK-GIIP-RVRVISSNVVQ 263
                     +   +  ++K+  Y NLLD +EH A++KG+  + G  P  VR+ S  +  
Sbjct: 204 DRFVQRETICEFPSQFGEFKLYAYRNLLDQTEHIAIVKGDPSEFGQQPVMVRMHSECLTG 263

Query: 264 NYL--INQQLPNSFDKTLNYFKKFNNCVLVFIKDTNLK-SVTQTLKDYKNKNF---YKKG 317
           + L  +           L   +     V+V+++       +   LK Y  ++      + 
Sbjct: 264 DALGSLRCDCRMQLQAALKMLENHGLGVVVYLRQEGRGIGLVNKLKAYSLQDLGYDTVEA 323

Query: 318 NDKL-----IRNYGIGAQIIKDLKIKNMILITKSLKKVIGLEGYDIKITKQ 363
           N++L     +R+YG+GAQ++ DL +K + LIT + +K+ GL+GY ++I ++
Sbjct: 324 NERLGFPADLRDYGMGAQMLNDLGVKQIRLITNNPRKIAGLKGYGLEIVER 374


>RIBB_DEHMU RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 356

 Score =  202 bits (515), Expect = 3e-54
 Identities = 129/355 (36%), Positives = 194/355 (54%), Gaps = 25/355 (7%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           +   I   ++G M ++VDDE RENEGDL+ + + S+ + +NFMA + +GLIC+A+    A
Sbjct: 17  VNQAIEDIRQGKMVVMVDDEDRENEGDLVYAASFSTPQKVNFMASHAKGLICVAISKKIA 76

Query: 69  KRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPG 128
            RL L  M   N S  +TAFTI+++A+    TGISA +R               ++V PG
Sbjct: 77  NRLQLEPMVKKNDSSYETAFTITVDARTA-ATGISAGERDMTIKILADGGSHESELVRPG 135

Query: 129 HVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKH 188
           H+FP+IAK+GG LVR GHTE SVD+ +LA + +SAVICEIM EDGTMA+  DL  F  KH
Sbjct: 136 HIFPLIAKEGGALVRIGHTEGSVDLCRLAGQGDSAVICEIMKEDGTMARRPDLDIFCAKH 195

Query: 189 NLKIGKIEDLIAYRXXXXXXXXXXXQSDIKVKNQKYKIRIYENLLDGSEHFALIKGNIKK 248
            L I  I D++ YR           +S  +   +  +   + +  D + H A   GNIK 
Sbjct: 196 ELNIVYISDIVEYRMMNESLIRVIAESTTQFLGKDARRYDFVDHND-NHHIAYAFGNIKN 254

Query: 249 GIIPRVRVISSNVVQNYLINQQLPNSFDKTLNYFKKFNNCVLVFIKDTNLKSVTQTLKDY 308
               +   I  +     L + +  NS  + ++Y +K +  VL+F+ D   + +++     
Sbjct: 255 RSAVKFHSIMPD--NELLADTKKYNSLIQAIHYLQK-SGGVLIFM-DNGTQDMSK----- 305

Query: 309 KNKNFYKKGNDKLIRNYGIGAQIIKDLKIKNMILITKSL-KKVIGLEGYDIKITK 362
                        IR YGIGAQIIK L I+N+ L++ S  K+ +G+ G+ + + K
Sbjct: 306 -------------IREYGIGAQIIKHLGIENIELLSDSKNKEFVGISGFGLSVIK 347


>RIBBA_CHLPN RecName: Full=Riboflavin biosynthesis protein
           ribBA;Includes:  RecName: Full=3,4-dihydroxy-2-butanone
           4-phosphate synthase;
          Length = 418

 Score =  202 bits (513), Expect = 5e-54
 Identities = 121/371 (32%), Positives = 197/371 (53%), Gaps = 12/371 (3%)

Query: 5   NYASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALD 64
           N+ S+E  I   + G   I+VD+  RE+EGDLII+    + + + F+ ++  G++C AL 
Sbjct: 12  NFVSLERAIEDLRAGKFVIVVDEASREDEGDLIIAGEKITVEKMTFLLQHTTGVVCAALS 71

Query: 65  SVQAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDI 124
             +   L+L  M   N+ R KT FT+S++A  G+TTG+SA DR               D 
Sbjct: 72  QERLLSLDLPPMVKDNRCRFKTPFTVSVDAAHGVTTGVSAADRTKVVQLLADPKSKPEDF 131

Query: 125 VSPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDF 184
           +SPGH FP+ +  GGVL RAGHTE++VD+ +LA      V+ E++NED +M +   + +F
Sbjct: 132 ISPGHFFPLASSPGGVLKRAGHTESTVDLMELAGLQPCGVLAELVNEDYSMMRLPQILEF 191

Query: 185 ANKHNLKIGKIEDLIAYRXXXXXXXXXXXQSDIKVKNQKYKIRIYENLLDGSEHFALIKG 244
           A KHN+ +  +  +IA+R            + +      + I +YE+LL+G +H AL+KG
Sbjct: 192 ARKHNIAVIPVTSIIAHRMLSDRLVSKISSARLPTIYGDFTIHVYESLLEGMQHLALVKG 251

Query: 245 NIKKGIIPRVRVISSNVVQNYLINQQLP--NSFDKTLNYFKKFNNCVLVFIKDTNLKSV- 301
           N+       VRV S  V  + L +++          ++Y  +    VLV+++    + + 
Sbjct: 252 NVAGKSNVLVRVHSECVTGDILGSKRCDCGEQLSSAMSYIAEKGTGVLVYLRGQEGRGIG 311

Query: 302 -TQTLKDYK-NKNFYKKGNDKLI-------RNYGIGAQIIKDLKIKNMILITKSLKKVIG 352
               ++ Y    N Y   +  L        R YGIGAQI+ DLK+  + LIT + +K  G
Sbjct: 312 LGHKVRAYALQDNGYDTVDANLAMGFPVDSREYGIGAQILVDLKLTTIKLITHNPQKYFG 371

Query: 353 LEGYDIKITKQ 363
           L+G+ + IT++
Sbjct: 372 LQGFGLSITER 382


>RIBBA_PELLD RecName: Full=Riboflavin biosynthesis protein
           ribBA;Includes:  RecName: Full=3,4-dihydroxy-2-butanone
           4-phosphate synthase;
          Length = 409

 Score =  200 bits (508), Expect = 2e-53
 Identities = 124/373 (33%), Positives = 199/373 (53%), Gaps = 18/373 (4%)

Query: 6   YASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDS 65
           + +IES +   ++G + I++DDE RENEGD I +    + + INF+ +  RGL+C+A+  
Sbjct: 6   FDTIESAVEDIRQGKLVIVIDDEDRENEGDFIAAADHVTTEMINFITREARGLLCVAVTM 65

Query: 66  VQAKRLNLSLMSPINQSRNKTAFTISIEA-KKGITTGISAKDRXXXXXXXXXXXXXXXDI 124
            +A+ L L  M   N S+++T FT+S++A  +G+TTGIS  DR                 
Sbjct: 66  ERARELQLDPMVQRNTSQHETNFTVSVDAIAEGVTTGISVYDRATTIKMLGDPASHADSF 125

Query: 125 VSPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDF 184
             PGH+FP+ A DGGVL R GHTEA+VD+++LA  +   ++CEI+++DG+MA+       
Sbjct: 126 SRPGHIFPLRAMDGGVLRRVGHTEAAVDLARLAGCSPVGLLCEILHDDGSMARLPXXXXX 185

Query: 185 ANKHNLKIGKIEDLIAYRXXXXXXXXXXXQSDIKVKNQKYKIRIYENLLDGSEHFALIKG 244
                     I+DL+AYR           +S +     ++ +  YE+ +D   H A +KG
Sbjct: 186 XXXXXXXXITIKDLVAYRMQRNKLVERAVESKLPTAYGEFGLIAYESFIDHHNHMAFVKG 245

Query: 245 NIKKGIIPRVRVISSNVVQNYLINQQLP--NSFDKTLNYFKKFNNCVLVFI-KDTNLKSV 301
           ++  G    VRV S     +   + +    N     L   +K    VLV++ ++     +
Sbjct: 246 DVSSGEPVLVRVHSQCATGDTFASLRCDCGNQLASALRMIEKEGRGVLVYLMQEGRGIGL 305

Query: 302 TQTLKDYKNKNFYKKGNDKL-----------IRNYGIGAQIIKDLKIKNMILITKSLKKV 350
              LK Y   N   +G D +           +R+YGIGAQI++DL ++ M L+T + KKV
Sbjct: 306 INKLKAY---NLQDEGFDTVEANEQLGFKADLRDYGIGAQILQDLGVRKMRLLTNNPKKV 362

Query: 351 IGLEGYDIKITKQ 363
           IGLEGY ++I ++
Sbjct: 363 IGLEGYGLEIVER 375


>RIBBA_CHLMU RecName: Full=Riboflavin biosynthesis protein
           ribBA;Includes:  RecName: Full=3,4-dihydroxy-2-butanone
           4-phosphate synthase;
          Length = 424

 Score =  199 bits (507), Expect = 2e-53
 Identities = 120/375 (32%), Positives = 197/375 (52%), Gaps = 18/375 (4%)

Query: 7   ASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSV 66
           AS++  I     G   I++D E RENEGDLI++    SA+ + F+  +  G++C ++   
Sbjct: 9   ASVQQAIKDIADGNFVIVIDRESRENEGDLILAGEKVSAEKMAFLLSHTTGIVCASVTRE 68

Query: 67  QAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVS 126
           QA+ L+L  M   NQ   KTAFT+S++A  GITTG+SA DR                 V 
Sbjct: 69  QARVLDLPAMVQENQCAFKTAFTVSVDASSGITTGVSAADRTRTVQLLSDPTSISQSFVR 128

Query: 127 PGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFAN 186
           PGHVFP++++ GGV+ R GHTEAS+D+ +LA      +  E++N D +M + Q + DFA 
Sbjct: 129 PGHVFPLVSQPGGVVKRPGHTEASMDLMRLAGMYPCGIFAELVNADHSMMRQQQILDFAE 188

Query: 187 KHNLKIGKIEDLIAYRXXXXXXXXXXXQSDIKVKNQKYKIRIYENLLDGSEHFALIKGNI 246
           +H   +  ++DLI YR            + I  K  ++ I +Y++++DG+EHFAL+KG+I
Sbjct: 189 QHGFTVITVDDLITYRWTFDSLVEHVSSARIPTKYGEFFIHVYKSIIDGTEHFALVKGDI 248

Query: 247 KKGIIPRVRVISSNVVQNYL--INQQLPNSFDKTLNYFKKFNNCVLVFIKDTNLKSV--T 302
           ++     VRV S  +  + L           D  + Y  +    V+V+++    + +   
Sbjct: 249 REQESVPVRVHSECLTGDVLGSCRCDCGAQLDMAMRYIAEQGLGVIVYLRGQEGRGIGFG 308

Query: 303 QTLKDYKNKNFYKKGNDKL-----------IRNYGIGAQIIKDLKIKNMILITKSLKKVI 351
             ++ Y  ++    G D +            R YG+ AQI+KDL++ ++ LIT + KK  
Sbjct: 309 HKIQAYALQDL---GYDTVEANLQLSFPIDAREYGVAAQILKDLRLTSVRLITHNPKKFF 365

Query: 352 GLEGYDIKITKQEII 366
            L+   I I  + ++
Sbjct: 366 ELQRLGIHILDRIVL 380


>RIBBA_CLONN RecName: Full=Riboflavin biosynthesis protein
           ribBA;Includes:  RecName: Full=3,4-dihydroxy-2-butanone
           4-phosphate synthase;
          Length = 414

 Score =  199 bits (506), Expect = 3e-53
 Identities = 131/370 (35%), Positives = 191/370 (51%), Gaps = 18/370 (4%)

Query: 1   MKKNNYASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLIC 60
           M++  + +IE  I   K G M              L+++    + + INFMAKY RGLIC
Sbjct: 1   MEQFKFNTIEEAIEDIKNGKMXXXXXXXXXXXXXXLLMAAEKVTPEAINFMAKYARGLIC 60

Query: 61  LALDSVQAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXX 120
           + +   + K L+L  M   N    +TAFT+SI++ +  TTGISA +R             
Sbjct: 61  MPMTEEKLKELDLYQMVINNTDTKETAFTVSIDSVE-TTTGISAFERALTITKAVEKGAK 119

Query: 121 XXDIVSPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQD 180
             D   PGH+FP+ A+ GGVL RAGHTEA+VD++ LA    +  ICEIMNEDGTMA+  D
Sbjct: 120 AKDFQRPGHIFPLRARKGGVLKRAGHTEAAVDLATLAGLTPAGTICEIMNEDGTMARVPD 179

Query: 181 LFDFANKHNLKIGKIEDLIAYRXXXXXXXXXXXQSDIKVKNQKYKIRIYENLLDGSEHFA 240
           L  +   HNLKI  I DLI YR            + +  K  +++I  YE+ L G EH A
Sbjct: 180 LMKYVKVHNLKIVTIADLIEYRRKTESFIERQGSASLPTKYGEFEIIGYEDKLTGKEHVA 239

Query: 241 LIKGNIKKGIIPRVRVISSNVVQNYL--INQQLPNSFDKTLNYFKKFNNCVLVFIKDTNL 298
           L+KG+IK G    +RV S  +  + L  +     +   + L    K     L++++    
Sbjct: 240 LVKGDIKNGEPVLIRVHSECLTGDVLGSLRCDCGDQLAQALRQINKEGRGALLYMRQEGR 299

Query: 299 K-SVTQTLKDYKNKNFYKKGNDKL-----------IRNYGIGAQIIKDLKIKNMILITKS 346
              +   +K YK ++    G D +           +R+YGIGAQI+KDL ++ + L+T +
Sbjct: 300 GIGLINKIKAYKLQD---NGMDTVDANLALGFPEDLRDYGIGAQILKDLGVEKVRLMTNN 356

Query: 347 LKKVIGLEGY 356
            KKV G+ GY
Sbjct: 357 PKKVSGISGY 366


>RIBB_WOLSU RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 347

 Score =  197 bits (502), Expect = 9e-53
 Identities = 121/359 (33%), Positives = 199/359 (55%), Gaps = 25/359 (6%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           +   I   KKG M I++DDE RENEGDL+ +   S+ + +NFM    +GL+C+ + S  +
Sbjct: 6   VREAIEAIKKGEMIIMMDDEDRENEGDLVYAAAFSTPEKVNFMVSEAKGLVCVCVTSTCS 65

Query: 69  KRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPG 128
            RL L+ M   N S+++TAFT+SI+A++  +TGISA +R               D V PG
Sbjct: 66  DRLGLAPMVRENNSQHETAFTVSIDARE-CSTGISAFERDLTIRKMVDGTSKPEDFVRPG 124

Query: 129 HVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKH 188
           H+FP+IAK+GGVLVR GHTE SVDI KLA     AVICEI+ +DG MA+  DL +FA +H
Sbjct: 125 HIFPLIAKEGGVLVRTGHTEGSVDICKLAGVAPVAVICEIIKKDGHMARRDDLMEFAKEH 184

Query: 189 NLKIGKIEDLIAYRXXXXXXXXXXXQSDIKVKNQKYKIRIYENLLDGSEHFALIKGNIKK 248
           +LKI  I DLI YR           +S+++   ++ +  ++++     EH     G I  
Sbjct: 185 HLKIVYISDLIEYRMQNEMLILIKERSEVEFLGKRAERYVFQD-HHRREHTLYAFGKIID 243

Query: 249 GIIPRVRVISSNVVQNYLINQQLPNSFDKTLNYFKKFNNCVLVFIKDTNLKSVTQTLKDY 308
             + +   +  ++  + L +++  ++  + +   ++ N   L+   DT   +  Q     
Sbjct: 244 NSLVKYHTVGKDL--SLLESEKKYSTLMQAIKKIQEENG--LIIFMDTPQNAAPQ----- 294

Query: 309 KNKNFYKKGNDKLIRNYGIGAQIIKDLKIKNMILIT-KSLKKVIGLEGYDIKITKQEII 366
                        I+++GIGAQ+++ L IKN  L+T +  ++ +GL G+ + +T++ ++
Sbjct: 295 -------------IKDFGIGAQMLRFLGIKNFRLLTSEENREYVGLSGFGLNVTEKIVL 340


>RIBBA_CYTH3 RecName: Full=Riboflavin biosynthesis protein
           ribBA;Includes:  RecName: Full=3,4-dihydroxy-2-butanone
           4-phosphate synthase;
          Length = 405

 Score =  195 bits (495), Expect = 6e-52
 Identities = 132/377 (35%), Positives = 190/377 (50%), Gaps = 18/377 (4%)

Query: 1   MKKNNYASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLIC 60
           M++    SI   I   +KG + I+VDDE RENEGD I +    + + INFM+K GRGLIC
Sbjct: 1   MEQIKLDSIADAIEAIRKGEVIIVVDDEDRENEGDFICAAECVTPEIINFMSKEGRGLIC 60

Query: 61  LALDSVQAKRLNLSLMSPINQSRNKTAFTISIEAK-KGITTGISAKDRXXXXXXXXXXXX 119
             +   +   L L LM   N + ++T FT+S++    G TTGISA DR            
Sbjct: 61  APISEARCTELKLDLMVGSNTATHETPFTVSVDLLGNGCTTGISASDRSKTIRALVDPDT 120

Query: 120 XXXDIVSPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQ 179
              D+  PGH+FP+ AKD GVL R GHTEA+VD+++LA    + V+ EIM+EDG+MA+  
Sbjct: 121 KPEDLGRPGHIFPLKAKDEGVLRRVGHTEAAVDLARLAGFKPAGVLIEIMSEDGSMARLP 180

Query: 180 DLFDFANKHNLKIGKIEDLIAYRXXXXXXXXXXXQSDIKVKNQKYKIRIYENLLDGSEHF 239
           +L   A K NLK+  I+DLI YR             D+      + +  +  +  G  H 
Sbjct: 181 ELKQIATKFNLKLISIKDLIEYRLTHESLVKREIGVDMPTNLGDFDLIAFRQISTGEVHL 240

Query: 240 ALIKGNIKKGIIPRVRVISSNVVQNYL--INQQLPNSFDKTLNYFKKFNNCVLVFIKDTN 297
           ALIKG  +K     VRV SS V  +              K +   ++    V++++    
Sbjct: 241 ALIKGTWEKDEPVMVRVHSSCVTGDIFGSCRCDCGPQLHKAMEMIQQEGKGVILYMNQEG 300

Query: 298 LK-SVTQTLKDYKNKNFYKKGNDKL-----------IRNYGIGAQIIKDLKIKNMILITK 345
               +   LK YK     ++G D +            R+YG GAQI++DL I  + LIT 
Sbjct: 301 RGIGLLNKLKAYK---LQEQGRDTVEANLELGFKMDQRDYGTGAQILRDLNISKLRLITN 357

Query: 346 SLKKVIGLEGYDIKITK 362
           +  K   L GY ++IT+
Sbjct: 358 NPVKRAALAGYGLEITE 374


>RIBBA_CHLTR RecName: Full=Riboflavin biosynthesis protein
           ribBA;Includes:  RecName: Full=3,4-dihydroxy-2-butanone
           4-phosphate synthase;
          Length = 424

 Score =  195 bits (495), Expect = 6e-52
 Identities = 115/372 (30%), Positives = 195/372 (52%), Gaps = 12/372 (3%)

Query: 7   ASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSV 66
           AS++  I    +G   I++D   RENEGDLI++    S + ++F+  +  G++C +L   
Sbjct: 9   ASVQQAIKDVAEGKFVIVIDAASRENEGDLILAGEKVSTEKMSFLLSHTTGIVCASLSRE 68

Query: 67  QAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVS 126
           QAK L+L  M   NQ   KTAFT+S++A  G+TTG+SA DR                 V 
Sbjct: 69  QAKSLDLPAMVQDNQCAFKTAFTVSVDASSGVTTGVSASDRTRTVQLLADPAATAESFVR 128

Query: 127 PGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFAN 186
           PGHVFP+I++ GG + R GHTEA++D+ +LA      +  E++N D +M + Q +  FA 
Sbjct: 129 PGHVFPLISQPGGAVQRPGHTEAAMDLMRLAGMQPCGIFAELVNPDHSMMRQQQVLAFAE 188

Query: 187 KHNLKIGKIEDLIAYRXXXXXXXXXXXQSDIKVKNQKYKIRIYENLLDGSEHFALIKGNI 246
           +H+L +  ++DLI YR            + +  K   + I +YE+++DG++HFAL+KG+I
Sbjct: 189 QHDLTVITVDDLITYRYTYDSLVTKISSARLPTKYGDFSIHVYESIIDGTQHFALVKGDI 248

Query: 247 KKGIIPRVRVISSNVVQNYL--INQQLPNSFDKTLNYFKKFNNCVLVFIKDTNLKSV--T 302
            +     VRV S  +  + L           D  + Y  +    V+V+++    + +   
Sbjct: 249 HEQEAVPVRVHSECLTGDILGSCRCDCGAQLDMAMRYIAEEGLGVIVYLRGQEGRGIGFG 308

Query: 303 QTLKDYKNKNF-YKKGNDKL-------IRNYGIGAQIIKDLKIKNMILITKSLKKVIGLE 354
             ++ Y  ++  Y   +  L        R YG+ AQ++KDL++ ++ LIT + +K   L+
Sbjct: 309 HKIRAYALQDLGYDTVDANLQLGFPIDAREYGMAAQVLKDLQLTSVRLITHNPRKFFELQ 368

Query: 355 GYDIKITKQEII 366
              I +  + I+
Sbjct: 369 RLGIHVLDRIIL 380


>RIBBA_BACCN RecName: Full=Riboflavin biosynthesis protein
           ribBA;Includes:  RecName: Full=3,4-dihydroxy-2-butanone
           4-phosphate synthase;
          Length = 397

 Score =  195 bits (495), Expect = 6e-52
 Identities = 130/366 (35%), Positives = 186/366 (50%), Gaps = 12/366 (3%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           IE  +   K+G + I+ DD+ RENEGD +      + + INFM  +GRGL+C+ L    A
Sbjct: 5   IEEALEDLKQGKVIIVCDDKNRENEGDFLALAEYITPETINFMITHGRGLVCVPLPEHYA 64

Query: 69  KRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPG 128
           KRL L  M   N   + TAFT+SI+     TTGISA +R               D   PG
Sbjct: 65  KRLQLEPMVSQNTDSHHTAFTVSID-HISTTTGISAHERATTVRELLNPSSKGSDFNRPG 123

Query: 129 HVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKH 188
           H+FP+IAKDGGVL RAGHTEA+VD++KL       VICEI+ EDGTMA+  DL   A + 
Sbjct: 124 HIFPLIAKDGGVLRRAGHTEAAVDLAKLCGTEPVGVICEIIKEDGTMARVPDLIQVAKQF 183

Query: 189 NLKIGKIEDLIAYRXXXXXXXXXXXQSDIKVKNQKYKIRIYENLLDGSEHFALIKGNIKK 248
           ++K+  IEDLIAYR           +  +  +   +    Y N LD  EH ALIKG++  
Sbjct: 184 DIKMITIEDLIAYRRHHETFVTKEVEITLPTEFGTFHAIGYTNSLDQKEHIALIKGDVST 243

Query: 249 GIIPRVRVISSNVVQNYL--INQQLPNSFDKTLNYFKKFNNCVLVFIKDTNLK-SVTQTL 305
                VRV S  +  +                L   ++    VL++++       +   L
Sbjct: 244 DEPVLVRVHSECLTGDVFGSCRCDCGPQLHAALTQIEREGRGVLLYMRQEGRGIGLLNKL 303

Query: 306 KDYKNKN---FYKKGNDKL-----IRNYGIGAQIIKDLKIKNMILITKSLKKVIGLEGYD 357
           + YK +       + N+KL     +R+YGIGAQI            T + +K+ GL+GY+
Sbjct: 304 RAYKLQEEGLDTVEANEKLGFPADLRDYGIGAQIXXXXXXXXXXXXTNNPRKIAGLQGYE 363

Query: 358 IKITKQ 363
           ++I ++
Sbjct: 364 LEIVER 369


>RIBB_HELPY RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 344

 Score =  194 bits (493), Expect = 1e-51
 Identities = 133/353 (37%), Positives = 189/353 (53%), Gaps = 33/353 (9%)

Query: 17  KKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQAKRLNLSLM 76
           K G M I++DDE RENEGDL+++   S+ + INFMA + RGLIC++L    AK+  L  M
Sbjct: 14  KNGEMLIVMDDEDRENEGDLVLAGIFSTPEKINFMATHARGLICVSLTKDLAKKFELPPM 73

Query: 77  SPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPGHVFPIIAK 136
             +N S ++TAFT+SI+AK+   TGISA +R               D V PGH+FP+IAK
Sbjct: 74  VSVNDSNHETAFTVSIDAKEA-RTGISAFERHLTIELLCKDTTKPSDFVRPGHIFPLIAK 132

Query: 137 DGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLF--DFANKHNLKIGK 194
           DGGVL R GHTEASVD+ KLA     +VICEIM EDG+MA+  D F  DFA KHNLK   
Sbjct: 133 DGGVLARTGHTEASVDLCKLAGLKPVSVICEIMKEDGSMARRGDKFLSDFALKHNLKTLY 192

Query: 195 IEDLIAYRXXXXXXXXXXXQSD---IKVKNQKYKIRIYENLLDGSEHFAL-IKGNIKKGI 250
           + DLI+YR           Q +   +K + Q Y    ++       H+A   KG     +
Sbjct: 193 VSDLISYRLENESLLKMFCQEEREFLKHQTQCYTFLDHQQ----KNHYAFKFKGAKTHDL 248

Query: 251 IPRVRVISSNVVQNYLINQQLPNSFDKTLNYFKKFNNCVLVFIKDTNLKSVTQTLKDYKN 310
            P VR        ++L        F K L Y  K     L+F+                 
Sbjct: 249 APLVRFHPIKEDFDFLTTDAF-EVFFKALEYL-KHEGGYLIFM----------------- 289

Query: 311 KNFYKKGNDKLIRNYGIGAQIIKDLKIKNMILITK-SLKKVIGLEGYDIKITK 362
            N + K N+ +++++GIGA ++K+L IK+  L++    ++   L G+ +K+ +
Sbjct: 290 -NTHSKENN-VVKDFGIGALVLKNLGIKDFRLLSSCEDRQYKALSGFGLKLVE 340


>RIBBA_SALTO RecName: Full=Riboflavin biosynthesis protein
           ribBA;Includes:  RecName: Full=3,4-dihydroxy-2-butanone
           4-phosphate synthase;
          Length = 400

 Score =  192 bits (489), Expect = 3e-51
 Identities = 115/371 (30%), Positives = 190/371 (51%), Gaps = 14/371 (3%)

Query: 6   YASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDS 65
           + +IE  +     G   ++VDD  RENEGDLI +   ++ + + FM +Y  G IC +L  
Sbjct: 4   FGTIEQAMAEILAGRPVVVVDDANRENEGDLIFAAELATPELVAFMVRYTSGYICASLTE 63

Query: 66  VQAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIV 125
               RL+L  M   NQ R  TA+ ++++A+KG++TGISA DR               D+ 
Sbjct: 64  DDCDRLDLPPMHHTNQDRRGTAYMVTVDARKGVSTGISAADRARVIRLLADPSTTPDDLA 123

Query: 126 SPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFA 185
            PGHV P+ A++GGVL R GHTEA+ D+++LA    + V+CE++N+DGTM +  DL  F 
Sbjct: 124 RPGHVVPLRAREGGVLRRTGHTEAATDLTRLAGLRPAGVLCELVNDDGTMMRVPDLERFC 183

Query: 186 NKHNLKIGKIEDLIAYRXXXXXXXXXXXQSDIKVKNQKYKIRIYENLLDGSEHFALIKGN 245
            +H+L +  I DL+ YR           ++ +  ++  +++  Y    D +EH AL+ G+
Sbjct: 184 AEHSLVLVTIADLVMYRRRTEKQVELVAEARLPTRHGDFRVAGYRGDYDSAEHVALVMGD 243

Query: 246 IKKGIIPRVRVISSNVVQNYL--INQQLPNSFDKTLNYFKKFNNCVLVFIKDTNLKSVTQ 303
           +  G    VR  S  +  +    +        D  +    K    V+++I+    + +  
Sbjct: 244 LGDGRDVLVRAHSECLTGDVFGSLRCDCGLQLDTAMELVAKEGRGVVLYIRGHEGRGI-G 302

Query: 304 TLKDYKNKNFYKKGNDKL-----------IRNYGIGAQIIKDLKIKNMILITKSLKKVIG 352
            L   +      KG D +            R+YG GAQ++ DL +++M L+T +  K  G
Sbjct: 303 LLHKLRAYQLQDKGRDTVEANLELGLPVDARDYGTGAQVLYDLGVRSMRLLTNNPAKRAG 362

Query: 353 LEGYDIKITKQ 363
           LEGY + +T++
Sbjct: 363 LEGYGLTVTER 373


>RIBB_HELPJ RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 344

 Score =  192 bits (488), Expect = 4e-51
 Identities = 130/353 (36%), Positives = 190/353 (53%), Gaps = 33/353 (9%)

Query: 17  KKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQAKRLNLSLM 76
           K G M I++DDE RENEGDL+++   S+ + INFMA + RGLIC++L    A +  L  M
Sbjct: 14  KNGEMLIVMDDEDRENEGDLVLAGIFSTPEKINFMATHARGLICVSLTKDLANKFELPPM 73

Query: 77  SPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPGHVFPIIAK 136
             +N S ++TAFT+SI+AK+   TGISA +R               D V PGH+FP+IAK
Sbjct: 74  VSVNDSNHETAFTVSIDAKEA-KTGISAFERHLTIELLCKDTTKPSDFVRPGHIFPLIAK 132

Query: 137 DGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLF--DFANKHNLKIGK 194
           DGGVL R GHTEASVD+ KLA     +VICEIM EDG+MA+  D F  DFA KHNLK   
Sbjct: 133 DGGVLARTGHTEASVDLCKLAGLKPVSVICEIMKEDGSMARRGDKFLSDFAIKHNLKTLY 192

Query: 195 IEDLIAYRXXXXXXXXXXXQSD---IKVKNQKYKIRIYENLLDGSEHFAL-IKGNIKKGI 250
           + DLI+YR           Q +   +K + Q Y    ++       H+A   KG     +
Sbjct: 193 VSDLISYRLENESLLKMFCQEEREFLKHQTQCYTFLDHQQ----KNHYAFKFKGAKTHDL 248

Query: 251 IPRVRVISSNVVQNYLINQQLPNSFDKTLNYFKKFNNCVLVFIKDTNLKSVTQTLKDYKN 310
            P VR        ++L       +F K L Y K+     L+F+                 
Sbjct: 249 APLVRFHPIKEDFDFLTTGAF-EAFFKALEYLKR-EGGYLIFM----------------- 289

Query: 311 KNFYKKGNDKLIRNYGIGAQIIKDLKIKNMILITK-SLKKVIGLEGYDIKITK 362
            N + + N+ +++++GIGA ++K+L +K+  L++    ++   L G+ +K+ +
Sbjct: 290 -NTHSEQNN-IVKDFGIGALVLKNLGVKDFRLLSSCEDRQYKALSGFGLKLVE 340


>RIBBA_STAES RecName: Full=Riboflavin biosynthesis protein
           ribBA;Includes:  RecName: Full=3,4-dihydroxy-2-butanone
           4-phosphate synthase;
          Length = 393

 Score =  192 bits (488), Expect = 4e-51
 Identities = 125/365 (34%), Positives = 189/365 (51%), Gaps = 13/365 (3%)

Query: 6   YASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDS 65
           + +IE  I   + G   I+VDDE RENEGDL+  T       INFMAK GRGLIC  +D 
Sbjct: 3   FDTIELAIEALRNGESIIVVDDEDRENEGDLVAVTEWMDDNTINFMAKEGRGLICAPIDK 62

Query: 66  VQAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIV 125
             A+RL L  M   N     T FT+SI+  K  TTGISA +R               D  
Sbjct: 63  SIAERLKLQSMEQNNTDIYGTHFTVSIDHYK-TTTGISAHERTQTARALIDENTNPEDFH 121

Query: 126 SPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFA 185
            PGH+FP+IAK+ GVL R GHTEA+VD+++L     + VICEIMN+DGTMAKG+DL  F 
Sbjct: 122 RPGHLFPLIAKENGVLTRNGHTEAAVDLARLTGAQPAGVICEIMNDDGTMAKGEDLQSFK 181

Query: 186 NKHNLKIGKIEDLIAYRXXXXXXXXXXXQSDIKVKNQKYKIRIYENLLDGSEHFALIKGN 245
            +H+LK+  I+ L+A+R           +  +      + +  +       E  A++KG+
Sbjct: 182 ERHHLKMITIKSLVAFRKAVELNVNLKAKVKMPTDFGHFDMYGFTTDYSDEEIVAIVKGD 241

Query: 246 IKKGIIPRVRVISSNVVQNYLINQQLP--NSFDKTLNYFKKFNNCVLVFIKDTNLKSVTQ 303
           +K    P VR+ S+ +  +   +Q+       + ++ Y  +    ++   ++     +  
Sbjct: 242 LKSN--PNVRMHSACLTGDIFHSQRCDCGAQLEASMKYIDEHGGMIIYLPQEGRGIGLIN 299

Query: 304 TLKDYK--NKNF------YKKGNDKLIRNYGIGAQIIKDLKIKNMILITKSLKKVIGLEG 355
            L+ Y+   K +         G D+ +R+Y + A+I+K   I  + L++ + KK  GLE 
Sbjct: 300 KLRAYELIEKGYDTVTANLALGFDEDLRDYHVAAEILKYFDISEINLLSNNPKKFEGLED 359

Query: 356 YDIKI 360
           Y I+I
Sbjct: 360 YGIEI 364


>RIBBA_STAEQ RecName: Full=Riboflavin biosynthesis protein
           ribBA;Includes:  RecName: Full=3,4-dihydroxy-2-butanone
           4-phosphate synthase;
          Length = 393

 Score =  191 bits (486), Expect = 7e-51
 Identities = 124/365 (33%), Positives = 189/365 (51%), Gaps = 13/365 (3%)

Query: 6   YASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDS 65
           + +IE  I   + G   I+VDDE RENEGDL+  T       INFMA+ GRGLIC  +D 
Sbjct: 3   FDTIELAIEALRNGESIIVVDDEDRENEGDLVAVTEWMDDNTINFMAREGRGLICAPIDK 62

Query: 66  VQAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIV 125
             A+RL L  M   N     T FT+SI+  K  TTGISA +R               D  
Sbjct: 63  SIAERLKLQSMEQNNTDIYGTHFTVSIDHYK-TTTGISAHERTQTARALIDENTNPEDFH 121

Query: 126 SPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFA 185
            PGH+FP+IAK+ GVL R GHTEA+VD+++L     + VICEIMN+DGTMAKG+DL  F 
Sbjct: 122 RPGHLFPLIAKENGVLTRNGHTEAAVDLARLTGAQPAGVICEIMNDDGTMAKGEDLQSFK 181

Query: 186 NKHNLKIGKIEDLIAYRXXXXXXXXXXXQSDIKVKNQKYKIRIYENLLDGSEHFALIKGN 245
            +H+LK+  I+ L+A+R           +  +      + +  +       E  A++KG+
Sbjct: 182 ERHHLKMITIKSLVAFRKAVELNVNLKAKVKMPTDFGHFDMYGFTTNYSDEEIVAIVKGD 241

Query: 246 IKKGIIPRVRVISSNVVQNYLINQQLP--NSFDKTLNYFKKFNNCVLVFIKDTNLKSVTQ 303
           +K    P VR+ S+ +  +   +Q+       + ++ Y  +    ++   ++     +  
Sbjct: 242 LKSN--PNVRMHSACLTGDIFHSQRCDCGAQLEASMKYIDEHGGMIIYLPQEGRGIGLIN 299

Query: 304 TLKDYK--NKNF------YKKGNDKLIRNYGIGAQIIKDLKIKNMILITKSLKKVIGLEG 355
            L+ Y+   K +         G D+ +R+Y + A+I+K   I  + L++ + KK  GLE 
Sbjct: 300 KLRAYELIEKGYDTVTANLALGFDEDLRDYHVAAEILKYFDISEINLLSNNPKKFEGLED 359

Query: 356 YDIKI 360
           Y I+I
Sbjct: 360 YGIEI 364


>RIBBA_BACFR RecName: Full=Riboflavin biosynthesis protein
           ribBA;Includes:  RecName: Full=3,4-dihydroxy-2-butanone
           4-phosphate synthase;
          Length = 404

 Score =  191 bits (486), Expect = 7e-51
 Identities = 125/367 (34%), Positives = 190/367 (51%), Gaps = 13/367 (3%)

Query: 8   SIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQ 67
           +IE  I   K+G   I+VDDE RENEGD II+    + + +NFM  +GRG++C  +   +
Sbjct: 8   TIEEAIADFKEGNFVIVVDDEDRENEGDFIIAAEKITPEKVNFMLTHGRGVLCAPITEER 67

Query: 68  AKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSP 127
              L L +    N S  +T FT++++  +G TTG+S  DR               D+  P
Sbjct: 68  CAELELDMQVSSNTSIYETPFTVTVDLLEGCTTGVSMHDRAMTIRALADPKTKPADLGRP 127

Query: 128 GHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANK 187
           GH+ P+ A+  GVL RAGHTEASVD++KLA    +A + EI+NEDGTMA+   L + A +
Sbjct: 128 GHINPLRARSRGVLRRAGHTEASVDLAKLAGLYPAAALIEIINEDGTMARLPQLVEVARR 187

Query: 188 HNLKIGKIEDLIAYRXXXXXXXXXXXQSDIKVKNQKYKIRIYENLLDGSEHFALIKGNIK 247
             LKI  I+DLIAYR           + D+  +   +++  +    +G EH ALIKG   
Sbjct: 188 FGLKIISIKDLIAYRLQMESIVDRGVEVDMPTQFGHFRLIPFRQKSNGMEHIALIKGTWD 247

Query: 248 KGIIPRVRVISSNVVQNYL--INQQLPNSFDKTLNYFKKFNNCVLVFI----KDTNLKSV 301
                 VRV SS +  +       +      K +   +     V+V++    +   L + 
Sbjct: 248 TDEPILVRVHSSCMTGDIFGSCRCECGEQLHKAMEMIEAAGKGVIVYMNQEGRGIGLMNK 307

Query: 302 TQTLK------DYKNKNFYKKGNDKLIRNYGIGAQIIKDLKIKNMILITKSLKKVIGLEG 355
               K      D  + N +  G D   R+YG+GAQI++++ +K M L+T +  K IGLE 
Sbjct: 308 IAAYKLQEEGYDTVDANLH-LGFDADERDYGVGAQILREIGVKKMKLMTNNPVKRIGLEA 366

Query: 356 YDIKITK 362
           Y ++IT+
Sbjct: 367 YGLEITE 373


>RIBBA_BACFN RecName: Full=Riboflavin biosynthesis protein
           ribBA;Includes:  RecName: Full=3,4-dihydroxy-2-butanone
           4-phosphate synthase;
          Length = 404

 Score =  191 bits (486), Expect = 7e-51
 Identities = 125/367 (34%), Positives = 190/367 (51%), Gaps = 13/367 (3%)

Query: 8   SIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQ 67
           +IE  I   K+G   I+VDDE RENEGD II+    + + +NFM  +GRG++C  +   +
Sbjct: 8   TIEEAIADFKEGNFVIVVDDEDRENEGDFIIAAEKITPEKVNFMLTHGRGVLCAPITEER 67

Query: 68  AKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSP 127
              L L +    N S  +T FT++++  +G TTG+S  DR               D+  P
Sbjct: 68  CAELELDMQVSSNTSIYETPFTVTVDLLEGCTTGVSMHDRAMTIRALADPKTKPADLGRP 127

Query: 128 GHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANK 187
           GH+ P+ A+  GVL RAGHTEASVD++KLA    +A + EI+NEDGTMA+   L + A +
Sbjct: 128 GHINPLRARSRGVLRRAGHTEASVDLAKLAGLYPAAALIEIINEDGTMARLPQLVEVARR 187

Query: 188 HNLKIGKIEDLIAYRXXXXXXXXXXXQSDIKVKNQKYKIRIYENLLDGSEHFALIKGNIK 247
             LKI  I+DLIAYR           + D+  +   +++  +    +G EH ALIKG   
Sbjct: 188 FGLKIISIKDLIAYRLQMESIVDRGVEVDMPTQFGHFRLIPFRQKSNGMEHIALIKGTWD 247

Query: 248 KGIIPRVRVISSNVVQNYL--INQQLPNSFDKTLNYFKKFNNCVLVFI----KDTNLKSV 301
                 VRV SS +  +       +      K +   +     V+V++    +   L + 
Sbjct: 248 TDEPILVRVHSSCMTGDIFGSCRCECGEQLHKAMEMIEAAGKGVIVYMNQEGRGIGLMNK 307

Query: 302 TQTLK------DYKNKNFYKKGNDKLIRNYGIGAQIIKDLKIKNMILITKSLKKVIGLEG 355
               K      D  + N +  G D   R+YG+GAQI++++ +K M L+T +  K IGLE 
Sbjct: 308 IAAYKLQEEGYDTVDANLH-LGFDADERDYGVGAQILREIGVKKMKLMTNNPVKRIGLEA 366

Query: 356 YDIKITK 362
           Y ++IT+
Sbjct: 367 YGLEITE 373


>RIBBA_ACTPJ RecName: Full=Riboflavin biosynthesis protein
           ribBA;Includes:  RecName: Full=3,4-dihydroxy-2-butanone
           4-phosphate synthase;
          Length = 401

 Score =  191 bits (486), Expect = 7e-51
 Identities = 121/375 (32%), Positives = 196/375 (52%), Gaps = 18/375 (4%)

Query: 6   YASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDS 65
           ++ +E  I   ++G + ++ DDE RENEGD I +   ++ +NINFMA YG+GLIC  + +
Sbjct: 6   FSKVEDAIEAIRQGKIILVTDDEDRENEGDFICAAEFATPENINFMATYGKGLICTPIST 65

Query: 66  VQAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIV 125
             AK+LN   M  +NQ  ++TAFT+S++      TGISA +R               D  
Sbjct: 66  EIAKKLNFHPMVAVNQDNHETAFTVSVD-HIDTGTGISAFERSITAMKIVDDNAKATDFR 124

Query: 126 SPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFA 185
            PGH+FP+IAKDGGVLVR GHTEA+VD+++LA   ++ + CEIM +DGTM    DL  FA
Sbjct: 125 CPGHMFPLIAKDGGVLVRNGHTEATVDLARLAGLKHAGLCCEIMADDGTMMTMPDLQKFA 184

Query: 186 NKHNLKIGKIEDLIAYRXXXXXXXXXXXQSDIKVKNQKYKIRIYENLLDGSEHFALIKGN 245
            +HN+    I+ L  YR              +  K  ++    +  ++ G EH AL+KG+
Sbjct: 185 VEHNMPFITIQQLQEYRRKHDSLVKQISVVKMPTKYGEFMAHSFVEVISGKEHVALVKGD 244

Query: 246 IKKGIIPRVRVISSNVVQNYLINQQLP--NSFDKTLNYFKKFNNCVLVFIKDTNLK-SVT 302
           +  G     R+ S  +  +   +Q+      F   +   ++    V+++++       + 
Sbjct: 245 LTDGEQVLARIHSECLTGDAFGSQRCDCGQQFAAAMTQIEQEGRGVILYLRQEGRGIGLI 304

Query: 303 QTLKDYKNKNFYKKGNDKL-----------IRNYGIGAQIIKDLKIKNMILITKSLKKVI 351
             L+ Y+ ++   KG D +            R Y IGAQ+ + L +K++ L+T +  K+ 
Sbjct: 305 NKLRAYELQD---KGMDTVEANVALGFKEDEREYYIGAQMFQQLGVKSIRLLTNNPAKIE 361

Query: 352 GLEGYDIKITKQEII 366
           GL+   + I  +E I
Sbjct: 362 GLKEQGLNIVAREPI 376


>RIBBA_ACTP7 RecName: Full=Riboflavin biosynthesis protein
           ribBA;Includes:  RecName: Full=3,4-dihydroxy-2-butanone
           4-phosphate synthase;
          Length = 401

 Score =  191 bits (486), Expect = 7e-51
 Identities = 121/375 (32%), Positives = 196/375 (52%), Gaps = 18/375 (4%)

Query: 6   YASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDS 65
           ++ +E  I   ++G + ++ DDE RENEGD I +   ++ +NINFMA YG+GLIC  + +
Sbjct: 6   FSKVEDAIEAIRQGKIILVTDDEDRENEGDFICAAEFATPENINFMATYGKGLICTPIST 65

Query: 66  VQAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIV 125
             AK+LN   M  +NQ  ++TAFT+S++      TGISA +R               D  
Sbjct: 66  EIAKKLNFHPMVAVNQDNHETAFTVSVD-HIDTGTGISAFERSITAMKIVDDNAKATDFR 124

Query: 126 SPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFA 185
            PGH+FP+IAKDGGVLVR GHTEA+VD+++LA   ++ + CEIM +DGTM    DL  FA
Sbjct: 125 RPGHMFPLIAKDGGVLVRNGHTEATVDLARLAGLKHAGLCCEIMADDGTMMTMPDLQKFA 184

Query: 186 NKHNLKIGKIEDLIAYRXXXXXXXXXXXQSDIKVKNQKYKIRIYENLLDGSEHFALIKGN 245
            +HN+    I+ L  YR              +  K  ++    +  ++ G EH AL+KG+
Sbjct: 185 VEHNMPFITIQQLQEYRRKHDSLVKQISVVKMPTKYGEFMAHSFVEVISGKEHVALVKGD 244

Query: 246 IKKGIIPRVRVISSNVVQNYLINQQLP--NSFDKTLNYFKKFNNCVLVFIKDTNLK-SVT 302
           +  G     R+ S  +  +   +Q+      F   +   ++    V+++++       + 
Sbjct: 245 LTDGEQVLARIHSECLTGDAFGSQRCDCGQQFAAAMTQIEQEGRGVILYLRQEGRGIGLI 304

Query: 303 QTLKDYKNKNFYKKGNDKL-----------IRNYGIGAQIIKDLKIKNMILITKSLKKVI 351
             L+ Y+ ++   KG D +            R Y IGAQ+ + L +K++ L+T +  K+ 
Sbjct: 305 NKLRAYELQD---KGMDTVEANVALGFKEDEREYYIGAQMFQQLGVKSIRLLTNNPAKIE 361

Query: 352 GLEGYDIKITKQEII 366
           GL+   + I  +E I
Sbjct: 362 GLKEQGLNIVAREPI 376


>RIBB_CAMJE RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 339

 Score =  191 bits (485), Expect = 9e-51
 Identities = 125/358 (34%), Positives = 186/358 (51%), Gaps = 30/358 (8%)

Query: 6   YASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDS 65
           + S+E  I   + G M ++VD E RENEGDLI     S+ + +NFM K  RG++C+ALD 
Sbjct: 3   FVSVEQAIKDLQAGKMLVMVDAEDRENEGDLIFPAQFSTQEKVNFMIKEARGVVCVALDE 62

Query: 66  VQAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIV 125
             AK+  L LM P N S ++TAFTI+++AK   TTG+SA +R               D V
Sbjct: 63  TLAKKFELPLMVPKNTSNHETAFTITVDAKDA-TTGVSAYERNMTIQIFADDNAKASDFV 121

Query: 126 SPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFA 185
            PGH+ P+IAK GGVL R GHTE +VD+ KLA    + VICEI+ ++G MA+ +DL  F 
Sbjct: 122 RPGHINPLIAKKGGVLERTGHTEGTVDLCKLAGLKGACVICEIVKDNGDMARREDLEIFC 181

Query: 186 NKHNLKIGKIEDLIAYRXXXXXXXXXXXQSDIKVKNQKYKIRIYENLLDGSEHFALIKGN 245
            KH+L +  + DLI YR           +S   +   K +  I+ +  + ++H A    +
Sbjct: 182 QKHDLNMIAVSDLIEYRLKHESLIKLEEKSQSVLAGFKAEKFIFSD-HNQTQHIAFCFKD 240

Query: 246 IKKGIIPRVRVISSNVVQNYLINQQLPNSFDKTLNYFK--KFNNCVLVFIKDTNLKSVTQ 303
           IKK    +  +  S+            + F K L   K    N  V+VF++         
Sbjct: 241 IKKCENVKFHISGSD------FELLTSDKFSKLLEQIKFLSENGGVIVFMQG-------- 286

Query: 304 TLKDYKNKNFYKKGNDKLIRNYGIGAQIIKDLKIKNMILITKSL-KKVIGLEGYDIKI 360
                      +K +    +NYGIGAQI++   I+ + L+++S  K  IGLEG+ + +
Sbjct: 287 -----------EKSSTTQYKNYGIGAQILRYFGIEEIKLLSQSCDKDYIGLEGFGLNL 333


>RIBB_PSEAE RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 365

 Score =  191 bits (484), Expect = 1e-50
 Identities = 130/357 (36%), Positives = 205/357 (57%), Gaps = 3/357 (0%)

Query: 8   SIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQ 67
           +I+ +I   ++G M IL+DDE RENEGDLI++      ++INFM K+ RGL+C+ +   +
Sbjct: 5   TIDELIEDIRQGKMVILMDDEDRENEGDLIMAAECVRTEDINFMVKHARGLVCMPMTRER 64

Query: 68  AKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSP 127
            +RL L LM   N S   T FT+SIEA +G+TTGIS                    IVSP
Sbjct: 65  CERLGLPLMVQRNGSGFGTKFTVSIEAAEGVTTGISXXXXXXXXXXXXXXXXXXXXIVSP 124

Query: 128 GHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANK 187
           GH+FP++A+ GG L RAGHTEA+ D++++A    S VICE+MN+DG+MA+  +L  FA +
Sbjct: 125 GHIFPLMAQPGGTLARAGHTEAACDLARMAGFEPSGVICEVMNDDGSMARRPELEAFAAE 184

Query: 188 HNLKIGKIEDLIAYRXXXXXXXXXXXQSDIKVKNQKYKIRIYENLLDGSEHFALIKGNIK 247
           H +KIG I DLI YR           +  +  +   + +  Y + ++G  H AL  G + 
Sbjct: 185 HGIKIGTIADLIHYRLIHERTVERIAEQPLDSELGHFNLITYRDSVEGDVHLALTLGKVC 244

Query: 248 KGIIPRVRVISSNVVQNYL-INQQLPNSFDKTLNYFKKFNNCVLVFI-KDTNLKSVTQTL 305
                 VRV + + +++ L +NQ    S    +    +  + V++ +        +   +
Sbjct: 245 AEEPTLVRVHNMDPLRDLLQVNQPGRWSLRAAMTKVAEAGSGVVLLLGHQIGGDDLLAHV 304

Query: 306 KDYKNKNFYKKGNDKLIRNYGIGAQIIKDLKIKNMILITKSLKKVIGLEGYDIKITK 362
           ++                  G G+QI++DL ++ M L++  + +   + G+D+++ +
Sbjct: 305 REIXXXXXXXXXXXXXYSTVGAGSQILRDLGVRKMRLLSAPM-RFNAISGFDLEVVE 360


>RIBB_HELHP RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 355

 Score =  190 bits (483), Expect = 1e-50
 Identities = 138/364 (37%), Positives = 201/364 (55%), Gaps = 26/364 (7%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           I+  I   K+G M I++DDE RENEGDL+++   SS + INFMA+  RGLIC+++    A
Sbjct: 6   IKEAIEAIKQGEMIIIMDDEDRENEGDLVMAGIFSSPQKINFMAQEARGLICVSITQELA 65

Query: 69  KRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPG 128
           ++L+L  M   N S ++TAFTISI+AK+   TGISA +R               D V PG
Sbjct: 66  QKLDLPPMVQKNDSNHETAFTISIDAKEA-KTGISAFERDMTIRLMCESNTKPSDFVRPG 124

Query: 129 HVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQD--LFDFAN 186
           H+FP+IAK+GGVLVR GHTEASVDI +LA     +VICEIM +DGTMA   D  L DFA+
Sbjct: 125 HIFPLIAKEGGVLVRTGHTEASVDICRLAGVAPISVICEIMKKDGTMAGRGDKFLLDFAS 184

Query: 187 KHNLKIGKIEDLIAYR-XXXXXXXXXXXQSDIKVKNQKYKIRIYENLLDGSEHFAL---I 242
           +H+LKI  + D+I YR            +S + +  +  KI   ++L    EH       
Sbjct: 185 QHHLKILYVSDIIQYRLNFENLLREITRESAVFMGVECEKITFIDHL--EREHIVFGFPH 242

Query: 243 KGNIKKGIIPRVRVISSNVVQNYLINQQLPNSFDKTLNYFKKFNNCVLVFIKDTNLKSVT 302
           KG+      P +R  +       L N Q  N+  K++   K+     LVF+         
Sbjct: 243 KGSSSNEPKPLIRFHNVRSDLELLQNAQEWNALLKSIECLKE-KGGYLVFL--------- 292

Query: 303 QTLKDYKNKNFYKKGNDKLIRNYGIGAQIIKDLKIKNMILITK---SLKKVIGLEGYDIK 359
            T  +Y N +  K   D  I+++GIGAQI+K L I++ +L++    S  +   L G+++ 
Sbjct: 293 NTHSEYANSS--KTCGD--IKDFGIGAQILKRLGIEDFVLLSSCGGSKGEYNALSGFNLH 348

Query: 360 ITKQ 363
           + ++
Sbjct: 349 LVEK 352


>RIBBA_ACTPL RecName: Full=Riboflavin biosynthesis protein
           ribBA;Includes:  RecName: Full=3,4-dihydroxy-2-butanone
           4-phosphate synthase;
          Length = 401

 Score =  190 bits (482), Expect = 2e-50
 Identities = 120/375 (32%), Positives = 196/375 (52%), Gaps = 18/375 (4%)

Query: 6   YASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDS 65
           ++ +E  I   ++G + ++ DDE RENEGD I +   ++ +NINFMA YG+GLIC  + +
Sbjct: 6   FSKVEDAIEAIRQGKIILVTDDEDRENEGDFICAAEFATPENINFMATYGKGLICTPIST 65

Query: 66  VQAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIV 125
             AK+LN   M  +NQ  ++TAFT+S++      TGISA +R               D  
Sbjct: 66  EIAKKLNFHPMVAVNQDNHETAFTVSVD-HIDTGTGISAFERSITAMKIVDDNAKATDFR 124

Query: 126 SPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFA 185
            PGH+FP+IAK+GGVLVR GHTEA+VD+++LA   ++ + CEIM +DGTM    DL  FA
Sbjct: 125 RPGHMFPLIAKEGGVLVRNGHTEATVDLARLAGLKHAGLCCEIMADDGTMMTMPDLQKFA 184

Query: 186 NKHNLKIGKIEDLIAYRXXXXXXXXXXXQSDIKVKNQKYKIRIYENLLDGSEHFALIKGN 245
            +HN+    I+ L  YR              +  K  ++    +  ++ G EH AL+KG+
Sbjct: 185 VEHNMPFITIQQLQEYRRKHDSLVKQISVVKMPTKYGEFMAHSFVEVISGKEHVALVKGD 244

Query: 246 IKKGIIPRVRVISSNVVQNYLINQQLP--NSFDKTLNYFKKFNNCVLVFIKDTNLK-SVT 302
           +  G     R+ S  +  +   +Q+      F   +   ++    V+++++       + 
Sbjct: 245 LTDGEQVLARIHSECLTGDAFGSQRCDCGQQFAAAMTQIEQEGRGVILYLRQEGRGIGLI 304

Query: 303 QTLKDYKNKNFYKKGNDKL-----------IRNYGIGAQIIKDLKIKNMILITKSLKKVI 351
             L+ Y+ ++   KG D +            R Y IGAQ+ + L +K++ L+T +  K+ 
Sbjct: 305 NKLRAYELQD---KGMDTVEANVALGFKEDEREYYIGAQMFQQLGVKSIRLLTNNPAKIE 361

Query: 352 GLEGYDIKITKQEII 366
           GL+   + I  +E I
Sbjct: 362 GLKEQGLNIVAREPI 376


>RIBBA_ACTP2 RecName: Full=Riboflavin biosynthesis protein
           ribBA;Includes:  RecName: Full=3,4-dihydroxy-2-butanone
           4-phosphate synthase;
          Length = 401

 Score =  190 bits (482), Expect = 2e-50
 Identities = 120/375 (32%), Positives = 196/375 (52%), Gaps = 18/375 (4%)

Query: 6   YASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDS 65
           ++ +E  I   ++G + ++ DDE RENEGD I +   ++ +NINFMA YG+GLIC  + +
Sbjct: 6   FSKVEDAIEAIRQGKIILVTDDEDRENEGDFICAAEFATPENINFMATYGKGLICTPIST 65

Query: 66  VQAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIV 125
             AK+LN   M  +NQ  ++TAFT+S++      TGISA +R               D  
Sbjct: 66  EIAKKLNFHPMVAVNQDNHETAFTVSVD-HIDTGTGISAFERSITAMKIVDDNAKATDFR 124

Query: 126 SPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFA 185
            PGH+FP+IAK+GGVLVR GHTEA+VD+++LA   ++ + CEIM +DGTM    DL  FA
Sbjct: 125 RPGHMFPLIAKEGGVLVRNGHTEATVDLARLAGLKHAGLCCEIMADDGTMMTMPDLQKFA 184

Query: 186 NKHNLKIGKIEDLIAYRXXXXXXXXXXXQSDIKVKNQKYKIRIYENLLDGSEHFALIKGN 245
            +HN+    I+ L  YR              +  K  ++    +  ++ G EH AL+KG+
Sbjct: 185 VEHNMPFITIQQLQEYRRKHDSLVKQISVVKMPTKYGEFMAHSFVEVISGKEHVALVKGD 244

Query: 246 IKKGIIPRVRVISSNVVQNYLINQQLP--NSFDKTLNYFKKFNNCVLVFIKDTNLK-SVT 302
           +  G     R+ S  +  +   +Q+      F   +   ++    V+++++       + 
Sbjct: 245 LTDGEQVLARIHSECLTGDAFGSQRCDCGQQFAAAMTQIEQEGRGVILYLRQEGRGIGLI 304

Query: 303 QTLKDYKNKNFYKKGNDKL-----------IRNYGIGAQIIKDLKIKNMILITKSLKKVI 351
             L+ Y+ ++   KG D +            R Y IGAQ+ + L +K++ L+T +  K+ 
Sbjct: 305 NKLRAYELQD---KGMDTVEANVALGFKEDEREYYIGAQMFQQLGVKSIRLLTNNPAKIE 361

Query: 352 GLEGYDIKITKQEII 366
           GL+   + I  +E I
Sbjct: 362 GLKEQGLNIVAREPI 376


>RIBBA_SALAI RecName: Full=Riboflavin biosynthesis protein
           ribBA;Includes:  RecName: Full=3,4-dihydroxy-2-butanone
           4-phosphate synthase;
          Length = 420

 Score =  189 bits (480), Expect = 3e-50
 Identities = 115/367 (31%), Positives = 195/367 (53%), Gaps = 12/367 (3%)

Query: 6   YASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDS 65
           + +IE  +     G   ++VDD  RENEGDLI +   ++ + + FM +Y  G IC  L  
Sbjct: 4   FGTIEQAMAEIVAGRPVVVVDDANRENEGDLIFAAELATPELVAFMVRYTSGYICAPLTE 63

Query: 66  VQAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIV 125
            +  RL+L  M   NQ R  TA+T++++A++G++TGISA DR               D+ 
Sbjct: 64  DECDRLDLPPMHHTNQDRRGTAYTVTVDAREGVSTGISAADRAHTIRLLADPRTGPADLA 123

Query: 126 SPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFA 185
            PGHV P+ A+ GGVL R GHTEA++D+++LA    + V+CE++N+DGTM +  DL  F 
Sbjct: 124 RPGHVVPLRARQGGVLRRPGHTEAAIDLTRLAGLRPAGVLCELVNDDGTMMRVPDLERFC 183

Query: 186 NKHNLKIGKIEDLIAYRXXXXXXXXXXXQSDIKVKNQKYKIRIYENLLDGSEHFALIKGN 245
            +H+L +  I DL+AYR           ++ +  ++  ++   Y +  D +EH AL+ G+
Sbjct: 184 AEHSLVLITIADLVAYRRRTEKQVELVAEARMPTRHGVFRAFGYRSDYDSAEHVALVMGD 243

Query: 246 IKKGIIPRVRVISSNVVQNYL--INQQLPNSFDKTLNYFKKFNNCVLVFIKDTNLKSV-- 301
           +  G    VRV S  +  + L  +        +  L+   +    V+++++    + +  
Sbjct: 244 LGDGRDVLVRVHSECLTGDVLGSLRCDCGPQLNAALDQVAREGRGVVLYVRGHEGRGIGL 303

Query: 302 TQTLKDYKNKNFYKKGNDKLI--------RNYGIGAQIIKDLKIKNMILITKSLKKVIGL 353
              L+ Y+ ++  +   D  +        R+YG GAQI+ DL +++M L+T +  K  GL
Sbjct: 304 LHKLQAYQLQDTGRDTVDANLDLGLPADARDYGTGAQILYDLGVRSMRLLTNNPAKRAGL 363

Query: 354 EGYDIKI 360
           EGY + +
Sbjct: 364 EGYGLTV 370


>RIBBA_PELPB RecName: Full=Riboflavin biosynthesis protein
           ribBA;Includes:  RecName: Full=3,4-dihydroxy-2-butanone
           4-phosphate synthase;
          Length = 419

 Score =  189 bits (480), Expect = 3e-50
 Identities = 120/378 (31%), Positives = 201/378 (53%), Gaps = 18/378 (4%)

Query: 1   MKKNNYASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLIC 60
           M K N+ +I++ +   ++G + I++           I +    + + +NF+ +  RGL+C
Sbjct: 1   MDKKNFDTIDAALEDIRQGKLVIVIXXXXXXXXXXFIGAADKVTNEMVNFITREARGLLC 60

Query: 61  LALDSVQAKRLNLSLMSPINQSRNKTAFTISIEA-KKGITTGISAKDRXXXXXXXXXXXX 119
           +A+   +AK L L  M   N S+++T FT+S++A  +G+TTGIS  DR            
Sbjct: 61  VAVTMDRAKELQLDPMVQRNTSQHETNFTVSVDAIAEGVTTGISVYDRAMTIKMLGDLSS 120

Query: 120 XXXDIVSPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQ 179
              D   PGH+FP+ A DGGVL R GHTEA+VD+++LA  + + ++CEI+N+DG+MA+  
Sbjct: 121 TADDFSRPGHIFPLRAMDGGVLRRVGHTEAAVDLARLAGCSPTGLLCEILNDDGSMARLP 180

Query: 180 DLFDFANKHNLKIGKIEDLIAYRXXXXXXXXXXXQSDIKVKNQKYKIRIYENLLDGSEHF 239
            L     K  LK+  I++L+AY+           +S +     ++++  YE+  D   H 
Sbjct: 181 QLIKLKAKFGLKLITIKELVAYQMQRNKLVQRAVESRLPTIYGEFRLIAYESFTDQHNHM 240

Query: 240 ALIKGNIKKGIIPRVRVISSNVVQNYLINQQLP--NSFDKTLNYFKKFNNCVLVFI-KDT 296
           A +KG++       VRV S     +   + +    N     L   +K    VL+++ ++ 
Sbjct: 241 AFVKGDVTTDEPVLVRVHSQCATGDTFASLRCDCGNQLASALTMIEKEGRGVLIYLMQEG 300

Query: 297 NLKSVTQTLKDYKNKNFYKKG------NDKL-----IRNYGIGAQIIKDLKIKNMILITK 345
               +   LK Y   N   +G      N+KL     +R+YGIGAQI+KDL ++ M L+T 
Sbjct: 301 RGIGLINKLKAY---NLQDQGYDTVEANEKLGFKADLRDYGIGAQILKDLGVRKMKLMTN 357

Query: 346 SLKKVIGLEGYDIKITKQ 363
           + KKV+GLEGY ++I ++
Sbjct: 358 NPKKVVGLEGYGLEIVER 375


>RIBBA_MYCUA RecName: Full=Riboflavin biosynthesis protein
           ribBA;Includes:  RecName: Full=3,4-dihydroxy-2-butanone
           4-phosphate synthase;
          Length = 425

 Score =  188 bits (478), Expect = 6e-50
 Identities = 119/374 (31%), Positives = 198/374 (52%), Gaps = 18/374 (4%)

Query: 8   SIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQ 67
           S+E  +     G   I++DDE RENEGDLI +   ++ + + FM +Y  G +C+ LD   
Sbjct: 6   SVERAVADIGAGKAVIVIDDEDRENEGDLIFAAEKATPELVAFMVRYTSGYLCVPLDGAV 65

Query: 68  AKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSP 127
             RL L  M  +NQ ++ TA+T++++AK G+ TGISA DR               D   P
Sbjct: 66  CDRLGLLPMYAVNQDKHGTAYTVTVDAKNGVGTGISASDRATTMRLLADPASVAEDFTRP 125

Query: 128 GHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMN--EDGTMAKGQDLFDFA 185
           GHV P+ AKDGGVL R GHTEA+VD++++A    +  ICEI++  ++G+MA+  +L  FA
Sbjct: 126 GHVVPLRAKDGGVLRRPGHTEAAVDLARMAGLQPAGAICEIVSRKDEGSMAQTDELRVFA 185

Query: 186 NKHNLKIGKIEDLIAYRXXXXXXXXXXXQSDIKVKNQKYKIRIYENLLDGSEHFALIKGN 245
           ++H L +  I DLI +R           ++ I  +  +++   Y ++ +  EH AL++G 
Sbjct: 186 DEHGLALITIADLIEWRRKHEKHIERVAEARIPTRRGEFRAIGYTSIYENVEHVALVRGE 245

Query: 246 I----KKGIIPRVRVISSNVVQNYLINQQLP--NSFDKTLNYFKKFNNCVLVFIKDTNLK 299
           I      G    VRV S  +  +   +++    +  D  +    +    V+++++    +
Sbjct: 246 IAGPNSDGDDVLVRVHSECLTGDVFGSRRCDCGSQLDAAMAMVAREGRGVVLYMRGHEGR 305

Query: 300 SV-------TQTLKDYKNKNF---YKKGNDKLIRNYGIGAQIIKDLKIKNMILITKSLKK 349
            +       T  L+D  +       K G     R+YGIGAQI+ DL +++M L+T +  K
Sbjct: 306 GIGLLHKLQTYQLQDAGDDTVDANLKLGLPADARDYGIGAQILVDLGVRSMRLLTNNPAK 365

Query: 350 VIGLEGYDIKITKQ 363
            +GL+GY + I ++
Sbjct: 366 RVGLDGYGLHIIER 379


>RIBBA_PROA2 RecName: Full=Riboflavin biosynthesis protein
           ribBA;Includes:  RecName: Full=3,4-dihydroxy-2-butanone
           4-phosphate synthase;
          Length = 421

 Score =  187 bits (475), Expect = 1e-49
 Identities = 119/380 (31%), Positives = 197/380 (51%), Gaps = 20/380 (5%)

Query: 1   MKKNNYASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLIC 60
           M +    SIES I   K G + I++           I +    + + +NF+ K  RGL+C
Sbjct: 1   MSEKKIDSIESAIEDLKNGKLIIVIXXXXXXXXXXFIAAADKVTPEMVNFITKEARGLLC 60

Query: 61  LALDSVQAKRLNLSLMSPINQSRNKTAFTISIEA-KKGITTGISAKDRXXXXXXXXXXXX 119
           +A+   +AK L L  M   N S+++T FT+S++A  +G+TTGISA DR            
Sbjct: 61  VAVTMDRAKELQLDPMVQRNTSQHETNFTVSVDALAEGVTTGISAFDRYMTIKMLADPVS 120

Query: 120 XXXDIVSPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQ 179
              +   PGH+FP+ A DGGVL R GHTEA+VD+++LA      ++CEI+++DG+MA+  
Sbjct: 121 HADNFSRPGHIFPLRAMDGGVLRRVGHTEAAVDLAELAGSTPVGLLCEILHDDGSMARLP 180

Query: 180 DLFDFANKHNLKIGKIEDLIAYRXXXXXXXXXXXQSDIKVKNQKYKIRIYENLLDGSE-- 237
           +L     K +LK+  I+DL+AY+           ++ +  ++  +++  YE   D  +  
Sbjct: 181 ELLKIKEKFDLKLITIKDLVAYQMKRKKLVARAVETSLPTRHGDFRLIAYEACCDSQQQN 240

Query: 238 HFALIKGNIKKGIIPRVRVISSNVVQNYLINQQLP--NSFDKTLNYFKKFNNCVLVFI-K 294
           H A +KG+        VRV S     +   + +    N     +   +K    VL+++ +
Sbjct: 241 HLAFVKGDFSTDEPVLVRVHSQCATGDIFASLRCDCGNQLASAMQQIEKAGKGVLIYLMQ 300

Query: 295 DTNLKSVTQTLKDYKNKNFYKKGNDKL-----------IRNYGIGAQIIKDLKIKNMILI 343
           +     +   LK Y   N   +G D +           +R+YGIGAQI++DL +K M L+
Sbjct: 301 EGRGIGLINKLKAY---NLQDQGFDTVEANEQLGFKADLRDYGIGAQILQDLGVKKMRLL 357

Query: 344 TKSLKKVIGLEGYDIKITKQ 363
           T + KK++GLEGY ++I ++
Sbjct: 358 TNNPKKIVGLEGYGLEIVER 377


>RIBBA_STAHJ RecName: Full=Riboflavin biosynthesis protein
           ribBA;Includes:  RecName: Full=3,4-dihydroxy-2-butanone
           4-phosphate synthase;
          Length = 393

 Score =  186 bits (472), Expect = 3e-49
 Identities = 122/368 (33%), Positives = 188/368 (51%), Gaps = 19/368 (5%)

Query: 6   YASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDS 65
           +  I+  +N  K+G   I+VDDE RENEGDL+  T   +   INFMAK GRGLIC  +  
Sbjct: 3   FDEIKDALNALKRGESIIVVDDEDRENEGDLVAITQWMNDNTINFMAKEGRGLICAPISK 62

Query: 66  VQAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIV 125
             A + NL  M   N     T FT+SI+     +TGISA DR               D  
Sbjct: 63  DLALKFNLMPMVEHNTDGFGTNFTVSIDHAT-TSTGISAFDRMATARALINPESTPEDFH 121

Query: 126 SPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFA 185
            PGH+FP+IAK+ GVL R GHTEA+VD++KL K   + VICEIMNEDGTMAKG+ L  F 
Sbjct: 122 KPGHLFPLIAKENGVLERTGHTEAAVDLAKLTKAAPAGVICEIMNEDGTMAKGEQLEAFK 181

Query: 186 NKHNLKIGKIEDLIAYRXXXXXXXXXXXQSDIKVKNQKYKIRIYENLLDGSEHFALIKGN 245
           ++H LK+  IE L+ Y+           + ++   +  +++  +E+ L   E   L KG 
Sbjct: 182 HQHGLKMITIESLVNYQKDKDTSVELKAKVNMPTDHGAFEMYGFESSLTKEEIVVLAKGE 241

Query: 246 IKKGIIPRVRVISSNVVQNYLINQQLP--NSFDKTLNYFKKFNNCVLVFIKDTNLKSVTQ 303
            +  +   VR+ S+ +  +   +Q+       +  + Y  +    ++   ++     +  
Sbjct: 242 PR--VTENVRIHSACLTGDIFHSQRCDCGAQLESAMKYINEHGGMIIYLPQEGRGIGLIN 299

Query: 304 TLKDYKNKNFYKKGNDKL-----------IRNYGIGAQIIKDLKIKNMILITKSLKKVIG 352
            L+ Y+     ++G+D +           +R+Y I AQI+    ++ + L++ + KK  G
Sbjct: 300 KLRAYE---LIEQGHDTVTANLALGFDEDLRDYHIAAQILNYFNVQQVNLLSNNPKKFEG 356

Query: 353 LEGYDIKI 360
           L  Y IK+
Sbjct: 357 LSEYGIKV 364


>RIBBA_MYCMM RecName: Full=Riboflavin biosynthesis protein
           ribBA;Includes:  RecName: Full=3,4-dihydroxy-2-butanone
           4-phosphate synthase;
          Length = 425

 Score =  186 bits (472), Expect = 3e-49
 Identities = 118/374 (31%), Positives = 199/374 (53%), Gaps = 18/374 (4%)

Query: 8   SIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQ 67
           S+E  +     G   I++DDE RENEGDLI +   ++ + + FM +Y  G +C+ LD   
Sbjct: 6   SVERAVADIGAGKAVIVIDDEDRENEGDLIFAAEKATPELVAFMVRYTSGYLCVPLDGAV 65

Query: 68  AKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSP 127
             RL L  M  +NQ ++ TA+T++++AK G+ TGISA DR               D   P
Sbjct: 66  CDRLGLLPMYAVNQDKHGTAYTVTVDAKNGVGTGISASDRATTMRLLADPASVAEDFTRP 125

Query: 128 GHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMN--EDGTMAKGQDLFDFA 185
           GHV P+ AKDGGVL R GHTEA+VD++++A    +  ICEI++  ++G+MA+  +L  FA
Sbjct: 126 GHVVPLRAKDGGVLRRPGHTEAAVDLARMAGLQPAGAICEIVSQKDEGSMAQTDELRVFA 185

Query: 186 NKHNLKIGKIEDLIAYRXXXXXXXXXXXQSDIKVKNQKYKIRIYENLLDGSEHFALIKGN 245
           ++H L +  I DLI +R           ++ I  ++ +++   Y ++ +  EH AL++G 
Sbjct: 186 DEHGLALITIADLIEWRRKHEKHIERVAEARIPTRHGEFRAIGYTSIYEDVEHVALVRGE 245

Query: 246 I----KKGIIPRVRVISSNVVQNYLINQQLP--NSFDKTLNYFKKFNNCVLVFIKDTNLK 299
           I      G    VRV S  +  +   +++       D  +    +    V+++++    +
Sbjct: 246 IAGPNSDGDDVLVRVHSECLTGDVFGSRRCDCGPQLDAAMAMVAREGRGVVLYMRGHEGR 305

Query: 300 SV--TQTLKDYKNKNF--------YKKGNDKLIRNYGIGAQIIKDLKIKNMILITKSLKK 349
            +     L+ Y+ ++          K G     R+YGIGAQI+ DL +++M L+T +  K
Sbjct: 306 GIGLLHKLQAYQLQDAGDDTVDANLKLGLPADARDYGIGAQILVDLGVRSMRLLTNNPAK 365

Query: 350 VIGLEGYDIKITKQ 363
            +GL+GY + I ++
Sbjct: 366 RVGLDGYGLHIIER 379


>RIBBA_BACV8 RecName: Full=Riboflavin biosynthesis protein
           ribBA;Includes:  RecName: Full=3,4-dihydroxy-2-butanone
           4-phosphate synthase;
          Length = 404

 Score =  186 bits (471), Expect = 4e-49
 Identities = 120/373 (32%), Positives = 191/373 (51%), Gaps = 11/373 (2%)

Query: 1   MKKNNYASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLIC 60
           M++    +IE  I   ++G   I+VDDE RENEGDLI++    + + +NFM K+ RG++C
Sbjct: 1   MEELKLNTIEEAIADFREGKFVIVVDDEDRENEGDLIVAAEKITPEQVNFMLKHARGVLC 60

Query: 61  LALDSVQAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXX 120
             +   + K L L      N S   T FT++++  +G +TG+S  DR             
Sbjct: 61  APITISRCKELELPHQVDTNTSVLGTPFTVTVDKLEGCSTGVSIHDRAATIRALADPTST 120

Query: 121 XXDIVSPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQD 180
                 PGHV P+ A+D GVL RAGHTEA +D+++LA    +A + EIM+EDGTMA+  +
Sbjct: 121 PETFGRPGHVNPLYAQDKGVLRRAGHTEACIDMARLAGLYPAAALMEIMSEDGTMARLPE 180

Query: 181 LFDFANKHNLKIGKIEDLIAYRXXXXXXXXXXXQSDIKVKNQKYKIRIYENLLDGSEHFA 240
           L   A++  LK+  I DLIAYR           + D+  +   +++  +    +G EH A
Sbjct: 181 LRKMADEWGLKLISIRDLIAYRLKQESLVEKGVEVDMPTEYGHFRLIPFRQKSNGLEHIA 240

Query: 241 LIKGNIKKGIIPRVRVISSNVVQNYLINQQLP--NSFDKTLNYFKKFNNCVLVFIKDTNL 298
           +IKG+IK+G    VRV SS    +   + +        K L   +K     +V++     
Sbjct: 241 IIKGDIKEGEPVLVRVHSSCATGDIFGSMRCDCGEQLHKALQMIEKEGKGAVVYLNQEGR 300

Query: 299 K-SVTQTLKDYKNKN--------FYKKGNDKLIRNYGIGAQIIKDLKIKNMILITKSLKK 349
              + + +K YK +             G+    R+YG+GAQI++ + +  M L+T +  K
Sbjct: 301 GIGLMEKMKAYKLQENGVDTVEANILLGHQADERDYGVGAQILRSIGVTQMRLLTNNPVK 360

Query: 350 VIGLEGYDIKITK 362
            +GLE Y + I +
Sbjct: 361 RVGLESYGLSIVE 373


>RIBBA_MYCTU RecName: Full=Riboflavin biosynthesis protein
           ribBA;Includes:  RecName: Full=3,4-dihydroxy-2-butanone
           4-phosphate synthase;
          Length = 425

 Score =  185 bits (470), Expect = 5e-49
 Identities = 119/374 (31%), Positives = 198/374 (52%), Gaps = 18/374 (4%)

Query: 8   SIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQ 67
           S+E  +     G   I++DDE RENEGDLI +   ++ + + FM +Y  G +C+ LD   
Sbjct: 6   SVERAVADIAAGKAVIVIDDEDRENEGDLIFAAEKATPEMVAFMVRYTSGYLCVPLDGAI 65

Query: 68  AKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSP 127
             RL L  M  +NQ ++ TA+T++++A+ GI TGISA DR               D   P
Sbjct: 66  CDRLGLLPMYAVNQDKHGTAYTVTVDARNGIGTGISASDRATTMRLLADPTSVADDFTRP 125

Query: 128 GHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMN--EDGTMAKGQDLFDFA 185
           GHV P+ AKDGGVL R GHTEA+VD++++A    +  ICEI++  ++G+MA   +L  FA
Sbjct: 126 GHVVPLRAKDGGVLRRPGHTEAAVDLARMAGLQPAGAICEIVSQKDEGSMAHTDELRVFA 185

Query: 186 NKHNLKIGKIEDLIAYRXXXXXXXXXXXQSDIKVKNQKYKIRIYENLLDGSEHFALIKGN 245
           ++H L +  I DLI +R           ++ I  ++ +++   Y ++ +  EH AL++G 
Sbjct: 186 DEHGLALITIADLIEWRRKHEKHIERVAEARIPTRHGEFRAIGYTSIYEDVEHVALVRGE 245

Query: 246 I----KKGIIPRVRVISSNVVQNYLINQQLP--NSFDKTLNYFKKFNNCVLVFIKDTNLK 299
           I      G    VRV S  +  +   +++       D  L    +    V+++++    +
Sbjct: 246 IAGPNADGDDVLVRVHSECLTGDVFGSRRCDCGPQLDAALAMVAREGRGVVLYMRGHEGR 305

Query: 300 SV--TQTLKDYKNKNF--------YKKGNDKLIRNYGIGAQIIKDLKIKNMILITKSLKK 349
            +     L+ Y+ ++          K G     R+YGIGAQI+ DL +++M L+T +  K
Sbjct: 306 GIGLMHKLQAYQLQDAGADTVDANLKLGLPADARDYGIGAQILVDLGVRSMRLLTNNPAK 365

Query: 350 VIGLEGYDIKITKQ 363
            +GL+GY + I ++
Sbjct: 366 RVGLDGYGLHIIER 379


>RIBBA_MYCTA RecName: Full=Riboflavin biosynthesis protein
           ribBA;Includes:  RecName: Full=3,4-dihydroxy-2-butanone
           4-phosphate synthase;
          Length = 425

 Score =  185 bits (470), Expect = 5e-49
 Identities = 119/374 (31%), Positives = 198/374 (52%), Gaps = 18/374 (4%)

Query: 8   SIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQ 67
           S+E  +     G   I++DDE RENEGDLI +   ++ + + FM +Y  G +C+ LD   
Sbjct: 6   SVERAVADIAAGKAVIVIDDEDRENEGDLIFAAEKATPEMVAFMVRYTSGYLCVPLDGAI 65

Query: 68  AKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSP 127
             RL L  M  +NQ ++ TA+T++++A+ GI TGISA DR               D   P
Sbjct: 66  CDRLGLLPMYAVNQDKHGTAYTVTVDARNGIGTGISASDRATTMRLLADPTSVADDFTRP 125

Query: 128 GHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMN--EDGTMAKGQDLFDFA 185
           GHV P+ AKDGGVL R GHTEA+VD++++A    +  ICEI++  ++G+MA   +L  FA
Sbjct: 126 GHVVPLRAKDGGVLRRPGHTEAAVDLARMAGLQPAGAICEIVSQKDEGSMAHTDELRVFA 185

Query: 186 NKHNLKIGKIEDLIAYRXXXXXXXXXXXQSDIKVKNQKYKIRIYENLLDGSEHFALIKGN 245
           ++H L +  I DLI +R           ++ I  ++ +++   Y ++ +  EH AL++G 
Sbjct: 186 DEHGLALITIADLIEWRRKHEKHIERVAEARIPTRHGEFRAIGYTSIYEDVEHVALVRGE 245

Query: 246 I----KKGIIPRVRVISSNVVQNYLINQQLP--NSFDKTLNYFKKFNNCVLVFIKDTNLK 299
           I      G    VRV S  +  +   +++       D  L    +    V+++++    +
Sbjct: 246 IAGPNADGDDVLVRVHSECLTGDVFGSRRCDCGPQLDAALAMVAREGRGVVLYMRGHEGR 305

Query: 300 SV--TQTLKDYKNKNF--------YKKGNDKLIRNYGIGAQIIKDLKIKNMILITKSLKK 349
            +     L+ Y+ ++          K G     R+YGIGAQI+ DL +++M L+T +  K
Sbjct: 306 GIGLMHKLQAYQLQDAGADTVDANLKLGLPADARDYGIGAQILVDLGVRSMRLLTNNPAK 365

Query: 350 VIGLEGYDIKITKQ 363
            +GL+GY + I ++
Sbjct: 366 RVGLDGYGLHIIER 379


>RIBBA_MYCBT RecName: Full=Riboflavin biosynthesis protein
           ribBA;Includes:  RecName: Full=3,4-dihydroxy-2-butanone
           4-phosphate synthase;
          Length = 425

 Score =  185 bits (470), Expect = 5e-49
 Identities = 119/374 (31%), Positives = 198/374 (52%), Gaps = 18/374 (4%)

Query: 8   SIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQ 67
           S+E  +     G   I++DDE RENEGDLI +   ++ + + FM +Y  G +C+ LD   
Sbjct: 6   SVERAVADIAAGKAVIVIDDEDRENEGDLIFAAEKATPEMVAFMVRYTSGYLCVPLDGAI 65

Query: 68  AKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSP 127
             RL L  M  +NQ ++ TA+T++++A+ GI TGISA DR               D   P
Sbjct: 66  CDRLGLLPMYAVNQDKHGTAYTVTVDARNGIGTGISASDRATTMRLLADPTSVADDFTRP 125

Query: 128 GHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMN--EDGTMAKGQDLFDFA 185
           GHV P+ AKDGGVL R GHTEA+VD++++A    +  ICEI++  ++G+MA   +L  FA
Sbjct: 126 GHVVPLRAKDGGVLRRPGHTEAAVDLARMAGLQPAGAICEIVSQKDEGSMAHTDELRVFA 185

Query: 186 NKHNLKIGKIEDLIAYRXXXXXXXXXXXQSDIKVKNQKYKIRIYENLLDGSEHFALIKGN 245
           ++H L +  I DLI +R           ++ I  ++ +++   Y ++ +  EH AL++G 
Sbjct: 186 DEHGLALITIADLIEWRRKHEKHIERVAEARIPTRHGEFRAIGYTSIYEDVEHVALVRGE 245

Query: 246 I----KKGIIPRVRVISSNVVQNYLINQQLP--NSFDKTLNYFKKFNNCVLVFIKDTNLK 299
           I      G    VRV S  +  +   +++       D  L    +    V+++++    +
Sbjct: 246 IAGPNADGDDVLVRVHSECLTGDVFGSRRCDCGPQLDAALAMVAREGRGVVLYMRGHEGR 305

Query: 300 SV--TQTLKDYKNKNF--------YKKGNDKLIRNYGIGAQIIKDLKIKNMILITKSLKK 349
            +     L+ Y+ ++          K G     R+YGIGAQI+ DL +++M L+T +  K
Sbjct: 306 GIGLMHKLQAYQLQDAGADTVDANLKLGLPADARDYGIGAQILVDLGVRSMRLLTNNPAK 365

Query: 350 VIGLEGYDIKITKQ 363
            +GL+GY + I ++
Sbjct: 366 RVGLDGYGLHIIER 379


>RIBBA_MYCBP RecName: Full=Riboflavin biosynthesis protein
           ribBA;Includes:  RecName: Full=3,4-dihydroxy-2-butanone
           4-phosphate synthase;
          Length = 425

 Score =  185 bits (470), Expect = 5e-49
 Identities = 119/374 (31%), Positives = 198/374 (52%), Gaps = 18/374 (4%)

Query: 8   SIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQ 67
           S+E  +     G   I++DDE RENEGDLI +   ++ + + FM +Y  G +C+ LD   
Sbjct: 6   SVERAVADIAAGKAVIVIDDEDRENEGDLIFAAEKATPEMVAFMVRYTSGYLCVPLDGAI 65

Query: 68  AKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSP 127
             RL L  M  +NQ ++ TA+T++++A+ GI TGISA DR               D   P
Sbjct: 66  CDRLGLLPMYAVNQDKHGTAYTVTVDARNGIGTGISASDRATTMRLLADPTSVADDFTRP 125

Query: 128 GHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMN--EDGTMAKGQDLFDFA 185
           GHV P+ AKDGGVL R GHTEA+VD++++A    +  ICEI++  ++G+MA   +L  FA
Sbjct: 126 GHVVPLRAKDGGVLRRPGHTEAAVDLARMAGLQPAGAICEIVSQKDEGSMAHTDELRVFA 185

Query: 186 NKHNLKIGKIEDLIAYRXXXXXXXXXXXQSDIKVKNQKYKIRIYENLLDGSEHFALIKGN 245
           ++H L +  I DLI +R           ++ I  ++ +++   Y ++ +  EH AL++G 
Sbjct: 186 DEHGLALITIADLIEWRRKHEKHIERVAEARIPTRHGEFRAIGYTSIYEDVEHVALVRGE 245

Query: 246 I----KKGIIPRVRVISSNVVQNYLINQQLP--NSFDKTLNYFKKFNNCVLVFIKDTNLK 299
           I      G    VRV S  +  +   +++       D  L    +    V+++++    +
Sbjct: 246 IAGPNADGDDVLVRVHSECLTGDVFGSRRCDCGPQLDAALAMVAREGRGVVLYMRGHEGR 305

Query: 300 SV--TQTLKDYKNKNF--------YKKGNDKLIRNYGIGAQIIKDLKIKNMILITKSLKK 349
            +     L+ Y+ ++          K G     R+YGIGAQI+ DL +++M L+T +  K
Sbjct: 306 GIGLMHKLQAYQLQDAGADTVDANLKLGLPADARDYGIGAQILVDLGVRSMRLLTNNPAK 365

Query: 350 VIGLEGYDIKITKQ 363
            +GL+GY + I ++
Sbjct: 366 RVGLDGYGLHIIER 379


>RIBBA_MYCBO RecName: Full=Riboflavin biosynthesis protein
           ribBA;Includes:  RecName: Full=3,4-dihydroxy-2-butanone
           4-phosphate synthase;
          Length = 425

 Score =  185 bits (470), Expect = 5e-49
 Identities = 119/374 (31%), Positives = 198/374 (52%), Gaps = 18/374 (4%)

Query: 8   SIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQ 67
           S+E  +     G   I++DDE RENEGDLI +   ++ + + FM +Y  G +C+ LD   
Sbjct: 6   SVERAVADIAAGKAVIVIDDEDRENEGDLIFAAEKATPEMVAFMVRYTSGYLCVPLDGAI 65

Query: 68  AKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSP 127
             RL L  M  +NQ ++ TA+T++++A+ GI TGISA DR               D   P
Sbjct: 66  CDRLGLLPMYAVNQDKHGTAYTVTVDARNGIGTGISASDRATTMRLLADPTSVADDFTRP 125

Query: 128 GHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMN--EDGTMAKGQDLFDFA 185
           GHV P+ AKDGGVL R GHTEA+VD++++A    +  ICEI++  ++G+MA   +L  FA
Sbjct: 126 GHVVPLRAKDGGVLRRPGHTEAAVDLARMAGLQPAGAICEIVSQKDEGSMAHTDELRVFA 185

Query: 186 NKHNLKIGKIEDLIAYRXXXXXXXXXXXQSDIKVKNQKYKIRIYENLLDGSEHFALIKGN 245
           ++H L +  I DLI +R           ++ I  ++ +++   Y ++ +  EH AL++G 
Sbjct: 186 DEHGLALITIADLIEWRRKHEKHIERVAEARIPTRHGEFRAIGYTSIYEDVEHVALVRGE 245

Query: 246 I----KKGIIPRVRVISSNVVQNYLINQQLP--NSFDKTLNYFKKFNNCVLVFIKDTNLK 299
           I      G    VRV S  +  +   +++       D  L    +    V+++++    +
Sbjct: 246 IAGPNADGDDVLVRVHSECLTGDVFGSRRCDCGPQLDAALAMVAREGRGVVLYMRGHEGR 305

Query: 300 SV--TQTLKDYKNKNF--------YKKGNDKLIRNYGIGAQIIKDLKIKNMILITKSLKK 349
            +     L+ Y+ ++          K G     R+YGIGAQI+ DL +++M L+T +  K
Sbjct: 306 GIGLMHKLQAYQLQDAGADTVDANLKLGLPADARDYGIGAQILVDLGVRSMRLLTNNPAK 365

Query: 350 VIGLEGYDIKITKQ 363
            +GL+GY + I ++
Sbjct: 366 RVGLDGYGLHIIER 379


>RIBBA_MYCVP RecName: Full=Riboflavin biosynthesis protein
           ribBA;Includes:  RecName: Full=3,4-dihydroxy-2-butanone
           4-phosphate synthase;
          Length = 423

 Score =  184 bits (468), Expect = 8e-49
 Identities = 119/374 (31%), Positives = 198/374 (52%), Gaps = 18/374 (4%)

Query: 8   SIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQ 67
           S+E  +     G   +++DDE RENEGDLI +   ++ + + FM +Y  G +C+ L    
Sbjct: 6   SVERAVADIAAGKAVVVIDDEDRENEGDLIFAAEKATPELVAFMVRYTSGYLCVPLAGDI 65

Query: 68  AKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSP 127
             RL L  M  +NQ ++ TA+T++++AKKG+ TGISA DR               D   P
Sbjct: 66  CDRLGLLPMYAVNQDKHGTAYTVTVDAKKGVGTGISAMDRATTMRLLADPDAVADDFTKP 125

Query: 128 GHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMN--EDGTMAKGQDLFDFA 185
           GHV P+ AKDGGVL R GHTEA+VD+++LA    +  ICEI++  ++G MA+  +L  FA
Sbjct: 126 GHVVPLRAKDGGVLRRPGHTEAAVDLARLAGLQPAGAICEIVSQKDEGAMAQTDELRIFA 185

Query: 186 NKHNLKIGKIEDLIAYRXXXXXXXXXXXQSDIKVKNQKYKIRIYENLLDGSEHFALIKGN 245
           ++H+L +  I DLI +R           ++ I  ++ +++   Y ++ +  EH AL+KG 
Sbjct: 186 DEHDLALISIADLIEWRRKHEKHIARVAEARIPTRHGEFRAVGYTSIYEDVEHVALVKGE 245

Query: 246 I----KKGIIPRVRVISSNVVQNYLINQQLP--NSFDKTLNYFKKFNNCVLVFIKDTNLK 299
           I      G    VRV S  +  +   +++       D  L    +    V+++++    +
Sbjct: 246 ISGPHSDGHDVLVRVHSECLTGDVFGSRRCDCGPQLDAALAMVAREGRGVVLYMRGHEGR 305

Query: 300 SV--TQTLKDYKNKNF--------YKKGNDKLIRNYGIGAQIIKDLKIKNMILITKSLKK 349
            +     L+ Y+ ++          K G     R+YG GAQI+ DL +++M L+T +  K
Sbjct: 306 GIGLMHKLQAYQLQDAGDDTVDANLKLGLPADARDYGTGAQILVDLGVRSMRLLTNNPAK 365

Query: 350 VIGLEGYDIKITKQ 363
            +GL+GY + I ++
Sbjct: 366 RVGLDGYGLHIIER 379


>RIBBA_MYCPA RecName: Full=Riboflavin biosynthesis protein
           ribBA;Includes:  RecName: Full=3,4-dihydroxy-2-butanone
           4-phosphate synthase;
          Length = 425

 Score =  184 bits (468), Expect = 8e-49
 Identities = 116/374 (31%), Positives = 200/374 (53%), Gaps = 18/374 (4%)

Query: 8   SIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQ 67
           S+E  +     G   I++DDE RENEGDLI +   ++ + + FM +Y  G +C+ LD   
Sbjct: 6   SVERAVADIAAGKAVIVIDDEDRENEGDLIFAAEKATPEMVAFMVRYTSGYLCVPLDGAI 65

Query: 68  AKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSP 127
             RL L  M  +NQ ++ TA+T++++A+ G+ TGISA DR               D   P
Sbjct: 66  CDRLGLLPMYAVNQDKHGTAYTVTVDARNGVGTGISASDRATTMRLLADPTSIAEDFTRP 125

Query: 128 GHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMN--EDGTMAKGQDLFDFA 185
           GHV P+ AKDGGVL R GHTEA+VD++++A    +  ICEI++  ++G+MA+  +L  FA
Sbjct: 126 GHVVPLRAKDGGVLRRPGHTEAAVDLARMAGLQPAGAICEIVSQKDEGSMAQTDELRVFA 185

Query: 186 NKHNLKIGKIEDLIAYRXXXXXXXXXXXQSDIKVKNQKYKIRIYENLLDGSEHFALIKGN 245
           ++H+L +  I DLI +R           ++ I  ++ +++   Y ++ +  EH AL++G 
Sbjct: 186 DEHDLAMITIADLIEWRRKHEKHIERIAEARIPTRHGEFRAIGYTSIYEEVEHVALVRGE 245

Query: 246 I----KKGIIPRVRVISSNVVQNYLINQQLP--NSFDKTLNYFKKFNNCVLVFIKDTNLK 299
           I      G    VRV S  +  +   +++       D  +    +    ++++++    +
Sbjct: 246 IAGPNSDGDDVLVRVHSECLTGDVFGSRRCDCGPQLDAAMAMVAREGRGIVLYMRGHEGR 305

Query: 300 SV--TQTLKDYKNKNF--------YKKGNDKLIRNYGIGAQIIKDLKIKNMILITKSLKK 349
            +     L+ Y+ ++          K G     R+YGIGAQI+ DL +++M L+T +  K
Sbjct: 306 GIGLMHKLQAYQLQDAGEDTVDANLKLGLPADARDYGIGAQILVDLGVRSMRLLTNNPAK 365

Query: 350 VIGLEGYDIKITKQ 363
            +GL+GY + I ++
Sbjct: 366 RVGLDGYGLHIIER 379


>RIBBA_MYCA1 RecName: Full=Riboflavin biosynthesis protein
           ribBA;Includes:  RecName: Full=3,4-dihydroxy-2-butanone
           4-phosphate synthase;
          Length = 425

 Score =  184 bits (468), Expect = 8e-49
 Identities = 116/374 (31%), Positives = 200/374 (53%), Gaps = 18/374 (4%)

Query: 8   SIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQ 67
           S+E  +     G   I++DDE RENEGDLI +   ++ + + FM +Y  G +C+ LD   
Sbjct: 6   SVERAVADIAAGKAVIVIDDEDRENEGDLIFAAEKATPEMVAFMVRYTSGYLCVPLDGAI 65

Query: 68  AKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSP 127
             RL L  M  +NQ ++ TA+T++++A+ G+ TGISA DR               D   P
Sbjct: 66  CDRLGLLPMYAVNQDKHGTAYTVTVDARNGVGTGISASDRATTMRLLADPTSIAEDFTRP 125

Query: 128 GHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMN--EDGTMAKGQDLFDFA 185
           GHV P+ AKDGGVL R GHTEA+VD++++A    +  ICEI++  ++G+MA+  +L  FA
Sbjct: 126 GHVVPLRAKDGGVLRRPGHTEAAVDLARMAGLQPAGAICEIVSQKDEGSMAQTDELRVFA 185

Query: 186 NKHNLKIGKIEDLIAYRXXXXXXXXXXXQSDIKVKNQKYKIRIYENLLDGSEHFALIKGN 245
           ++H+L +  I DLI +R           ++ I  ++ +++   Y ++ +  EH AL++G 
Sbjct: 186 DEHDLAMITIADLIEWRRKHEKHIERIAEARIPTRHGEFRAIGYTSIYEEVEHVALVRGE 245

Query: 246 I----KKGIIPRVRVISSNVVQNYLINQQLP--NSFDKTLNYFKKFNNCVLVFIKDTNLK 299
           I      G    VRV S  +  +   +++       D  +    +    ++++++    +
Sbjct: 246 IAGPNSDGDDVLVRVHSECLTGDVFGSRRCDCGPQLDAAMAMVAREGRGIVLYMRGHEGR 305

Query: 300 SV--TQTLKDYKNKNF--------YKKGNDKLIRNYGIGAQIIKDLKIKNMILITKSLKK 349
            +     L+ Y+ ++          K G     R+YGIGAQI+ DL +++M L+T +  K
Sbjct: 306 GIGLMHKLQAYQLQDAGEDTVDANLKLGFPADARDYGIGAQILVDLGVRSMRLLTNNPAK 365

Query: 350 VIGLEGYDIKITKQ 363
            +GL+GY + I ++
Sbjct: 366 RVGLDGYGLHIIER 379


>RIBBA_MYCGI RecName: Full=Riboflavin biosynthesis protein
           ribBA;Includes:  RecName: Full=3,4-dihydroxy-2-butanone
           4-phosphate synthase;
          Length = 423

 Score =  182 bits (462), Expect = 4e-48
 Identities = 117/374 (31%), Positives = 198/374 (52%), Gaps = 18/374 (4%)

Query: 8   SIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQ 67
           S+E  +     G   +++DDE RENEGDLI +   ++ + + FM +Y  G +C+ L    
Sbjct: 6   SVERAVADIAAGKAVVVIDDEDRENEGDLIFAAEKATPELVAFMVRYTSGYLCVPLAGEI 65

Query: 68  AKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSP 127
             RL L  M  +NQ ++ TA+T++++AK G+ TGISA DR               D   P
Sbjct: 66  CDRLGLLPMYAVNQDKHGTAYTVTVDAKVGVGTGISASDRATTMRLLADPDSVADDFTKP 125

Query: 128 GHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMN--EDGTMAKGQDLFDFA 185
           GHV P+ AKDGGVL R GHTEA+VD+++LA    +  ICEI++  ++G MA+  +L  FA
Sbjct: 126 GHVVPLRAKDGGVLRRPGHTEAAVDLARLAGLQAAGTICEIVSQKDEGAMAQTDELRIFA 185

Query: 186 NKHNLKIGKIEDLIAYRXXXXXXXXXXXQSDIKVKNQKYKIRIYENLLDGSEHFALIKGN 245
           ++H+L +  I DLI +R           ++ I  ++ +++   Y ++ +  EH AL+KG+
Sbjct: 186 DEHDLALISIADLIEWRRKHEKHIARVAEARIPTRHGEFRAVGYTSIYEDVEHVALVKGD 245

Query: 246 IK----KGIIPRVRVISSNVVQNYLINQQLP--NSFDKTLNYFKKFNNCVLVFIKDTNLK 299
           I      G    VRV S  +  +   +++       D  L    +    ++++++    +
Sbjct: 246 IAGPHGDGHDVLVRVHSECLTGDVFGSRRCDCGPQLDAALAMVAREGRGIVLYMRGHEGR 305

Query: 300 SV--TQTLKDYKNKNF--------YKKGNDKLIRNYGIGAQIIKDLKIKNMILITKSLKK 349
            +     L+ Y+ ++          K G     R+YG GAQI+ DL +++M L+T +  K
Sbjct: 306 GIGLMHKLQAYQLQDAGDDTVDANLKLGLPADARDYGTGAQILVDLGVRSMRLLTNNPAK 365

Query: 350 VIGLEGYDIKITKQ 363
            +GL+GY + I ++
Sbjct: 366 RVGLDGYGLHIIER 379


>RIBBA_STAAN RecName: Full=Riboflavin biosynthesis protein
           ribBA;Includes:  RecName: Full=3,4-dihydroxy-2-butanone
           4-phosphate synthase;
          Length = 393

 Score =  182 bits (461), Expect = 5e-48
 Identities = 124/368 (33%), Positives = 189/368 (51%), Gaps = 13/368 (3%)

Query: 6   YASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDS 65
           + +I+S +   K G   I+VDDE RENEGDL+  T   +   INFMAK  RGLIC  +  
Sbjct: 3   FDNIDSALMALKNGETIIVVDDENRENEGDLVAVTEWMNDNTINFMAKEARGLICAPVSK 62

Query: 66  VQAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIV 125
             A+RL+L  M   N     T FT+SI+     TTGISA +R               D  
Sbjct: 63  DIAQRLDLVQMVDDNSDIFGTQFTVSID-HVDTTTGISAYERTLTAKKLIDPSSEAKDFN 121

Query: 126 SPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFA 185
            PGH+FP++A+D GVL R GHTEA+VD++KL     + VICEIMN+DGTMAKGQDL +F 
Sbjct: 122 RPGHLFPLVAQDKGVLARNGHTEAAVDLAKLTGAKPAGVICEIMNDDGTMAKGQDLQNFK 181

Query: 186 NKHNLKIGKIEDLIAYRXXXXXXXXXXXQSDIKVKNQKYKIRIYENLLDGSEHFALIKGN 245
            KH LK+  I+DLI YR           +  +      + +  ++      E   L KG 
Sbjct: 182 EKHQLKMITIDDLIEYRKKLEPEIEFKAKVKMPTDFGTFDMYGFKATYTDEEIVVLTKGA 241

Query: 246 IKKGIIPRVRVISSNVVQNYLINQQLP--NSFDKTLNYFKKFNNCVLVFIKDTNLKSVTQ 303
           I++     VR+ S+ +  +   +Q+       + ++ Y  +    ++   ++     +  
Sbjct: 242 IRQH--ENVRLHSACLTGDIFHSQRCDCGAQLESSMKYINEHGGMIIYLPQEGRGIGLLN 299

Query: 304 TLKDYK--NKNF------YKKGNDKLIRNYGIGAQIIKDLKIKNMILITKSLKKVIGLEG 355
            L+ Y+   + +         G D+ +R+Y I AQI+K   I+++ L++ +  K  GL+ 
Sbjct: 300 KLRAYELIEQGYDTVTANLALGFDEDLRDYHIAAQILKYFNIEHINLLSNNPSKFEGLKQ 359

Query: 356 YDIKITKQ 363
           Y I I ++
Sbjct: 360 YGIDIAER 367


>RIBBA_STAAM RecName: Full=Riboflavin biosynthesis protein
           ribBA;Includes:  RecName: Full=3,4-dihydroxy-2-butanone
           4-phosphate synthase;
          Length = 393

 Score =  182 bits (461), Expect = 5e-48
 Identities = 124/368 (33%), Positives = 189/368 (51%), Gaps = 13/368 (3%)

Query: 6   YASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDS 65
           + +I+S +   K G   I+VDDE RENEGDL+  T   +   INFMAK  RGLIC  +  
Sbjct: 3   FDNIDSALMALKNGETIIVVDDENRENEGDLVAVTEWMNDNTINFMAKEARGLICAPVSK 62

Query: 66  VQAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIV 125
             A+RL+L  M   N     T FT+SI+     TTGISA +R               D  
Sbjct: 63  DIAQRLDLVQMVDDNSDIFGTQFTVSID-HVDTTTGISAYERTLTAKKLIDPSSEAKDFN 121

Query: 126 SPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFA 185
            PGH+FP++A+D GVL R GHTEA+VD++KL     + VICEIMN+DGTMAKGQDL +F 
Sbjct: 122 RPGHLFPLVAQDKGVLARNGHTEAAVDLAKLTGAKPAGVICEIMNDDGTMAKGQDLQNFK 181

Query: 186 NKHNLKIGKIEDLIAYRXXXXXXXXXXXQSDIKVKNQKYKIRIYENLLDGSEHFALIKGN 245
            KH LK+  I+DLI YR           +  +      + +  ++      E   L KG 
Sbjct: 182 EKHQLKMITIDDLIEYRKKLEPEIEFKAKVKMPTDFGTFDMYGFKATYTDEEIVVLTKGA 241

Query: 246 IKKGIIPRVRVISSNVVQNYLINQQLP--NSFDKTLNYFKKFNNCVLVFIKDTNLKSVTQ 303
           I++     VR+ S+ +  +   +Q+       + ++ Y  +    ++   ++     +  
Sbjct: 242 IRQH--ENVRLHSACLTGDIFHSQRCDCGAQLESSMKYINEHGGMIIYLPQEGRGIGLLN 299

Query: 304 TLKDYK--NKNF------YKKGNDKLIRNYGIGAQIIKDLKIKNMILITKSLKKVIGLEG 355
            L+ Y+   + +         G D+ +R+Y I AQI+K   I+++ L++ +  K  GL+ 
Sbjct: 300 KLRAYELIEQGYDTVTANLALGFDEDLRDYHIAAQILKYFNIEHINLLSNNPSKFEGLKQ 359

Query: 356 YDIKITKQ 363
           Y I I ++
Sbjct: 360 YGIDIAER 367


>RIBBA_PORGI RecName: Full=Riboflavin biosynthesis protein
           ribBA;Includes:  RecName: Full=3,4-dihydroxy-2-butanone
           4-phosphate synthase;
          Length = 405

 Score =  182 bits (461), Expect = 5e-48
 Identities = 122/380 (32%), Positives = 194/380 (51%), Gaps = 24/380 (6%)

Query: 1   MKKNNYASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLIC 60
           M++    +IE  +   K+G   I+VDDE RENEGD II+    +   +NFM  +GRG++C
Sbjct: 1   MEEIKLNTIEEALEDFKEGKFLIVVDDEDRENEGDFIIAAEKITPDKVNFMMHHGRGVLC 60

Query: 61  LALDSVQAKRLNLSLMSPINQSRNKTAFTISIEAK-KGITTGISAKDRXXXXXXXXXXXX 119
             +   +A  L L +  P N S ++T FT++++    G TTG+S  DR            
Sbjct: 61  APISEERAHELELEMQVPDNTSVHETPFTVTVDRLGNGCTTGVSMYDRAQTILALADPNT 120

Query: 120 XXXDIVSPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQ 179
              D+  PGH+ P+ A+  GVL RAGHTEA+VD+++L     +A + EI+NEDGTMA+  
Sbjct: 121 RPSDLGRPGHICPLRARSRGVLRRAGHTEAAVDLARLCGMQPAAALIEIINEDGTMARLP 180

Query: 180 DLFDFANKHNLKIGKIEDLIAYRXXXXXXXXXXXQSDIKVKNQKYKIRIYENLLDGSEHF 239
            L++ + +  LKI  I+DLIAYR           + D+  +   +++  +    +G EH 
Sbjct: 181 QLWEVSKRFGLKIIAIKDLIAYRLKQESIVEKGVEVDMPTEYGHFRLIPFRQKSNGLEHI 240

Query: 240 ALIKGNIKKGIIPRVRVISSNVVQNYL------INQQLPNSFDKTLNYFKKFNNCVLVFI 293
           AL KG   +     VR+ SS    +           QL  + +K     K+    ++   
Sbjct: 241 ALFKGTWDENEPILVRMHSSCATGDIFGSMRCDCGGQLLQAMEK---IEKEGKGAIIYLN 297

Query: 294 KDTNLKSVTQTLKDYKNKNFYKKGNDKL-----------IRNYGIGAQIIKDLKIKNMIL 342
           ++     + + +K YK     ++G D +            R+YGIGAQI++ L IK M L
Sbjct: 298 QEGRGIGLMEKMKAYK---LQEQGMDTIDANLCLGHKADERDYGIGAQILRLLGIKKMRL 354

Query: 343 ITKSLKKVIGLEGYDIKITK 362
           +T +  K IGLE + ++I +
Sbjct: 355 MTNNPVKRIGLEAFGLEIVE 374


>RIBBA_PORG3 RecName: Full=Riboflavin biosynthesis protein
           ribBA;Includes:  RecName: Full=3,4-dihydroxy-2-butanone
           4-phosphate synthase;
          Length = 405

 Score =  182 bits (461), Expect = 5e-48
 Identities = 122/380 (32%), Positives = 194/380 (51%), Gaps = 24/380 (6%)

Query: 1   MKKNNYASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLIC 60
           M++    +IE  +   K+G   I+VDDE RENEGD II+    +   +NFM  +GRG++C
Sbjct: 1   MEEIKLNTIEEALEDFKEGKFLIVVDDEDRENEGDFIIAAEKITPDKVNFMMHHGRGVLC 60

Query: 61  LALDSVQAKRLNLSLMSPINQSRNKTAFTISIEAK-KGITTGISAKDRXXXXXXXXXXXX 119
             +   +A  L L +  P N S ++T FT++++    G TTG+S  DR            
Sbjct: 61  APISEERAHELELEMQVPDNTSVHETPFTVTVDRLGNGCTTGVSMYDRAQTILALADPNT 120

Query: 120 XXXDIVSPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQ 179
              D+  PGH+ P+ A+  GVL RAGHTEA+VD+++L     +A + EI+NEDGTMA+  
Sbjct: 121 RPSDLGRPGHICPLRARSRGVLRRAGHTEAAVDLARLCGMQPAAALIEIINEDGTMARLP 180

Query: 180 DLFDFANKHNLKIGKIEDLIAYRXXXXXXXXXXXQSDIKVKNQKYKIRIYENLLDGSEHF 239
            L++ + +  LKI  I+DLIAYR           + D+  +   +++  +    +G EH 
Sbjct: 181 QLWEVSKRFGLKIIAIKDLIAYRLKQESIVEKGVEVDMPTEYGHFRLIPFRQKSNGLEHI 240

Query: 240 ALIKGNIKKGIIPRVRVISSNVVQNYL------INQQLPNSFDKTLNYFKKFNNCVLVFI 293
           AL KG   +     VR+ SS    +           QL  + +K     K+    ++   
Sbjct: 241 ALFKGTWDENEPILVRMHSSCATGDIFGSMRCDCGGQLLQAMEK---IEKEGKGAIIYLN 297

Query: 294 KDTNLKSVTQTLKDYKNKNFYKKGNDKL-----------IRNYGIGAQIIKDLKIKNMIL 342
           ++     + + +K YK     ++G D +            R+YGIGAQI++ L IK M L
Sbjct: 298 QEGRGIGLMEKMKAYK---LQEQGMDTIDANLCLGHKADERDYGIGAQILRLLGIKKMRL 354

Query: 343 ITKSLKKVIGLEGYDIKITK 362
           +T +  K IGLE + ++I +
Sbjct: 355 MTNNPVKRIGLEAFGLEIVE 374


>RIBBA_BACTN RecName: Full=Riboflavin biosynthesis protein
           ribBA;Includes:  RecName: Full=3,4-dihydroxy-2-butanone
           4-phosphate synthase;
          Length = 404

 Score =  182 bits (461), Expect = 5e-48
 Identities = 118/366 (32%), Positives = 190/366 (51%), Gaps = 17/366 (4%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           IE  I   K+G   I+VDDE RENEGDLII+    + + +NFM K+ RG++C  +   + 
Sbjct: 9   IEDAIADFKEGKFVIVVDDEDRENEGDLIIAAEKITPEKVNFMLKHARGVLCAPITVSRC 68

Query: 69  KRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPG 128
           K L+L      N S   T FT++I+  +G +TG+SA DR                   PG
Sbjct: 69  KELDLPHQVSDNTSVLGTPFTVTIDKLEGCSTGVSASDRAATIQALADPASTPATFGRPG 128

Query: 129 HVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKH 188
           H+ P+ A++ GVL RAGHTEA++D+++LA    +  + EIM++DGTMA+  +L   A++H
Sbjct: 129 HINPLYAQEKGVLRRAGHTEATIDMARLAGLYPAGALMEIMSDDGTMARLPELRAMADEH 188

Query: 189 NLKIGKIEDLIAYRXXXXXXXXXXXQSDIKVKNQKYKIRIYENLLDGSEHFALIKGNIKK 248
            LK+  I DLIAYR           + ++  ++  +++  +    +G EH A+ KG   +
Sbjct: 189 GLKLISIHDLIAYRLKQESIVEKGVEVNMPTEHGMFRLIPFRQKSNGLEHMAIFKGTWNE 248

Query: 249 GIIPRVRVISSNVVQNYLINQQLP--NSFDKTLNYFKKFNNCVLVFIKDTNLK-SVTQTL 305
                VRV SS    + L + +        K +   +K    V+V++        + + +
Sbjct: 249 DEPILVRVHSSCATGDILGSHRCDCGEQLHKAMEMIEKEGKGVVVYLNQEGRGIGLMEKM 308

Query: 306 KDYKNKNFYKKGNDKL-----------IRNYGIGAQIIKDLKIKNMILITKSLKKVIGLE 354
           K YK     + G D +            R+YG+GAQI+++L +  M L+T +  K +GLE
Sbjct: 309 KAYK---LQEDGMDTVDANLCLGHLADERDYGVGAQILRELGVHKMKLLTNNPVKRVGLE 365

Query: 355 GYDIKI 360
            Y ++I
Sbjct: 366 AYGLEI 371


>RIBBA_STAS1 RecName: Full=Riboflavin biosynthesis protein
           ribBA;Includes:  RecName: Full=3,4-dihydroxy-2-butanone
           4-phosphate synthase;
          Length = 393

 Score =  181 bits (459), Expect = 9e-48
 Identities = 123/369 (33%), Positives = 186/369 (50%), Gaps = 19/369 (5%)

Query: 8   SIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQ 67
           SI++ +   KKG   I+VDDE RENEGDL+  T   +   +NFMA YG+GLIC  + +  
Sbjct: 5   SIDTALQALKKGESIIVVDDENRENEGDLVAVTEWMNDNTVNFMATYGKGLICAPISNAI 64

Query: 68  AKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSP 127
           A++L+L+ M   N     T FT+S++  +  TTGISA +R               D   P
Sbjct: 65  AEKLDLNPMVTHNSDVYGTQFTVSVDHIQ-TTTGISADERTMTARALIDEQATGSDFNKP 123

Query: 128 GHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANK 187
           GH+FP+IA+D GVL R GHTEASVD++KL     +A+ICEIM+EDGTMAKG  L  F   
Sbjct: 124 GHLFPLIAQDNGVLSRRGHTEASVDLAKLTGAKPAALICEIMDEDGTMAKGASLEAFKET 183

Query: 188 HNLKIGKIEDLIAYRXXXXXXXXXXXQSDIKVKNQKYKIRIYENLLDGSEHFALIKGNIK 247
           H L +  IEDL  YR           ++ +K+  +     +Y    D SE   ++  N  
Sbjct: 184 HGLVMISIEDLEKYR--KSSISKLDAKAKVKMPTEYGNFDMYGFTTDNSEEDIVVIANGD 241

Query: 248 KGIIPRVRVISSNVVQNYLINQQLP--NSFDKTLNYFKKFNNCVLVFIKDTNLKSVTQTL 305
                 VR+ S+ +  +   +Q+         ++ Y  +    +L   ++     +   L
Sbjct: 242 INKTENVRIHSACLTGDIFHSQRCDCGEQLAASMKYIAEHGGMILYLPQEGRGIGLINKL 301

Query: 306 KDYKNKNFYKKGNDKL-----------IRNYGIGAQIIKDLKIKNMILITKSLKKVIGLE 354
           K Y+     ++G D +           +R+Y   AQI+K   + ++ L++ + KK   LE
Sbjct: 302 KAYE---LIEQGYDTVSANIALGFEEDLRDYQNAAQILKYFGVDSVNLLSNNPKKFESLE 358

Query: 355 GYDIKITKQ 363
            Y I I K+
Sbjct: 359 SYGIHIAKR 367


>RIBBA_STAAW RecName: Full=Riboflavin biosynthesis protein
           ribBA;Includes:  RecName: Full=3,4-dihydroxy-2-butanone
           4-phosphate synthase;
          Length = 393

 Score =  181 bits (459), Expect = 9e-48
 Identities = 124/368 (33%), Positives = 188/368 (51%), Gaps = 13/368 (3%)

Query: 6   YASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDS 65
           + +I+S +   K G   I+VDDE RENEGDL+  T   +   INFMAK  RGLIC  +  
Sbjct: 3   FDNIDSALMALKNGETIIVVDDENRENEGDLVAVTEWMNDNTINFMAKEARGLICAPVSK 62

Query: 66  VQAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIV 125
             A+RL+L  M   N     T FT+SI+     TTGISA +R               D  
Sbjct: 63  DIAQRLDLVQMVDDNSDIFGTQFTVSID-HVDTTTGISAYERTLTAKKLIDPSSEAKDFN 121

Query: 126 SPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFA 185
            PGH+FP++A+D GVL R GHTEA+VD++KL     + VICEIMN+DGTMAKGQDL  F 
Sbjct: 122 RPGHLFPLVAQDKGVLARNGHTEAAVDLAKLTGAKPAGVICEIMNDDGTMAKGQDLQKFK 181

Query: 186 NKHNLKIGKIEDLIAYRXXXXXXXXXXXQSDIKVKNQKYKIRIYENLLDGSEHFALIKGN 245
            KH LK+  I+DLI YR           +  +      + +  ++      E   L KG 
Sbjct: 182 EKHQLKMITIDDLIEYRKKLEPEIEFKAKVKMPTDFGTFDMYGFKATYTDEEIVVLTKGA 241

Query: 246 IKKGIIPRVRVISSNVVQNYLINQQLP--NSFDKTLNYFKKFNNCVLVFIKDTNLKSVTQ 303
           I++     VR+ S+ +  +   +Q+       + ++ Y  +    ++   ++     +  
Sbjct: 242 IRQH--ENVRLHSACLTGDIFHSQRCDCGAQLESSMKYINEHGGMIIYLPQEGRGIGLLN 299

Query: 304 TLKDYK--NKNF------YKKGNDKLIRNYGIGAQIIKDLKIKNMILITKSLKKVIGLEG 355
            L+ Y+   + +         G D+ +R+Y I AQI+K   I+++ L++ +  K  GL+ 
Sbjct: 300 KLRAYELIEQGYDTVTANLALGFDEDLRDYHIAAQILKYFNIEHINLLSNNPSKFEGLKQ 359

Query: 356 YDIKITKQ 363
           Y I I ++
Sbjct: 360 YGIDIAER 367


>RIBBA_STAAS RecName: Full=Riboflavin biosynthesis protein
           ribBA;Includes:  RecName: Full=3,4-dihydroxy-2-butanone
           4-phosphate synthase;
          Length = 393

 Score =  181 bits (459), Expect = 9e-48
 Identities = 124/368 (33%), Positives = 188/368 (51%), Gaps = 13/368 (3%)

Query: 6   YASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDS 65
           + +I+S +   K G   I+VDDE RENEGDL+  T   +   INFMAK  RGLIC  +  
Sbjct: 3   FDNIDSALMALKNGETIIVVDDENRENEGDLVAVTEWMNDNTINFMAKEARGLICAPVSK 62

Query: 66  VQAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIV 125
             A+RL+L  M   N     T FT+SI+     TTGISA +R               D  
Sbjct: 63  DIAQRLDLVQMVDDNSDIFGTQFTVSID-HVDTTTGISAYERTLTAKKLIDPSSEAKDFN 121

Query: 126 SPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFA 185
            PGH+FP++A+D GVL R GHTEA+VD++KL     + VICEIMN+DGTMAKGQDL  F 
Sbjct: 122 RPGHLFPLVAQDKGVLARNGHTEAAVDLAKLTGAKPAGVICEIMNDDGTMAKGQDLQKFK 181

Query: 186 NKHNLKIGKIEDLIAYRXXXXXXXXXXXQSDIKVKNQKYKIRIYENLLDGSEHFALIKGN 245
            KH LK+  I+DLI YR           +  +      + +  ++      E   L KG 
Sbjct: 182 EKHQLKMITIDDLIEYRKKLEPEIEFKAKVKMPTDFGTFDMYGFKATYTDEEIVVLTKGA 241

Query: 246 IKKGIIPRVRVISSNVVQNYLINQQLP--NSFDKTLNYFKKFNNCVLVFIKDTNLKSVTQ 303
           I++     VR+ S+ +  +   +Q+       + ++ Y  +    ++   ++     +  
Sbjct: 242 IRQH--ENVRLHSACLTGDIFHSQRCDCGAQLESSMKYINEHGGMIIYLPQEGRGIGLLN 299

Query: 304 TLKDYK--NKNF------YKKGNDKLIRNYGIGAQIIKDLKIKNMILITKSLKKVIGLEG 355
            L+ Y+   + +         G D+ +R+Y I AQI+K   I+++ L++ +  K  GL+ 
Sbjct: 300 KLRAYELIEQGYDTVTANLALGFDEDLRDYHIAAQILKYFNIEHINLLSNNPSKFEGLKQ 359

Query: 356 YDIKITKQ 363
           Y I I ++
Sbjct: 360 YGIDIAER 367


>RIBBA_STAAR RecName: Full=Riboflavin biosynthesis protein
           ribBA;Includes:  RecName: Full=3,4-dihydroxy-2-butanone
           4-phosphate synthase;
          Length = 393

 Score =  181 bits (459), Expect = 9e-48
 Identities = 124/368 (33%), Positives = 188/368 (51%), Gaps = 13/368 (3%)

Query: 6   YASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDS 65
           + +I+S +   K G   I+VDDE RENEGDL+  T   +   INFMAK  RGLIC  +  
Sbjct: 3   FDNIDSALMALKNGETIIVVDDENRENEGDLVAVTEWMNDNTINFMAKEARGLICAPVSK 62

Query: 66  VQAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIV 125
             A+RL+L  M   N     T FT+SI+     TTGISA +R               D  
Sbjct: 63  DIAQRLDLVQMVDDNSDIFGTQFTVSID-HVDTTTGISAYERTLTAKKLIDPSSEAKDFN 121

Query: 126 SPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFA 185
            PGH+FP++A+D GVL R GHTEA+VD++KL     + VICEIMN+DGTMAKGQDL  F 
Sbjct: 122 RPGHLFPLVAQDKGVLARNGHTEAAVDLAKLTGAKPAGVICEIMNDDGTMAKGQDLQKFK 181

Query: 186 NKHNLKIGKIEDLIAYRXXXXXXXXXXXQSDIKVKNQKYKIRIYENLLDGSEHFALIKGN 245
            KH LK+  I+DLI YR           +  +      + +  ++      E   L KG 
Sbjct: 182 EKHKLKMITIDDLIEYRKKLEPEIEFKAKVKMPTDFGTFDMYGFKATYTDEEIVVLTKGA 241

Query: 246 IKKGIIPRVRVISSNVVQNYLINQQLP--NSFDKTLNYFKKFNNCVLVFIKDTNLKSVTQ 303
           I++     VR+ S+ +  +   +Q+       + ++ Y  +    ++   ++     +  
Sbjct: 242 IRQH--ENVRLHSACLTGDIFHSQRCDCGAQLESSMKYINEHGGMIIYLPQEGRGIGLLN 299

Query: 304 TLKDYK--NKNF------YKKGNDKLIRNYGIGAQIIKDLKIKNMILITKSLKKVIGLEG 355
            L+ Y+   + +         G D+ +R+Y I AQI+K   I+++ L++ +  K  GL+ 
Sbjct: 300 KLRAYELIEQGYDTVTANLALGFDEDLRDYHIAAQILKYFNIEHINLLSNNPSKFEGLKQ 359

Query: 356 YDIKITKQ 363
           Y I I ++
Sbjct: 360 YGIDIAER 367


>RIBBA_STAAC RecName: Full=Riboflavin biosynthesis protein
           ribBA;Includes:  RecName: Full=3,4-dihydroxy-2-butanone
           4-phosphate synthase;
          Length = 393

 Score =  181 bits (458), Expect = 1e-47
 Identities = 124/368 (33%), Positives = 188/368 (51%), Gaps = 13/368 (3%)

Query: 6   YASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDS 65
           + +I+S +   K G   I+VDDE RENEGDL+  T   +   INFMAK  RGLIC  +  
Sbjct: 3   FDNIDSALMALKNGEPIIVVDDENRENEGDLVAVTEWMNDNTINFMAKEARGLICAPVSK 62

Query: 66  VQAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIV 125
             A+RL+L  M   N     T FT+SI+     TTGISA +R               D  
Sbjct: 63  DIAQRLDLVQMVDDNSDIFGTQFTVSID-HVDTTTGISAYERTLTAKKLIDPSSEAKDFN 121

Query: 126 SPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFA 185
            PGH+FP++A+D GVL R GHTEA+VD++KL     + VICEIMN+DGTMAKGQDL  F 
Sbjct: 122 RPGHLFPLVAQDKGVLARNGHTEAAVDLAKLTGAKPAGVICEIMNDDGTMAKGQDLQKFK 181

Query: 186 NKHNLKIGKIEDLIAYRXXXXXXXXXXXQSDIKVKNQKYKIRIYENLLDGSEHFALIKGN 245
            KH LK+  I+DLI YR           +  +      + +  ++      E   L KG 
Sbjct: 182 EKHQLKMITIDDLIEYRKKLEPEIEFKAKVKMPTDFGTFDMYGFKATYTDEEIVVLTKGA 241

Query: 246 IKKGIIPRVRVISSNVVQNYLINQQLP--NSFDKTLNYFKKFNNCVLVFIKDTNLKSVTQ 303
           I++     VR+ S+ +  +   +Q+       + ++ Y  +    ++   ++     +  
Sbjct: 242 IRQH--ENVRLHSACLTGDIFHSQRCDCGAQLESSMKYINEHGGMIIYLPQEGRGIGLLN 299

Query: 304 TLKDYK--NKNF------YKKGNDKLIRNYGIGAQIIKDLKIKNMILITKSLKKVIGLEG 355
            L+ Y+   + +         G D+ +R+Y I AQI+K   I+++ L++ +  K  GL+ 
Sbjct: 300 KLRAYELIEQGYDTVTANLALGFDEDLRDYHIAAQILKYFNIEHINLLSNNPSKFEGLKQ 359

Query: 356 YDIKITKQ 363
           Y I I ++
Sbjct: 360 YGIDIAER 367


>RIBBA_ARATH RecName: Full=Riboflavin biosynthesis protein ribBA,
           chloroplastic;Includes:  RecName:
           Full=3,4-dihydroxy-2-butanone 4-phosphate synthase;
          Length = 543

 Score =  180 bits (457), Expect = 2e-47
 Identities = 117/371 (31%), Positives = 197/371 (53%), Gaps = 18/371 (4%)

Query: 6   YASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDS 65
           ++SI   I   ++G +              L+++   ++ + + F+ ++G G++C+++  
Sbjct: 128 FSSIPEAIEDIRQGKLXXXXXXXXXXXXXXLVMAAQLATPEAMAFIVRHGTGIVCVSMKE 187

Query: 66  VQAKRLNLSLMSPINQSRNK----TAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXX 121
              +RL+L LM  +NQ  N+    TAFT++++AK G TTG+SA+DR              
Sbjct: 188 DDLERLHLPLM--VNQKENEEKLSTAFTVTVDAKHGTTTGVSARDRATTILSLASRDSKP 245

Query: 122 XDIVSPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDL 181
            D   PGH+FP+  ++GGVL RAGHTEASVD++ LA  +   V+CEI+++DG+MA+   L
Sbjct: 246 EDFNRPGHIFPLKYREGGVLKRAGHTEASVDLTVLAGLDPVGVLCEIVDDDGSMARLPKL 305

Query: 182 FDFANKHNLKIGKIEDLIAYRXXXXXXXXXXXQSDIKVKNQKYKIRIYENLLDGSEHFAL 241
            +FA ++NLK+  I DLI YR            + I      +    Y ++LDG EH A+
Sbjct: 306 REFAAENNLKVVSIADLIRYRRKRDKLVERASAARIPTMWGPFTAYCYRSILDGIEHIAM 365

Query: 242 IKGNIKKGIIPRVRVISSNVVQNYLINQQLP--NSFDKTLNYFKKFNNCVLVFIKDTNLK 299
           +KG I  G    VRV S  +  +   + +    N    ++   +     VLV+++    +
Sbjct: 366 VKGEIGDGQDILVRVHSECLTGDIFGSARCDCGNQLALSMQQIEATGRGVLVYLRGHEGR 425

Query: 300 SV--TQTLKDYKNKNFYK---KGNDKL-----IRNYGIGAQIIKDLKIKNMILITKSLKK 349
            +     L+ Y  ++  +   + N++L      R YGIGAQII+DL ++ M L+T +  K
Sbjct: 426 GIGLGHKLRAYNLQDAGRDTVEANEELGLPVDSREYGIGAQIIRDLGVRTMKLMTNNPAK 485

Query: 350 VIGLEGYDIKI 360
            +GL+GY + I
Sbjct: 486 YVGLKGYGLAI 496


>RIBB_TOLAT RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 217

 Score =  170 bits (431), Expect = 2e-44
 Identities = 84/198 (42%), Positives = 124/198 (62%)

Query: 4   NNYASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLAL 63
           N +  +E  ++  ++G   ++VDDE RENEGDLI S    + + +  M +   G++CL L
Sbjct: 11  NPFQRVEQALSALQQGNGVLVVDDEDRENEGDLIFSAEKMTPQQMALMIRECSGIVCLCL 70

Query: 64  DSVQAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXD 123
              + ++L L +M   N S N+T FT++IEA +G+TTG+SA+DR               D
Sbjct: 71  TEERIRQLALPMMVEHNTSANQTGFTVTIEAARGVTTGVSAQDRITTIRTAIADGAVASD 130

Query: 124 IVSPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFD 183
           +  PGHVFP+ A+ GGVL R GHTEA++D+ KLA      V+CE+ NEDG+MA+   + +
Sbjct: 131 LNRPGHVFPLRARAGGVLTRRGHTEATIDLMKLAGLKPYGVLCEVQNEDGSMARLPGIVE 190

Query: 184 FANKHNLKIGKIEDLIAY 201
           FANKHN+ +  IEDL+AY
Sbjct: 191 FANKHNMPVLCIEDLVAY 208


>RIBB_VIBFI RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 217

 Score =  170 bits (430), Expect = 2e-44
 Identities = 86/194 (44%), Positives = 121/194 (62%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           +E  I   ++G   +L+DDE RENEGDLI S    +++ +  M +   G++CL L   +A
Sbjct: 19  VEQAIKSVQQGNGVLLLDDESRENEGDLIYSVDHLTSEQMALMIRSCSGIVCLCLTEDKA 78

Query: 69  KRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPG 128
             L LS M   N+S N+TAFTISIEAKKG+TTG+SA DR               ++  PG
Sbjct: 79  DYLELSPMVEHNESVNQTAFTISIEAKKGVTTGVSATDRVTTIKTACKNGALPHELAKPG 138

Query: 129 HVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKH 188
           HVFP+ AKDGGVL R GHTE +VD+ +LA+   + V+CE+ N DG+MAK  ++  FA +H
Sbjct: 139 HVFPLRAKDGGVLTRRGHTEGTVDLMRLAELTPAGVLCEVTNSDGSMAKTPEIIIFAEQH 198

Query: 189 NLKIGKIEDLIAYR 202
           +L +  + D+  YR
Sbjct: 199 HLPVLTVNDIALYR 212


>RIBB_HAEIE RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 215

 Score =  170 bits (430), Expect = 2e-44
 Identities = 86/190 (45%), Positives = 119/190 (62%)

Query: 13  INIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQAKRLN 72
           IN  K G   +++DDE RENEGDLI      + + +  + +YG G++CL +   + ++L+
Sbjct: 21  INAFKNGNGVLVLDDEDRENEGDLIFPAETITPEQMAKLIRYGSGIVCLCITDERCQQLD 80

Query: 73  LSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPGHVFP 132
           L  M   N S NKTAFT++IEA KG++TG+SA DR               D+  PGHVFP
Sbjct: 81  LPSMVEHNNSVNKTAFTVTIEAAKGVSTGVSAADRVTTIQTAIADNAVPTDLHRPGHVFP 140

Query: 133 IIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKHNLKI 192
           + A +GGVL R GHTEASVD+++LA    + VICEI N+DGTMA+  D+ +FA K    +
Sbjct: 141 LRAANGGVLTRRGHTEASVDLARLAGFKEAGVICEITNDDGTMARTPDIVEFAKKFGYSV 200

Query: 193 GKIEDLIAYR 202
             IEDL+ YR
Sbjct: 201 LTIEDLVEYR 210


>RIBB_VIBHA RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;AltName: Full=LUXH protein;
          Length = 230

 Score =  169 bits (429), Expect = 3e-44
 Identities = 86/194 (44%), Positives = 118/194 (60%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           +E  I   K G   +L+DDE RENEGDLI S    +   +  M + G G++CL L   +A
Sbjct: 17  VERAIEALKNGLGVLLMDDEDRENEGDLIFSAQHLTEAQMALMIREGSGIVCLCLTEERA 76

Query: 69  KRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPG 128
             L+L  M   N S+N+TAFT+SIEAK+G+TTG+SAKDR               D+  PG
Sbjct: 77  NWLDLPPMVKDNCSKNQTAFTVSIEAKEGVTTGVSAKDRVTTVKTATYFDAQPEDLARPG 136

Query: 129 HVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKH 188
           HVFP++AK  GVL R GHTE ++D+  LA    S ++CE+ N DGTMAK  +  +FA +H
Sbjct: 137 HVFPLVAKTNGVLARRGHTEGTIDLMYLANLVPSGILCELTNPDGTMAKLPETIEFARRH 196

Query: 189 NLKIGKIEDLIAYR 202
            + +  IED++ YR
Sbjct: 197 GMPVLTIEDIVDYR 210


>RIBBA_MYCA9 RecName: Full=Riboflavin biosynthesis protein
           ribBA;Includes:  RecName: Full=3,4-dihydroxy-2-butanone
           4-phosphate synthase;
          Length = 417

 Score =  169 bits (428), Expect = 4e-44
 Identities = 111/346 (32%), Positives = 183/346 (52%), Gaps = 18/346 (5%)

Query: 36  LIISTTDSSAKNINFMAKYGRGLICLALDSVQAKRLNLSLMSPINQSRNKTAFTISIEAK 95
           LI +   ++ + + FM +Y  G +C+ L      RL L     +NQ ++ TA+T++++AK
Sbjct: 34  LIFAAEKATPELVAFMVRYTSGYLCVPLAGEDCDRLGLLPQYAVNQDKHGTAYTVTVDAK 93

Query: 96  KGITTGISAKDRXXXXXXXXXXXXXXXDIVSPGHVFPIIAKDGGVLVRAGHTEASVDISK 155
            GI TGISA DR               D   PGHV P+ AKDGGVL R GHTEASVD++K
Sbjct: 94  NGIGTGISASDRAATMRLLADAASTADDFTKPGHVVPLRAKDGGVLRRPGHTEASVDLAK 153

Query: 156 LAKKNNSAVICEIMN--EDGTMAKGQDLFDFANKHNLKIGKIEDLIAYRXXXXXXXXXXX 213
           LA    +AVICEI++  ++G MA+ ++L  FA++HNL +  I DLI +R           
Sbjct: 154 LAGLRPAAVICEIVSQKDEGAMAQTEELRVFADEHNLALVSIADLIEWRRKHEKHVQRIA 213

Query: 214 QSDIKVKNQKYKIRIYENLLDGSEHFALIKGNIK----KGIIPRVRVISSNVVQNYLINQ 269
           ++ I  ++ +++   Y ++ D  EH AL+ G+I      G    VRV S  +  +   ++
Sbjct: 214 EARIPTQHGEFRAVGYTSIYDDVEHVALVLGDISGPDGDGNDVLVRVHSECLTGDVFGSR 273

Query: 270 QLP--NSFDKTLNYFKKFNNCVLVFIKDTNLKSV--TQTLKDYKNKNF--------YKKG 317
           +       D  +    K    ++++++    + +     L+ Y+ ++          K G
Sbjct: 274 RCDCGPQLDAAMEMVAKEGRGIVLYMRGHEGRGIGLMHKLQAYQLQDAGEDTVDANLKLG 333

Query: 318 NDKLIRNYGIGAQIIKDLKIKNMILITKSLKKVIGLEGYDIKITKQ 363
                R+YG+GAQI+ DL +K+M L+T +  K +GL+GY + I ++
Sbjct: 334 LPADARDYGLGAQILVDLGVKSMRLLTNNPAKRVGLDGYGLHIIER 379


>RIBB_HAEIG RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 215

 Score =  169 bits (427), Expect = 5e-44
 Identities = 86/190 (45%), Positives = 119/190 (62%)

Query: 13  INIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQAKRLN 72
           IN  K G   +++DDE RENEGDLI      + + +  + +YG G++CL +   + ++L+
Sbjct: 21  INAFKNGTGVLVLDDEDRENEGDLIFPAETITPEQMAKLIRYGSGIVCLCITDERCQQLD 80

Query: 73  LSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPGHVFP 132
           L  M   N S NKTAFT++IEA KG++TG+SA DR               D+  PGHVFP
Sbjct: 81  LPSMVEHNNSVNKTAFTVTIEAAKGVSTGVSAADRVTTIQTAIADNAVPTDLHRPGHVFP 140

Query: 133 IIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKHNLKI 192
           + A +GGVL R GHTEASVD+++LA    + VICEI N+DGTMA+  D+ +FA K    +
Sbjct: 141 LRAVNGGVLTRRGHTEASVDLARLAGFKEAGVICEITNDDGTMARTPDIVEFAKKFGYSV 200

Query: 193 GKIEDLIAYR 202
             IEDL+ YR
Sbjct: 201 LTIEDLVEYR 210


>RIBB_PASMU RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 214

 Score =  168 bits (426), Expect = 6e-44
 Identities = 85/190 (44%), Positives = 118/190 (62%)

Query: 13  INIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQAKRLN 72
           IN  K+G   +++DDE RENEGDLI      + + +  + +YG G++CL L     ++L+
Sbjct: 20  INAFKQGNGVLVLDDEDRENEGDLIFPAETITVEQMTMLIRYGSGIVCLCLSDEICQQLD 79

Query: 73  LSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPGHVFP 132
           L  M   N S NKTAFT++IEA KG++TG+SA DR               D+  PGH+FP
Sbjct: 80  LPPMVTENTSVNKTAFTVTIEAAKGVSTGVSATDRVTTIRAAVADNAKPSDLSRPGHIFP 139

Query: 133 IIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKHNLKI 192
           + A  GGVL R GHTEASVD+++LA    + VICEI N+DG+MA+  ++  FA K    +
Sbjct: 140 LRAMTGGVLKRRGHTEASVDLARLAGYKAAGVICEITNDDGSMARAPEIVTFAQKFGFPV 199

Query: 193 GKIEDLIAYR 202
             IEDL+AYR
Sbjct: 200 VTIEDLVAYR 209


>RIBB_HAEIN RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 215

 Score =  168 bits (425), Expect = 8e-44
 Identities = 85/190 (44%), Positives = 119/190 (62%)

Query: 13  INIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQAKRLN 72
           IN  K G   +++DDE RENEGDLI      + + +  + +YG G++CL +   + ++L+
Sbjct: 21  INAFKNGTGVLVLDDEDRENEGDLIFPAETITPEQMAKLIRYGSGIVCLCITDERCQQLD 80

Query: 73  LSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPGHVFP 132
           L  M   N S NKTAFT++IEA KG++TG+SA DR               D+  PGHVFP
Sbjct: 81  LPPMVEHNNSVNKTAFTVTIEAAKGVSTGVSAADRVTTIQTAIADNAVLTDLHRPGHVFP 140

Query: 133 IIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKHNLKI 192
           + A +GGVL R GHTEASVD+++LA    + VICEI N+DGTMA+  ++ +FA K    +
Sbjct: 141 LRAANGGVLTRRGHTEASVDLARLAGFKEAGVICEITNDDGTMARAPEIVEFAKKFGYSV 200

Query: 193 GKIEDLIAYR 202
             IEDL+ YR
Sbjct: 201 LTIEDLVEYR 210


>RIBB_HAEI8 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 215

 Score =  167 bits (424), Expect = 1e-43
 Identities = 85/190 (44%), Positives = 120/190 (63%)

Query: 13  INIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQAKRLN 72
           IN  K G   +++DDE RENEGDLI      +++ +  + +YG G++CL +   + ++L+
Sbjct: 21  INAFKHGTGVLVLDDEDRENEGDLIFPAETITSEQMAKLIRYGSGIVCLCITDERCQQLD 80

Query: 73  LSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPGHVFP 132
           L  M   N S NKTAFT++IEA KG++TG+SA DR               D+  PGHVFP
Sbjct: 81  LPPMVEHNNSVNKTAFTVTIEAAKGVSTGVSAADRVTTIQTAIADNAVPTDLHRPGHVFP 140

Query: 133 IIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKHNLKI 192
           + A +GGVL R GHTEASVD+++LA    + VICEI N+DGTMA+  ++ +FA K    +
Sbjct: 141 LRAANGGVLTRRGHTEASVDLARLAGFKEAGVICEITNDDGTMARTPEIVEFAKKFGYSV 200

Query: 193 GKIEDLIAYR 202
             IEDL+ YR
Sbjct: 201 LTIEDLVEYR 210


>RIBB_WIGBR RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 213

 Score =  167 bits (423), Expect = 1e-43
 Identities = 80/193 (41%), Positives = 124/193 (64%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           +++ +   K+G   +++DDE RENEGD+I +  + +   +    ++G G++C+ L   + 
Sbjct: 16  VKNALQSLKRGNGILVLDDENRENEGDMIFAAENMTVNQMALAIRFGSGIVCICLTKEKC 75

Query: 69  KRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPG 128
           K LNL +M   N S+ KTAFT+SIE+  GITTG+SA DR               D+  PG
Sbjct: 76  KILNLPMMVKKNNSKYKTAFTVSIESAYGITTGVSAYDRIITIKTAIKDNAKPDDLNRPG 135

Query: 129 HVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKH 188
           HVFP+ A  GG+L RAGHTEA+VD++KLA    + VICE+MN+DG+MA+  ++ +F+ K+
Sbjct: 136 HVFPLQAHPGGILSRAGHTEAAVDLTKLAGLKPAGVICEVMNDDGSMARMPEIINFSKKY 195

Query: 189 NLKIGKIEDLIAY 201
           N+ +  I+D+I Y
Sbjct: 196 NMPVLIIKDIIEY 208


>RIBB_CLOBL RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 213

 Score =  167 bits (423), Expect = 1e-43
 Identities = 86/199 (43%), Positives = 118/199 (59%)

Query: 4   NNYASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLAL 63
           N+   +E  +   K G   +LVDDE RENEGDLI      +   +  + +   G++CL L
Sbjct: 11  NSLTRVEKALENLKNGKGVLLVDDENRENEGDLIFPAETITVPQMAMLIRECSGIVCLCL 70

Query: 64  DSVQAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXD 123
              + K+L L+ M   N    +TAFTISIEAK+G+TTG+SA DR               D
Sbjct: 71  TDEKVKKLGLTQMVSNNTCTYETAFTISIEAKEGVTTGVSAADRVTTILTAVKDDCKPED 130

Query: 124 IVSPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFD 183
           +  PGHVFP+ A+ GGVL R GHTE +VD+ +LA  N + ++CE+ N DGTMA+   + +
Sbjct: 131 LCHPGHVFPLRARAGGVLTRPGHTEGTVDLMRLAGYNPAGILCELTNPDGTMARLPQIIN 190

Query: 184 FANKHNLKIGKIEDLIAYR 202
           FA KHNL I  IED+I Y+
Sbjct: 191 FAKKHNLTILSIEDIIKYK 209


>RIBBA_RHOE4 RecName: Full=Riboflavin biosynthesis protein
           ribBA;Includes:  RecName: Full=3,4-dihydroxy-2-butanone
           4-phosphate synthase;
          Length = 424

 Score =  167 bits (423), Expect = 1e-43
 Identities = 111/347 (31%), Positives = 184/347 (53%), Gaps = 24/347 (6%)

Query: 36  LIISTTDSSAKNINFMAKYGRGLICLALDSVQAKRLNLSLMSPINQSRNKTAFTISIEAK 95
           LI +   ++ + + FM +Y  G +C+ LD     RL L  M   NQ ++ TA+T++++A+
Sbjct: 34  LIFAAEKATPELVAFMVRYTSGYLCVPLDGDDCDRLGLPPMYATNQDKHGTAYTVTVDAR 93

Query: 96  KGITTGISAKDRXXXXXXXXXXXXXXXDIVSPGHVFPIIAKDGGVLVRAGHTEASVDISK 155
           +GI TGISA DR               D   PGHV P+ AK+GGVL R GHTEA+VD+++
Sbjct: 94  EGIGTGISASDRAATMRLLANPESGANDFTRPGHVVPLRAKEGGVLRRPGHTEAAVDLAR 153

Query: 156 LAKKNNSAVICEIMN--EDGTMAKGQDLFDFANKHNLKIGKIEDLIAYRXXXXXXXXXXX 213
           +A    + VICEI++  ++G MA+  +L  FA++HNL +  I DLIA+R           
Sbjct: 154 MADLRPAGVICEIVSQKDEGAMAQTDELRVFADEHNLALISIADLIAWRRKHEKHVLRIA 213

Query: 214 QSDIKVKNQKYKIRIYENLLDGSEHFALIKGNIK----KGIIPRVRVISSNVVQNYL--I 267
           ++ I  ++ ++    Y ++ D  EH AL++G+I      G    VRV S  +  +    +
Sbjct: 214 EARIPTRHGEFTAVGYTSIYDEVEHVALVRGDIAGPDGDGSDVLVRVHSECLTGDVFGSL 273

Query: 268 NQQLPNSFDKTLNYFKKFNNCVLVFIKDTNLKSV--TQTLKDYKNKNFYKKGNDKL---- 321
                   D  L+   +    V+++++    + +     L+ Y+ ++    G+D +    
Sbjct: 274 RCDCGPQLDAALDMVAQEGRGVVLYMRGHEGRGIGLMHKLQAYQLQD---AGSDTVDANL 330

Query: 322 -------IRNYGIGAQIIKDLKIKNMILITKSLKKVIGLEGYDIKIT 361
                   R+YGIGAQI+ DL I +M L+T +  K +GL+GY ++IT
Sbjct: 331 ELGLPADARDYGIGAQILVDLGISSMRLLTNNPAKRVGLDGYGLQIT 377


>RIBBA_NOCFA RecName: Full=Riboflavin biosynthesis protein
           ribBA;Includes:  RecName: Full=3,4-dihydroxy-2-butanone
           4-phosphate synthase;
          Length = 414

 Score =  167 bits (423), Expect = 1e-43
 Identities = 119/342 (34%), Positives = 191/342 (55%), Gaps = 14/342 (4%)

Query: 36  LIISTTDSSAKNINFMAKYGRGLICLALDSVQAKRLNLSLMSPINQSRNKTAFTISIEAK 95
           LI +   ++ + + FM +Y  G IC+ L      RL L  M   NQ ++ TA+T+S++A+
Sbjct: 34  LIFAAEKATPELVAFMIRYTSGYICVPLTGEDCDRLGLPPMYATNQDKHGTAYTVSVDAR 93

Query: 96  KGITTGISAKDRXXXXXXXXXXXXXXXDIVSPGHVFPIIAKDGGVLVRAGHTEASVDISK 155
           +GITTGISA DR                   PGHV P+ AKDGGVL R GHTEA+VD+++
Sbjct: 94  EGITTGISAADRATTMRXXXXXXXXXXXXTRPGHVVPLRAKDGGVLRRPGHTEAAVDLAR 153

Query: 156 LAKKNNSAVICEIMN--EDGTMAKGQDLFDFANKHNLKIGKIEDLIAYRXXXXXXXXXXX 213
           +A    + VICEI++  ++G MA+ ++L  FA+ H+L +  I D+IA+R           
Sbjct: 154 MAGLRPAGVICEIVSQKDEGHMARTEELRVFADDHDLALISIADMIAWRRKHEKQVVRVA 213

Query: 214 QSDIKVKNQKYKIRIYENLLDGSEHFALIKGNIKKGIIPRVRVISSNVVQNYL--INQQL 271
           ++ I   +  +    Y+++ D  EH AL++G+I  G    VRV S  +  +    +    
Sbjct: 214 EARIPTAHGAFTAVGYQSIYDDVEHVALVRGDIGDGEDVLVRVHSECLTGDVFGSLRCDC 273

Query: 272 PNSFDKTLNYFKKFNNCVLVFIKDTNLKSV--TQTLKDYKNKNFYKKGNDKLI------- 322
               D  L    +    V+++++    + +     L+ Y+ ++  +   D  +       
Sbjct: 274 GPQLDAALEMVDQEGRGVVLYMRGHEGRGIGLMHKLQAYQLQDSGRDTVDANLDLGLPAD 333

Query: 323 -RNYGIGAQIIKDLKIKNMILITKSLKKVIGLEGYDIKITKQ 363
            R+YG GAQI+ DL I++M L+T +  K +GL+GY + IT++
Sbjct: 334 ARDYGTGAQILVDLGIRSMRLLTNNPAKRVGLDGYGLTITER 375


>RIBB_VIBPA RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 218

 Score =  166 bits (420), Expect = 3e-43
 Identities = 82/194 (42%), Positives = 119/194 (61%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           +E+ +   K+G   +L+DDE RENEGD+I S    + + +  M +   G++CL L   QA
Sbjct: 17  VENALIALKEGRGVLLLDDEDRENEGDIIYSVEHLTNEQMALMIRECSGIVCLCLTDAQA 76

Query: 69  KRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPG 128
            +L L  M   N S N+TAFT+SIEAK G+TTG+SA DR               D+  PG
Sbjct: 77  DKLELPPMVVNNNSANQTAFTVSIEAKVGVTTGVSAADRVTTIKTAANPHAKPEDLARPG 136

Query: 129 HVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKH 188
           HVFP+ A+ GGV+ R GHTE ++D+ ++A    + V+CE+ N DGTMAK  ++  F + H
Sbjct: 137 HVFPLRARPGGVMTRRGHTEGTIDLMQMAGLQPAGVLCEVTNPDGTMAKAPEIVAFGHLH 196

Query: 189 NLKIGKIEDLIAYR 202
           N+ +  IED++AYR
Sbjct: 197 NMPVLTIEDMVAYR 210


>RIBB_PSEHT RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 217

 Score =  166 bits (420), Expect = 3e-43
 Identities = 85/193 (44%), Positives = 120/193 (62%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           +E+ I   ++G   ++VDDE RENEGD + S    +   +  M + G G++CL +   + 
Sbjct: 16  VENAITALQQGQGVLVVDDENRENEGDFVFSAEHLTTAQMAEMIREGSGIVCLCMGEERI 75

Query: 69  KRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPG 128
           K+L+L  M   N S+N TA+TI+IEAK+G+TTG+SA DR               D+  PG
Sbjct: 76  KQLDLPQMVTHNTSQNNTAYTITIEAKEGVTTGVSAADRVTTIKAATADNAKPEDLSRPG 135

Query: 129 HVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKH 188
           HVF + AK GGVLVR GHTEASVD+ +LA      VICE+ N DG+MA+  ++  +ANKH
Sbjct: 136 HVFGLKAKTGGVLVRRGHTEASVDLMQLAGLKPFGVICELTNPDGSMARLPEVSGYANKH 195

Query: 189 NLKIGKIEDLIAY 201
           N+ +  IEDL+ Y
Sbjct: 196 NMPVVSIEDLVQY 208


>RIBB_CLOBH RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 213

 Score =  166 bits (420), Expect = 3e-43
 Identities = 85/199 (42%), Positives = 118/199 (59%)

Query: 4   NNYASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLAL 63
           N+   +E  +   K G   +LVDDE RENEGDLI      +   +  + +   G++CL L
Sbjct: 11  NSLTRVEKALENLKNGKGVLLVDDENRENEGDLIFPAETITVPQMVMLIRECSGIVCLCL 70

Query: 64  DSVQAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXD 123
              + K+L L+ M   N    +TAFTISIEAK+G+TTG+SA DR               D
Sbjct: 71  TDKKVKKLGLTQMVHNNTCTYETAFTISIEAKEGVTTGVSAADRVTTILTAVKDDCKPED 130

Query: 124 IVSPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFD 183
           +  PGHVFP+ A+ GGVL R GHTE +VD+ +LA  N + ++CE+ N DGTMA+   + +
Sbjct: 131 LCHPGHVFPLRARAGGVLTRPGHTEGTVDLMRLAGYNPAGILCELTNPDGTMARLPQIIN 190

Query: 184 FANKHNLKIGKIEDLIAYR 202
           FA KHNL +  IED+I Y+
Sbjct: 191 FAKKHNLAVLSIEDIIKYK 209


>RIBB_CLOB1 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 213

 Score =  166 bits (420), Expect = 3e-43
 Identities = 85/199 (42%), Positives = 118/199 (59%)

Query: 4   NNYASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLAL 63
           N+   +E  +   K G   +LVDDE RENEGDLI      +   +  + +   G++CL L
Sbjct: 11  NSLTRVEKALENLKNGKGVLLVDDENRENEGDLIFPAETITVPQMVMLIRECSGIVCLCL 70

Query: 64  DSVQAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXD 123
              + K+L L+ M   N    +TAFTISIEAK+G+TTG+SA DR               D
Sbjct: 71  TDKKVKKLGLTQMVHNNTCTYETAFTISIEAKEGVTTGVSAADRVTTILTAVKDDCKPED 130

Query: 124 IVSPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFD 183
           +  PGHVFP+ A+ GGVL R GHTE +VD+ +LA  N + ++CE+ N DGTMA+   + +
Sbjct: 131 LCHPGHVFPLRARAGGVLTRPGHTEGTVDLMRLAGYNPAGILCELTNPDGTMARLPQIIN 190

Query: 184 FANKHNLKIGKIEDLIAYR 202
           FA KHNL +  IED+I Y+
Sbjct: 191 FAKKHNLAVLSIEDIIKYK 209


>RIBB_BLOFL RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 213

 Score =  166 bits (419), Expect = 4e-43
 Identities = 81/190 (42%), Positives = 120/190 (63%)

Query: 13  INIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQAKRLN 72
           ++    G   ++VDDE RENEGD+I +  + + K +    +YG G++CL L   + ++L 
Sbjct: 20  LDALSNGRGILVVDDENRENEGDMIFAAENMTVKQMALAIRYGSGIVCLCLTEEKCRQLK 79

Query: 73  LSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPGHVFP 132
           L +M   N +  KTAFT++IEA KGITTG+SAKDR               D+  PGHVFP
Sbjct: 80  LPMMVKNNSNHYKTAFTVTIEASKGITTGVSAKDRLTTIKTSIEDYAKPSDLNRPGHVFP 139

Query: 133 IIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKHNLKI 192
           + A +GGVL R+GHTEA+VD++ LA      VICE+ NEDG+MA+  ++  F+ ++++ +
Sbjct: 140 LRAHNGGVLSRSGHTEAAVDLTTLAGLKPFGVICEVTNEDGSMARTTEIIKFSKQYDMPV 199

Query: 193 GKIEDLIAYR 202
             I D+IAYR
Sbjct: 200 LTISDVIAYR 209


>RIBB_SODGM RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 217

 Score =  165 bits (418), Expect = 5e-43
 Identities = 78/194 (40%), Positives = 122/194 (62%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           +E+ +   + G   +++DDE RENEGD+I +  + + + +    +YG G++CL L   + 
Sbjct: 16  VENALESLRNGRGVLVLDDEDRENEGDMIFAAQNMTVEQMALTIRYGSGIVCLCLTEERR 75

Query: 69  KRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPG 128
           ++L L +M   N S  +TAFT++IEA +G++TG+SA DR               D+  PG
Sbjct: 76  QQLALPMMVERNSSHYQTAFTVTIEAAEGVSTGVSAADRLTTIRAAIKDNAKPTDLNRPG 135

Query: 129 HVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKH 188
           HVFP+ A+ GGVLVR GHTEA+VD++ LA    + V+CE+ N+DG+MA   ++  F  +H
Sbjct: 136 HVFPLCAQPGGVLVRGGHTEAAVDLTTLAGLKPAGVLCEVTNDDGSMAHAPEIIAFGRRH 195

Query: 189 NLKIGKIEDLIAYR 202
           N+ +  IEDL+AYR
Sbjct: 196 NMPVLTIEDLVAYR 209


>RIBB_SHISS RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 217

 Score =  165 bits (417), Expect = 7e-43
 Identities = 79/197 (40%), Positives = 122/197 (61%)

Query: 6   YASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDS 65
           +  +E+ +   ++G   +++DDE RENEGD+I      + + +    ++G G++CL +  
Sbjct: 13  FERVENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITE 72

Query: 66  VQAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIV 125
            + K+L+L +M   N S   T FT++IEA +G+TTG+SA DR               D+ 
Sbjct: 73  DRRKQLDLPMMVENNTSAYGTGFTVTIEAAEGVTTGVSAADRITTVRAAIADGAKPSDLN 132

Query: 126 SPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFA 185
            PGHVFP+ A+ GGVL R GHTEA++D+  LA    + V+CE+ N+DGTMA+  +  +FA
Sbjct: 133 RPGHVFPLRAQAGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFA 192

Query: 186 NKHNLKIGKIEDLIAYR 202
           NKHN+ +  IEDL+AYR
Sbjct: 193 NKHNMALVTIEDLVAYR 209


>RIBB_SHIFL RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 217

 Score =  165 bits (417), Expect = 7e-43
 Identities = 79/197 (40%), Positives = 122/197 (61%)

Query: 6   YASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDS 65
           +  +E+ +   ++G   +++DDE RENEGD+I      + + +    ++G G++CL +  
Sbjct: 13  FERVENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITE 72

Query: 66  VQAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIV 125
            + K+L+L +M   N S   T FT++IEA +G+TTG+SA DR               D+ 
Sbjct: 73  DRRKQLDLPMMVENNTSAYGTGFTVTIEAAEGVTTGVSAADRITTVRAAIADGAKPSDLN 132

Query: 126 SPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFA 185
            PGHVFP+ A+ GGVL R GHTEA++D+  LA    + V+CE+ N+DGTMA+  +  +FA
Sbjct: 133 RPGHVFPLRAQAGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFA 192

Query: 186 NKHNLKIGKIEDLIAYR 202
           NKHN+ +  IEDL+AYR
Sbjct: 193 NKHNMALVTIEDLVAYR 209


>RIBB_SHIF8 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 217

 Score =  165 bits (417), Expect = 7e-43
 Identities = 79/197 (40%), Positives = 122/197 (61%)

Query: 6   YASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDS 65
           +  +E+ +   ++G   +++DDE RENEGD+I      + + +    ++G G++CL +  
Sbjct: 13  FERVENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITE 72

Query: 66  VQAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIV 125
            + K+L+L +M   N S   T FT++IEA +G+TTG+SA DR               D+ 
Sbjct: 73  DRRKQLDLPMMVENNTSAYGTGFTVTIEAAEGVTTGVSAADRITTVRAAIADGAKPSDLN 132

Query: 126 SPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFA 185
            PGHVFP+ A+ GGVL R GHTEA++D+  LA    + V+CE+ N+DGTMA+  +  +FA
Sbjct: 133 RPGHVFPLRAQAGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFA 192

Query: 186 NKHNLKIGKIEDLIAYR 202
           NKHN+ +  IEDL+AYR
Sbjct: 193 NKHNMALVTIEDLVAYR 209


>RIBB_SHIDS RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 217

 Score =  165 bits (417), Expect = 7e-43
 Identities = 79/197 (40%), Positives = 122/197 (61%)

Query: 6   YASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDS 65
           +  +E+ +   ++G   +++DDE RENEGD+I      + + +    ++G G++CL +  
Sbjct: 13  FERVENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITE 72

Query: 66  VQAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIV 125
            + K+L+L +M   N S   T FT++IEA +G+TTG+SA DR               D+ 
Sbjct: 73  DRRKQLDLPMMVENNTSAYGTGFTVTIEAAEGVTTGVSAADRITTVRAAIADGAKPSDLN 132

Query: 126 SPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFA 185
            PGHVFP+ A+ GGVL R GHTEA++D+  LA    + V+CE+ N+DGTMA+  +  +FA
Sbjct: 133 RPGHVFPLRAQAGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFA 192

Query: 186 NKHNLKIGKIEDLIAYR 202
           NKHN+ +  IEDL+AYR
Sbjct: 193 NKHNMALVTIEDLVAYR 209


>RIBB_SHIBS RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 217

 Score =  165 bits (417), Expect = 7e-43
 Identities = 79/197 (40%), Positives = 122/197 (61%)

Query: 6   YASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDS 65
           +  +E+ +   ++G   +++DDE RENEGD+I      + + +    ++G G++CL +  
Sbjct: 13  FERVENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITE 72

Query: 66  VQAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIV 125
            + K+L+L +M   N S   T FT++IEA +G+TTG+SA DR               D+ 
Sbjct: 73  DRRKQLDLPMMVENNTSAYGTGFTVTIEAAEGVTTGVSAADRITTVRAAIADGAKPSDLN 132

Query: 126 SPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFA 185
            PGHVFP+ A+ GGVL R GHTEA++D+  LA    + V+CE+ N+DGTMA+  +  +FA
Sbjct: 133 RPGHVFPLRAQAGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFA 192

Query: 186 NKHNLKIGKIEDLIAYR 202
           NKHN+ +  IEDL+AYR
Sbjct: 193 NKHNMALVTIEDLVAYR 209


>RIBB_SHIB3 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 217

 Score =  165 bits (417), Expect = 7e-43
 Identities = 79/197 (40%), Positives = 122/197 (61%)

Query: 6   YASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDS 65
           +  +E+ +   ++G   +++DDE RENEGD+I      + + +    ++G G++CL +  
Sbjct: 13  FERVENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITE 72

Query: 66  VQAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIV 125
            + K+L+L +M   N S   T FT++IEA +G+TTG+SA DR               D+ 
Sbjct: 73  DRRKQLDLPMMVENNTSAYGTGFTVTIEAAEGVTTGVSAADRITTVRAAIADGAKPSDLN 132

Query: 126 SPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFA 185
            PGHVFP+ A+ GGVL R GHTEA++D+  LA    + V+CE+ N+DGTMA+  +  +FA
Sbjct: 133 RPGHVFPLRAQAGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFA 192

Query: 186 NKHNLKIGKIEDLIAYR 202
           NKHN+ +  IEDL+AYR
Sbjct: 193 NKHNMALVTIEDLVAYR 209


>RIBB_ECOUT RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 217

 Score =  165 bits (417), Expect = 7e-43
 Identities = 79/197 (40%), Positives = 122/197 (61%)

Query: 6   YASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDS 65
           +  +E+ +   ++G   +++DDE RENEGD+I      + + +    ++G G++CL +  
Sbjct: 13  FERVENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITD 72

Query: 66  VQAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIV 125
            + K+L+L +M   N S   T FT++IEA +G+TTG+SA DR               D+ 
Sbjct: 73  DRRKQLDLPMMVENNTSAYGTGFTVTIEAAEGVTTGVSAADRITTVRAAIADGAKPSDLN 132

Query: 126 SPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFA 185
            PGHVFP+ A+ GGVL R GHTEA++D+  LA    + V+CE+ N+DGTMA+  +  +FA
Sbjct: 133 RPGHVFPLRAQAGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFA 192

Query: 186 NKHNLKIGKIEDLIAYR 202
           NKHN+ +  IEDL+AYR
Sbjct: 193 NKHNMALVTIEDLVAYR 209


>RIBB_ECOSM RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 217

 Score =  165 bits (417), Expect = 7e-43
 Identities = 79/197 (40%), Positives = 122/197 (61%)

Query: 6   YASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDS 65
           +  +E+ +   ++G   +++DDE RENEGD+I      + + +    ++G G++CL +  
Sbjct: 13  FERVENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITE 72

Query: 66  VQAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIV 125
            + K+L+L +M   N S   T FT++IEA +G+TTG+SA DR               D+ 
Sbjct: 73  DRRKQLDLPMMVENNTSAYGTGFTVTIEAAEGVTTGVSAADRITTVRAAIADDAKPSDLN 132

Query: 126 SPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFA 185
            PGHVFP+ A+ GGVL R GHTEA++D+  LA    + V+CE+ N+DGTMA+  +  +FA
Sbjct: 133 RPGHVFPLRAQAGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFA 192

Query: 186 NKHNLKIGKIEDLIAYR 202
           NKHN+ +  IEDL+AYR
Sbjct: 193 NKHNMALVTIEDLVAYR 209


>RIBB_ECOSE RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 217

 Score =  165 bits (417), Expect = 7e-43
 Identities = 79/197 (40%), Positives = 122/197 (61%)

Query: 6   YASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDS 65
           +  +E+ +   ++G   +++DDE RENEGD+I      + + +    ++G G++CL +  
Sbjct: 13  FERVENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITE 72

Query: 66  VQAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIV 125
            + K+L+L +M   N S   T FT++IEA +G+TTG+SA DR               D+ 
Sbjct: 73  DRRKQLDLPMMVENNTSAYGTGFTVTIEAAEGVTTGVSAADRITTVRAAIADGAKPSDLN 132

Query: 126 SPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFA 185
            PGHVFP+ A+ GGVL R GHTEA++D+  LA    + V+CE+ N+DGTMA+  +  +FA
Sbjct: 133 RPGHVFPLRAQAGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFA 192

Query: 186 NKHNLKIGKIEDLIAYR 202
           NKHN+ +  IEDL+AYR
Sbjct: 193 NKHNMALVTIEDLVAYR 209


>RIBB_ECOLU RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 217

 Score =  165 bits (417), Expect = 7e-43
 Identities = 79/197 (40%), Positives = 122/197 (61%)

Query: 6   YASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDS 65
           +  +E+ +   ++G   +++DDE RENEGD+I      + + +    ++G G++CL +  
Sbjct: 13  FERVENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITE 72

Query: 66  VQAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIV 125
            + K+L+L +M   N S   T FT++IEA +G+TTG+SA DR               D+ 
Sbjct: 73  DRRKQLDLPMMVENNTSAYGTGFTVTIEAAEGVTTGVSAADRITTVRAAIADDAKPSDLN 132

Query: 126 SPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFA 185
            PGHVFP+ A+ GGVL R GHTEA++D+  LA    + V+CE+ N+DGTMA+  +  +FA
Sbjct: 133 RPGHVFPLRAQAGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFA 192

Query: 186 NKHNLKIGKIEDLIAYR 202
           NKHN+ +  IEDL+AYR
Sbjct: 193 NKHNMALVTIEDLVAYR 209


>RIBB_ECOLI RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 217

 Score =  165 bits (417), Expect = 7e-43
 Identities = 79/197 (40%), Positives = 122/197 (61%)

Query: 6   YASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDS 65
           +  +E+ +   ++G   +++DDE RENEGD+I      + + +    ++G G++CL +  
Sbjct: 13  FERVENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITE 72

Query: 66  VQAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIV 125
            + K+L+L +M   N S   T FT++IEA +G+TTG+SA DR               D+ 
Sbjct: 73  DRRKQLDLPMMVENNTSAYGTGFTVTIEAAEGVTTGVSAADRITTVRAAIADGAKPSDLN 132

Query: 126 SPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFA 185
            PGHVFP+ A+ GGVL R GHTEA++D+  LA    + V+CE+ N+DGTMA+  +  +FA
Sbjct: 133 RPGHVFPLRAQAGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFA 192

Query: 186 NKHNLKIGKIEDLIAYR 202
           NKHN+ +  IEDL+AYR
Sbjct: 193 NKHNMALVTIEDLVAYR 209


>RIBB_ECOLC RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 217

 Score =  165 bits (417), Expect = 7e-43
 Identities = 79/197 (40%), Positives = 122/197 (61%)

Query: 6   YASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDS 65
           +  +E+ +   ++G   +++DDE RENEGD+I      + + +    ++G G++CL +  
Sbjct: 13  FERVENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITE 72

Query: 66  VQAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIV 125
            + K+L+L +M   N S   T FT++IEA +G+TTG+SA DR               D+ 
Sbjct: 73  DRRKQLDLPMMVENNTSAYGTGFTVTIEAAEGVTTGVSAADRITTVRAAIADGAKPSDLN 132

Query: 126 SPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFA 185
            PGHVFP+ A+ GGVL R GHTEA++D+  LA    + V+CE+ N+DGTMA+  +  +FA
Sbjct: 133 RPGHVFPLRAQAGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFA 192

Query: 186 NKHNLKIGKIEDLIAYR 202
           NKHN+ +  IEDL+AYR
Sbjct: 193 NKHNMALVTIEDLVAYR 209


>RIBB_ECOL6 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 217

 Score =  165 bits (417), Expect = 7e-43
 Identities = 79/197 (40%), Positives = 122/197 (61%)

Query: 6   YASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDS 65
           +  +E+ +   ++G   +++DDE RENEGD+I      + + +    ++G G++CL +  
Sbjct: 13  FERVENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITD 72

Query: 66  VQAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIV 125
            + K+L+L +M   N S   T FT++IEA +G+TTG+SA DR               D+ 
Sbjct: 73  DRRKQLDLPMMVENNTSAYGTGFTVTIEAAEGVTTGVSAADRITTVRAAIADGAKPSDLN 132

Query: 126 SPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFA 185
            PGHVFP+ A+ GGVL R GHTEA++D+  LA    + V+CE+ N+DGTMA+  +  +FA
Sbjct: 133 RPGHVFPLRAQAGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFA 192

Query: 186 NKHNLKIGKIEDLIAYR 202
           NKHN+ +  IEDL+AYR
Sbjct: 193 NKHNMALVTIEDLVAYR 209


>RIBB_ECOL5 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 217

 Score =  165 bits (417), Expect = 7e-43
 Identities = 79/197 (40%), Positives = 122/197 (61%)

Query: 6   YASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDS 65
           +  +E+ +   ++G   +++DDE RENEGD+I      + + +    ++G G++CL +  
Sbjct: 13  FERVENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITE 72

Query: 66  VQAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIV 125
            + K+L+L +M   N S   T FT++IEA +G+TTG+SA DR               D+ 
Sbjct: 73  DRRKQLDLPMMVENNTSAYGTGFTVTIEAAEGVTTGVSAADRITTVRAAIADGAKPSDLN 132

Query: 126 SPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFA 185
            PGHVFP+ A+ GGVL R GHTEA++D+  LA    + V+CE+ N+DGTMA+  +  +FA
Sbjct: 133 RPGHVFPLRAQAGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFA 192

Query: 186 NKHNLKIGKIEDLIAYR 202
           NKHN+ +  IEDL+AYR
Sbjct: 193 NKHNMALVTIEDLVAYR 209


>RIBB_ECOK1 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 217

 Score =  165 bits (417), Expect = 7e-43
 Identities = 79/197 (40%), Positives = 122/197 (61%)

Query: 6   YASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDS 65
           +  +E+ +   ++G   +++DDE RENEGD+I      + + +    ++G G++CL +  
Sbjct: 13  FERVENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITD 72

Query: 66  VQAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIV 125
            + K+L+L +M   N S   T FT++IEA +G+TTG+SA DR               D+ 
Sbjct: 73  DRRKQLDLPMMVENNTSAYGTGFTVTIEAAEGVTTGVSAADRITTVRAAIADGAKPSDLN 132

Query: 126 SPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFA 185
            PGHVFP+ A+ GGVL R GHTEA++D+  LA    + V+CE+ N+DGTMA+  +  +FA
Sbjct: 133 RPGHVFPLRAQAGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFA 192

Query: 186 NKHNLKIGKIEDLIAYR 202
           NKHN+ +  IEDL+AYR
Sbjct: 193 NKHNMALVTIEDLVAYR 209


>RIBB_ECOHS RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 217

 Score =  165 bits (417), Expect = 7e-43
 Identities = 79/197 (40%), Positives = 122/197 (61%)

Query: 6   YASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDS 65
           +  +E+ +   ++G   +++DDE RENEGD+I      + + +    ++G G++CL +  
Sbjct: 13  FERVENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITE 72

Query: 66  VQAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIV 125
            + K+L+L +M   N S   T FT++IEA +G+TTG+SA DR               D+ 
Sbjct: 73  DRRKQLDLPMMVENNTSAYGTGFTVTIEAAEGVTTGVSAADRITTVRAAIADGAKPSDLN 132

Query: 126 SPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFA 185
            PGHVFP+ A+ GGVL R GHTEA++D+  LA    + V+CE+ N+DGTMA+  +  +FA
Sbjct: 133 RPGHVFPLRAQAGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFA 192

Query: 186 NKHNLKIGKIEDLIAYR 202
           NKHN+ +  IEDL+AYR
Sbjct: 193 NKHNMALVTIEDLVAYR 209


>RIBB_ECODH RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 217

 Score =  165 bits (417), Expect = 7e-43
 Identities = 79/197 (40%), Positives = 122/197 (61%)

Query: 6   YASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDS 65
           +  +E+ +   ++G   +++DDE RENEGD+I      + + +    ++G G++CL +  
Sbjct: 13  FERVENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITE 72

Query: 66  VQAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIV 125
            + K+L+L +M   N S   T FT++IEA +G+TTG+SA DR               D+ 
Sbjct: 73  DRRKQLDLPMMVENNTSAYGTGFTVTIEAAEGVTTGVSAADRITTVRAAIADGAKPSDLN 132

Query: 126 SPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFA 185
            PGHVFP+ A+ GGVL R GHTEA++D+  LA    + V+CE+ N+DGTMA+  +  +FA
Sbjct: 133 RPGHVFPLRAQAGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFA 192

Query: 186 NKHNLKIGKIEDLIAYR 202
           NKHN+ +  IEDL+AYR
Sbjct: 193 NKHNMALVTIEDLVAYR 209


>RIBB_ECOBW RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 217

 Score =  165 bits (417), Expect = 7e-43
 Identities = 79/197 (40%), Positives = 122/197 (61%)

Query: 6   YASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDS 65
           +  +E+ +   ++G   +++DDE RENEGD+I      + + +    ++G G++CL +  
Sbjct: 13  FERVENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITE 72

Query: 66  VQAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIV 125
            + K+L+L +M   N S   T FT++IEA +G+TTG+SA DR               D+ 
Sbjct: 73  DRRKQLDLPMMVENNTSAYGTGFTVTIEAAEGVTTGVSAADRITTVRAAIADGAKPSDLN 132

Query: 126 SPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFA 185
            PGHVFP+ A+ GGVL R GHTEA++D+  LA    + V+CE+ N+DGTMA+  +  +FA
Sbjct: 133 RPGHVFPLRAQAGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFA 192

Query: 186 NKHNLKIGKIEDLIAYR 202
           NKHN+ +  IEDL+AYR
Sbjct: 193 NKHNMALVTIEDLVAYR 209


>RIBB_ECO8A RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 217

 Score =  165 bits (417), Expect = 7e-43
 Identities = 79/197 (40%), Positives = 122/197 (61%)

Query: 6   YASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDS 65
           +  +E+ +   ++G   +++DDE RENEGD+I      + + +    ++G G++CL +  
Sbjct: 13  FERVENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITE 72

Query: 66  VQAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIV 125
            + K+L+L +M   N S   T FT++IEA +G+TTG+SA DR               D+ 
Sbjct: 73  DRRKQLDLPMMVENNTSAYGTGFTVTIEAAEGVTTGVSAADRITTVRAAIADGAKPSDLN 132

Query: 126 SPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFA 185
            PGHVFP+ A+ GGVL R GHTEA++D+  LA    + V+CE+ N+DGTMA+  +  +FA
Sbjct: 133 RPGHVFPLRAQAGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFA 192

Query: 186 NKHNLKIGKIEDLIAYR 202
           NKHN+ +  IEDL+AYR
Sbjct: 193 NKHNMALVTIEDLVAYR 209


>RIBB_ECO81 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 217

 Score =  165 bits (417), Expect = 7e-43
 Identities = 79/197 (40%), Positives = 122/197 (61%)

Query: 6   YASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDS 65
           +  +E+ +   ++G   +++DDE RENEGD+I      + + +    ++G G++CL +  
Sbjct: 13  FERVENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITD 72

Query: 66  VQAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIV 125
            + K+L+L +M   N S   T FT++IEA +G+TTG+SA DR               D+ 
Sbjct: 73  DRRKQLDLPMMVENNTSAYGTGFTVTIEAAEGVTTGVSAADRITTVRAAIADGAKPSDLN 132

Query: 126 SPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFA 185
            PGHVFP+ A+ GGVL R GHTEA++D+  LA    + V+CE+ N+DGTMA+  +  +FA
Sbjct: 133 RPGHVFPLRAQAGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFA 192

Query: 186 NKHNLKIGKIEDLIAYR 202
           NKHN+ +  IEDL+AYR
Sbjct: 193 NKHNMALVTIEDLVAYR 209


>RIBB_ECO7I RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 217

 Score =  165 bits (417), Expect = 7e-43
 Identities = 79/197 (40%), Positives = 122/197 (61%)

Query: 6   YASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDS 65
           +  +E+ +   ++G   +++DDE RENEGD+I      + + +    ++G G++CL +  
Sbjct: 13  FERVENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITE 72

Query: 66  VQAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIV 125
            + K+L+L +M   N S   T FT++IEA +G+TTG+SA DR               D+ 
Sbjct: 73  DRRKQLDLPMMVENNTSAYGTGFTVTIEAAEGVTTGVSAADRITTVRAAIADGAKPSDLN 132

Query: 126 SPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFA 185
            PGHVFP+ A+ GGVL R GHTEA++D+  LA    + V+CE+ N+DGTMA+  +  +FA
Sbjct: 133 RPGHVFPLRAQAGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFA 192

Query: 186 NKHNLKIGKIEDLIAYR 202
           NKHN+ +  IEDL+AYR
Sbjct: 193 NKHNMALVTIEDLVAYR 209


>RIBB_ECO5E RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 217

 Score =  165 bits (417), Expect = 7e-43
 Identities = 79/197 (40%), Positives = 122/197 (61%)

Query: 6   YASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDS 65
           +  +E+ +   ++G   +++DDE RENEGD+I      + + +    ++G G++CL +  
Sbjct: 13  FERVENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITE 72

Query: 66  VQAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIV 125
            + K+L+L +M   N S   T FT++IEA +G+TTG+SA DR               D+ 
Sbjct: 73  DRRKQLDLPMMVENNTSAYGTGFTVTIEAAEGVTTGVSAADRITTVRAAIADGAKPSDLN 132

Query: 126 SPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFA 185
            PGHVFP+ A+ GGVL R GHTEA++D+  LA    + V+CE+ N+DGTMA+  +  +FA
Sbjct: 133 RPGHVFPLRAQAGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFA 192

Query: 186 NKHNLKIGKIEDLIAYR 202
           NKHN+ +  IEDL+AYR
Sbjct: 193 NKHNMALVTIEDLVAYR 209


>RIBB_ECO57 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 217

 Score =  165 bits (417), Expect = 7e-43
 Identities = 79/197 (40%), Positives = 122/197 (61%)

Query: 6   YASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDS 65
           +  +E+ +   ++G   +++DDE RENEGD+I      + + +    ++G G++CL +  
Sbjct: 13  FERVENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITE 72

Query: 66  VQAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIV 125
            + K+L+L +M   N S   T FT++IEA +G+TTG+SA DR               D+ 
Sbjct: 73  DRRKQLDLPMMVENNTSAYGTGFTVTIEAAEGVTTGVSAADRITTVRAAIADGAKPSDLN 132

Query: 126 SPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFA 185
            PGHVFP+ A+ GGVL R GHTEA++D+  LA    + V+CE+ N+DGTMA+  +  +FA
Sbjct: 133 RPGHVFPLRAQAGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFA 192

Query: 186 NKHNLKIGKIEDLIAYR 202
           NKHN+ +  IEDL+AYR
Sbjct: 193 NKHNMALVTIEDLVAYR 209


>RIBB_ECO55 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 217

 Score =  165 bits (417), Expect = 7e-43
 Identities = 79/197 (40%), Positives = 122/197 (61%)

Query: 6   YASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDS 65
           +  +E+ +   ++G   +++DDE RENEGD+I      + + +    ++G G++CL +  
Sbjct: 13  FERVENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITE 72

Query: 66  VQAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIV 125
            + K+L+L +M   N S   T FT++IEA +G+TTG+SA DR               D+ 
Sbjct: 73  DRRKQLDLPMMVENNTSAYGTGFTVTIEAAEGVTTGVSAADRITTVRAAIADGAKPSDLN 132

Query: 126 SPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFA 185
            PGHVFP+ A+ GGVL R GHTEA++D+  LA    + V+CE+ N+DGTMA+  +  +FA
Sbjct: 133 RPGHVFPLRAQAGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFA 192

Query: 186 NKHNLKIGKIEDLIAYR 202
           NKHN+ +  IEDL+AYR
Sbjct: 193 NKHNMALVTIEDLVAYR 209


>RIBB_ECO45 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 217

 Score =  165 bits (417), Expect = 7e-43
 Identities = 79/197 (40%), Positives = 122/197 (61%)

Query: 6   YASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDS 65
           +  +E+ +   ++G   +++DDE RENEGD+I      + + +    ++G G++CL +  
Sbjct: 13  FERVENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITD 72

Query: 66  VQAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIV 125
            + K+L+L +M   N S   T FT++IEA +G+TTG+SA DR               D+ 
Sbjct: 73  DRRKQLDLPMMVENNTSAYGTGFTVTIEAAEGVTTGVSAADRITTVRAAIADGAKPSDLN 132

Query: 126 SPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFA 185
            PGHVFP+ A+ GGVL R GHTEA++D+  LA    + V+CE+ N+DGTMA+  +  +FA
Sbjct: 133 RPGHVFPLRAQAGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFA 192

Query: 186 NKHNLKIGKIEDLIAYR 202
           NKHN+ +  IEDL+AYR
Sbjct: 193 NKHNMALVTIEDLVAYR 209


>RIBB_ECO27 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 217

 Score =  165 bits (417), Expect = 7e-43
 Identities = 79/197 (40%), Positives = 122/197 (61%)

Query: 6   YASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDS 65
           +  +E+ +   ++G   +++DDE RENEGD+I      + + +    ++G G++CL +  
Sbjct: 13  FERVENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITD 72

Query: 66  VQAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIV 125
            + K+L+L +M   N S   T FT++IEA +G+TTG+SA DR               D+ 
Sbjct: 73  DRRKQLDLPMMVENNTSAYGTGFTVTIEAAEGVTTGVSAADRITTVRAAIADGAKPSDLN 132

Query: 126 SPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFA 185
            PGHVFP+ A+ GGVL R GHTEA++D+  LA    + V+CE+ N+DGTMA+  +  +FA
Sbjct: 133 RPGHVFPLRAQAGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFA 192

Query: 186 NKHNLKIGKIEDLIAYR 202
           NKHN+ +  IEDL+AYR
Sbjct: 193 NKHNMALVTIEDLVAYR 209


>RIBB_ECO24 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 217

 Score =  165 bits (417), Expect = 7e-43
 Identities = 79/197 (40%), Positives = 122/197 (61%)

Query: 6   YASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDS 65
           +  +E+ +   ++G   +++DDE RENEGD+I      + + +    ++G G++CL +  
Sbjct: 13  FERVENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITE 72

Query: 66  VQAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIV 125
            + K+L+L +M   N S   T FT++IEA +G+TTG+SA DR               D+ 
Sbjct: 73  DRRKQLDLPMMVENNTSAYGTGFTVTIEAAEGVTTGVSAADRITTVRAAIADGAKPSDLN 132

Query: 126 SPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFA 185
            PGHVFP+ A+ GGVL R GHTEA++D+  LA    + V+CE+ N+DGTMA+  +  +FA
Sbjct: 133 RPGHVFPLRAQAGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFA 192

Query: 186 NKHNLKIGKIEDLIAYR 202
           NKHN+ +  IEDL+AYR
Sbjct: 193 NKHNMALVTIEDLVAYR 209


>RIBB_ESCF3 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 217

 Score =  164 bits (416), Expect = 9e-43
 Identities = 79/197 (40%), Positives = 122/197 (61%)

Query: 6   YASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDS 65
           +  +E+ +   ++G   +++DDE RENEGD+I      + + +    ++G G++CL +  
Sbjct: 13  FERVENALAALREGRGVMVLDDEDRENEGDMIFPAETMTIEQMALTIRHGSGIVCLCITE 72

Query: 66  VQAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIV 125
            + K+L+L +M   N S   T FT++IEA +G+TTG+SA DR               D+ 
Sbjct: 73  DRRKQLDLPMMVENNTSAYGTGFTVTIEAAEGVTTGVSAADRITTVRAAIADGAKPSDLN 132

Query: 126 SPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFA 185
            PGHVFP+ A+ GGVL R GHTEA++D+  LA    + V+CE+ N+DGTMA+  +  +FA
Sbjct: 133 RPGHVFPLRAQAGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIEFA 192

Query: 186 NKHNLKIGKIEDLIAYR 202
           NKHN+ +  IEDL+AYR
Sbjct: 193 NKHNMALVTIEDLVAYR 209


>RIBB_VIBVY RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 218

 Score =  164 bits (415), Expect = 1e-42
 Identities = 82/194 (42%), Positives = 118/194 (60%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           +E+ +   K+G   +L+DDE RENEGD+I S    +   +  M +   G++CL L    A
Sbjct: 17  VENALLALKEGRGVLLLDDEDRENEGDIIYSVEHLTNAQMALMIRECSGIVCLCLTDEHA 76

Query: 69  KRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPG 128
            +L L  M   N S N+TAFT+SIEAK+G+TTG+SA+DR               D+  PG
Sbjct: 77  NKLELPPMVVNNNSANQTAFTVSIEAKQGVTTGVSAQDRVTTIKTAANPSAKADDLARPG 136

Query: 129 HVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKH 188
           HVFP+ A+ GGVL R GHTE +VD+ ++A    + V+CE+ N DGTMAK  ++  F  +H
Sbjct: 137 HVFPLRARPGGVLARRGHTEGTVDLMQMAGLQPAGVLCELTNPDGTMAKTPEIIAFGKQH 196

Query: 189 NLKIGKIEDLIAYR 202
           N+ +  IED++ YR
Sbjct: 197 NMPVLTIEDMVMYR 210


>RIBB_VIBVU RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 218

 Score =  164 bits (415), Expect = 1e-42
 Identities = 82/194 (42%), Positives = 118/194 (60%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           +E+ +   K+G   +L+DDE RENEGD+I S    +   +  M +   G++CL L    A
Sbjct: 17  VENALLALKEGRGVLLLDDEDRENEGDIIYSVEHLTNAQMALMIRECSGIVCLCLTDEHA 76

Query: 69  KRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPG 128
            +L L  M   N S N+TAFT+SIEAK+G+TTG+SA+DR               D+  PG
Sbjct: 77  NKLELPPMVVNNNSANQTAFTVSIEAKQGVTTGVSAQDRVTTIKTAANPSAKADDLARPG 136

Query: 129 HVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKH 188
           HVFP+ A+ GGVL R GHTE +VD+ ++A    + V+CE+ N DGTMAK  ++  F  +H
Sbjct: 137 HVFPLRARPGGVLARRGHTEGTVDLMQMAGLQPAGVLCELTNPDGTMAKTPEIIAFGKQH 196

Query: 189 NLKIGKIEDLIAYR 202
           N+ +  IED++ YR
Sbjct: 197 NMPVLTIEDMVMYR 210


>RIBB_VIBSL RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 218

 Score =  164 bits (414), Expect = 1e-42
 Identities = 81/194 (41%), Positives = 117/194 (60%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           +E+ +   ++G   +L+DDE RENEGD+I S    +   +  M +   G++CL L   QA
Sbjct: 17  VENALQALREGRGVLLLDDEDRENEGDIIYSVEHLTNAQMALMIRECSGIVCLCLTDEQA 76

Query: 69  KRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPG 128
            +L L  M   N S N+TAFT++IEAK G+TTG+SA DR               D+  PG
Sbjct: 77  NQLELPPMVVDNNSANQTAFTVTIEAKVGVTTGVSAADRVTTIKTAANPTAKPTDLARPG 136

Query: 129 HVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKH 188
           HVFP+ A+ GGVL R GHTE +VD+ ++A   ++ V+CE+ N DGTMAK  ++  F   H
Sbjct: 137 HVFPLRARKGGVLARRGHTEGTVDLMQMAGLQSAGVLCEVTNPDGTMAKAPEIVAFGKMH 196

Query: 189 NLKIGKIEDLIAYR 202
           N+ +  IED++ YR
Sbjct: 197 NMPVLTIEDMVMYR 210


>RIBB_DESPS RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 214

 Score =  164 bits (414), Expect = 1e-42
 Identities = 84/194 (43%), Positives = 117/194 (60%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           +E  +   ++G   +LVDDE RENEGDLI S    +AK +  M + G G++CL L   + 
Sbjct: 16  VEKSLQALRQGEGVLLVDDEDRENEGDLIYSAEHLTAKQMALMIREGSGIVCLCLTGEKV 75

Query: 69  KRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPG 128
             L L  M   N SR+ T FTISIEA+ G+TTG+SA DR               D+  PG
Sbjct: 76  DELKLPQMVTNNNSRHGTGFTISIEARDGVTTGVSAADRTQTVKAAIAEGAVAEDLCQPG 135

Query: 129 HVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKH 188
           HVFP+ A+D GVL R GHTE +VD+ KL+    + ++CE+ N DGTMA+  ++ DFA K 
Sbjct: 136 HVFPLRARDNGVLDRRGHTEGTVDLMKLSGLAPAGLLCELTNVDGTMARLPEIVDFARKR 195

Query: 189 NLKIGKIEDLIAYR 202
           ++++  IED+  YR
Sbjct: 196 DMQVLSIEDIAQYR 209


>RIBB_CITK8 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 217

 Score =  163 bits (413), Expect = 2e-42
 Identities = 79/197 (40%), Positives = 120/197 (60%)

Query: 6   YASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDS 65
           +  +E  ++  ++G   +++DDE RENEGD+I      + + +    ++G G++CL +  
Sbjct: 13  FERVEHALSALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITE 72

Query: 66  VQAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIV 125
            + K+L+L +M   N S   T FT++IEA KG+TTG+SA DR               D+ 
Sbjct: 73  DRRKQLDLPMMVENNTSAYGTGFTVTIEAAKGVTTGVSAADRVTTVRAAIADGAKPADLH 132

Query: 126 SPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFA 185
            PGHVFP+ A+ GGVL R GHTEA++D+  LA    + V+CE+ N+DGTMA+  +   FA
Sbjct: 133 RPGHVFPLRAQPGGVLTRGGHTEATIDLVTLAGFKPAGVLCELTNDDGTMARAPECIAFA 192

Query: 186 NKHNLKIGKIEDLIAYR 202
            KHN+ +  IEDL+AYR
Sbjct: 193 GKHNMAVVTIEDLVAYR 209


>RIBB_BAUCH RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 211

 Score =  163 bits (413), Expect = 2e-42
 Identities = 78/194 (40%), Positives = 122/194 (62%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           +E  +   + G   +++D+E RENEGD+I +    + + +    +YG G+ICL L   + 
Sbjct: 16  VEIALQALRHGRGVLVLDNEDRENEGDMIFAAEKMTIEQMALAIRYGSGIICLCLTEERR 75

Query: 69  KRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPG 128
           ++L L +M   N S  +TAFT++IEA +G+TTG+SA DR               D+  PG
Sbjct: 76  QQLELPMMVEHNTSHYQTAFTVTIEAAEGVTTGVSAADRITTIRTAIKNDAIPEDLNRPG 135

Query: 129 HVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKH 188
           HVFP++A+ GGVL R GHTEA++D++ LA    + V+CE+ NEDG+MA+  ++  F+N+H
Sbjct: 136 HVFPLLAQPGGVLNRGGHTEAAIDLTLLAGLKPAGVLCEVTNEDGSMARALEIIAFSNQH 195

Query: 189 NLKIGKIEDLIAYR 202
           N+ +  I DL+AYR
Sbjct: 196 NMPVLTINDLVAYR 209


>RIBB_PECCP RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 217

 Score =  163 bits (412), Expect = 3e-42
 Identities = 79/194 (40%), Positives = 121/194 (62%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           +E  ++  + G   +++DDE RENEGD+I S  + + + +    ++G G++CL L   + 
Sbjct: 16  VERALDALRHGRGVLVLDDEDRENEGDMIFSAENMTVEQMALTIRHGSGIVCLCLTEERR 75

Query: 69  KRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPG 128
           ++L L +M   N S  +TAFT++IEA +G+TTG+SA DR               D+  PG
Sbjct: 76  QQLELPMMVEKNSSHYQTAFTVTIEAAEGVTTGVSAADRLTTIRAAIADNAKPSDLNRPG 135

Query: 129 HVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKH 188
           HVFP+ A+ GGVL R GHTEA+VD+  LA    S V+CE+ N+DG+MA   ++  FA +H
Sbjct: 136 HVFPLRAQPGGVLTRGGHTEATVDLMTLAGLKPSGVLCELTNDDGSMAHAPEVIAFAKQH 195

Query: 189 NLKIGKIEDLIAYR 202
           ++ +  IEDL+AYR
Sbjct: 196 DMPVLTIEDLVAYR 209


>RIBB_KLEP7 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 217

 Score =  162 bits (411), Expect = 3e-42
 Identities = 78/197 (39%), Positives = 121/197 (61%)

Query: 6   YASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDS 65
           +  +E  ++  ++G   +++DDE RENEGD+I +    + + +    ++G G++CL L  
Sbjct: 13  FERVEHALDALREGRGVMVLDDEDRENEGDMIFAAETMTVEQMALTIRHGSGIVCLCLTE 72

Query: 66  VQAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIV 125
            + K+L+L +M   N S   T FT++IEA +G+TTG+SA DR               D+ 
Sbjct: 73  ERRKQLDLPMMVENNTSAYGTGFTVTIEAAEGVTTGVSAADRVTTVRAAIADGAKPSDLN 132

Query: 126 SPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFA 185
            PGHVFP+ A+ GGVL R GHTEA++D+  LA    + V+CE+ N+DGTMA+  +   FA
Sbjct: 133 RPGHVFPLRAQPGGVLTRGGHTEATIDLVTLAGFKPAGVLCELTNDDGTMARAPECIKFA 192

Query: 186 NKHNLKIGKIEDLIAYR 202
            +HN+ +  IEDL+AYR
Sbjct: 193 QQHNMAVVTIEDLVAYR 209


>RIBB_KLEP3 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 217

 Score =  162 bits (411), Expect = 3e-42
 Identities = 79/197 (40%), Positives = 121/197 (61%)

Query: 6   YASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDS 65
           +  +E  ++  ++G   +++DDE RENEGD+I +    + + +    ++G G++CL L  
Sbjct: 13  FERVEHALDALREGRGVMVLDDEDRENEGDMIFAAETMTVEQMALTIRHGSGIVCLCLTE 72

Query: 66  VQAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIV 125
            + K+L+L +M   N S   T FT++IEA +G+TTG+SA DR               D+ 
Sbjct: 73  DRRKQLDLPMMVENNTSAYGTGFTVTIEAAEGVTTGVSAADRVTTVRAAIADGAKPSDLN 132

Query: 126 SPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFA 185
            PGHVFP+ A+ GGVL R GHTEA++D+  LA    + V+CE+ N+DGTMA+  +   FA
Sbjct: 133 RPGHVFPLRAQPGGVLTRGGHTEATIDLVTLAGFKPAGVLCELTNDDGTMARAPECIKFA 192

Query: 186 NKHNLKIGKIEDLIAYR 202
            +HN+ I  IEDL+AYR
Sbjct: 193 QQHNMAIVTIEDLVAYR 209


>RIBBA_PARD8 RecName: Full=Riboflavin biosynthesis protein
           ribBA;Includes:  RecName: Full=3,4-dihydroxy-2-butanone
           4-phosphate synthase;
          Length = 405

 Score =  162 bits (411), Expect = 3e-42
 Identities = 111/368 (30%), Positives = 179/368 (48%), Gaps = 14/368 (3%)

Query: 8   SIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQ 67
           +IE  I   ++G   I+VDDE RENEGD II+    + + INFM K GRG++C  +   +
Sbjct: 8   TIEEAIEDFREGKFLIVVDDEDRENEGDFIIAAEKVTPEKINFMLKNGRGVLCAPITEER 67

Query: 68  AKRLNLSLMSPINQSRNKTAFTISIEAKKG-ITTGISAKDRXXXXXXXXXXXXXXXDIVS 126
            + L L +    N S   T FTI+++   G  TTG+S  DR               D+  
Sbjct: 68  CQELELDMQVANNTSLLGTPFTITVDKLGGKCTTGVSMYDRAETILALADPKTKPSDLGR 127

Query: 127 PGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFAN 186
           PGH+ P+ A+  GVL RAGHTEA+VD+++LA    +  + EI+NEDGTMA+   L + A 
Sbjct: 128 PGHINPLRARSRGVLRRAGHTEAAVDLARLAGLYPAGALIEIINEDGTMARLPQLIEVAX 187

Query: 187 KHNLKIGKIEDLIAYRXXXXXXXXXXXQSDIKVKNQKYKIRIYENLLDGSEHFALIKGNI 246
                        AYR           + D+  +   +++  +    +G EH ALIKG  
Sbjct: 188 XXXXXXXXXXXXXAYRLRTESIVENGVEVDLPTEYGHFRLIPFRQKSNGLEHIALIKGKF 247

Query: 247 KKGIIPRVRVISSNVVQNYL--INQQLPNSFDKTLNYFKKFNNCVLVFIKDTNLK-SVTQ 303
           +K     VRV SS    +    +  +      + +    +    V+V++        + +
Sbjct: 248 EKDEPILVRVHSSCATGDIFGSMRCECGEQLHEAMRRIDQEGKGVIVYLNQEGRGIGLME 307

Query: 304 TLKDYK---------NKNFYKKGNDKLIRNYGIGAQIIKDLKIKNMILITKSLKKVIGLE 354
            +K YK         + N +  G+    R+YG+GAQI++ + +  M L++ +  K +GLE
Sbjct: 308 KMKAYKLQEDGLDTVDANLH-LGHQADERDYGVGAQILRHIGVTKMRLMSNNPVKRVGLE 366

Query: 355 GYDIKITK 362
            Y +++ +
Sbjct: 367 AYGLEVVE 374


>RIBB_ERWCT RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 217

 Score =  162 bits (410), Expect = 4e-42
 Identities = 79/194 (40%), Positives = 120/194 (61%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           +E  ++  + G   +++DDE RENEGD+I S    + + +    ++G G++CL L   + 
Sbjct: 16  VERALDALRHGRGVLVLDDEDRENEGDMIFSAESMTVEQMALTIRHGSGIVCLCLTEERR 75

Query: 69  KRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPG 128
           ++L L +M   N S  +TAFT++IEA +G+TTG+SA DR               D+  PG
Sbjct: 76  QQLELPMMVEKNSSHYQTAFTVTIEAAEGVTTGVSAADRLTTIRAAIADNARPSDLNRPG 135

Query: 129 HVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKH 188
           HVFP+ A+ GGVL R GHTEA+VD+  LA    S V+CE+ N+DG+MA   ++  FA +H
Sbjct: 136 HVFPLRAQPGGVLTRGGHTEATVDLMTLAGLKPSGVLCELTNDDGSMAHAPEVIAFAKQH 195

Query: 189 NLKIGKIEDLIAYR 202
           ++ +  IEDL+AYR
Sbjct: 196 DMLVLTIEDLVAYR 209


>RIBB_SHEFN RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 218

 Score =  162 bits (409), Expect = 6e-42
 Identities = 82/194 (42%), Positives = 118/194 (60%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           +E+ +   ++G   +L+DDE RENEGD+I S    +   +  M +   G++CL L    A
Sbjct: 17  VENALAALREGRGVLLLDDEDRENEGDIIYSVEHLTTAQMALMIRECSGIVCLCLTDEHA 76

Query: 69  KRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPG 128
            +L L  M   N S N+TAFTISIEAK G+TTG+SA+DR               D+  PG
Sbjct: 77  NKLQLPPMVINNNSANQTAFTISIEAKHGVTTGVSAQDRVTTIKTAANRDAKASDLAHPG 136

Query: 129 HVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKH 188
           HVFP+ A+ GGV+ R GHTE +VD+ ++A    + V+CE+ NEDG+MAK  ++  F  KH
Sbjct: 137 HVFPLRARAGGVMSRRGHTEGTVDLMQMAGLMPAGVLCELANEDGSMAKTPEIIAFGLKH 196

Query: 189 NLKIGKIEDLIAYR 202
           N+ +  IED++ YR
Sbjct: 197 NMPVLTIEDMVMYR 210


>RIBB_RALEJ RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 223

 Score =  162 bits (409), Expect = 6e-42
 Identities = 82/194 (42%), Positives = 124/194 (63%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           I   ++  ++G   +L+DD+ RENE DLI++    +  N+  M +   G++CL L + + 
Sbjct: 26  IAQALDAMREGRPVVLLDDDDRENEADLILAAECLTPSNMAMMIRECSGIVCLCLTTDKV 85

Query: 69  KRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPG 128
           ++L L  M   N+S+  TAFT+SIEA++G+TTG+SA DR                +VSPG
Sbjct: 86  RQLGLRPMVENNRSQYGTAFTVSIEAREGVTTGVSAVDRITTIRAAIAKDAGTDAVVSPG 145

Query: 129 HVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKH 188
           HVFP++A DGGVLVR GHTE SV+++++A  + +AV+CE+MN DGTMA+  +   FA  +
Sbjct: 146 HVFPLVAVDGGVLVRRGHTEGSVELARMAGLSPAAVLCELMNPDGTMARRPEALSFAEMY 205

Query: 189 NLKIGKIEDLIAYR 202
            L I  I DL+A+R
Sbjct: 206 RLPILTIADLVAWR 219


>RIBB_HAES1 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 212

 Score =  162 bits (409), Expect = 6e-42
 Identities = 81/193 (41%), Positives = 119/193 (61%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           ++  I   K+G   +++DDE RENEGDLI      + + +  + +YG G++CL +     
Sbjct: 16  VKRAIEAFKRGNGVLVLDDEDRENEGDLIFPAETITVEQMAKLIRYGSGIVCLCITDELC 75

Query: 69  KRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPG 128
           ++L+LS M   N S N+TAFT+SIEA +G++TG+SA+DR               D+  PG
Sbjct: 76  QQLDLSPMVQNNTSINQTAFTVSIEAAQGVSTGVSAQDRVTTIQAAIADNAKPQDLSRPG 135

Query: 129 HVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKH 188
           HVFP+ AK GGVL R GHTEA+VD++  A    + VICEI N+DG+MA+  ++ +F  K 
Sbjct: 136 HVFPLRAKKGGVLARRGHTEAAVDLASWAGHKPAGVICEITNDDGSMARTPEIVEFGKKF 195

Query: 189 NLKIGKIEDLIAY 201
           N  +  IEDL+ Y
Sbjct: 196 NYPVVTIEDLVRY 208


>RIBB_MANSM RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 214

 Score =  160 bits (406), Expect = 1e-41
 Identities = 82/186 (44%), Positives = 114/186 (61%)

Query: 17  KKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQAKRLNLSLM 76
           K+G   +++DDE RENEGDLI      + + +  + +YG G++CL +     ++L L  M
Sbjct: 24  KQGNGVLVLDDENRENEGDLIFPAETITTEQMAKLIRYGSGIVCLCITDELCQKLELPPM 83

Query: 77  SPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPGHVFPIIAK 136
              N S NKTAFT++IEA +G++TG+SA DR               D+  PGHVFP+ A 
Sbjct: 84  VAANTSVNKTAFTVTIEAAEGVSTGVSAADRVTTVKVAVADNAKPSDLHHPGHVFPLRAA 143

Query: 137 DGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKHNLKIGKIE 196
           + GVL R GHTEA+VD+++L     + VICEI N+DGTMA+  +L  FA K    +  IE
Sbjct: 144 ENGVLARPGHTEAAVDLARLCGYKPAGVICEITNDDGTMARTPELVAFAQKFGYAVVTIE 203

Query: 197 DLIAYR 202
           DLIAYR
Sbjct: 204 DLIAYR 209


>RIBB_EDWI9 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 219

 Score =  160 bits (406), Expect = 1e-41
 Identities = 76/194 (39%), Positives = 120/194 (61%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           +E  ++  + G   +++DDE RENEGD+I +    + + +    ++G G++CL +   + 
Sbjct: 16  VERALSALRDGRGVMVLDDENRENEGDMIFAAEKMTVEQMALTIRHGSGIVCLCITEARR 75

Query: 69  KRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPG 128
           ++L+L +M   N S   TAFT++IEA +G+TTG+SA+DR               D+  PG
Sbjct: 76  QQLDLPMMVSNNTSHYGTAFTVTIEAAEGVTTGVSAQDRLTTVRAAIADDAKPGDLHRPG 135

Query: 129 HVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKH 188
           HVFP+ A+ GGVL R GHTEA++D+  LA    + V+CE+ N+DGTMA+   +  FA +H
Sbjct: 136 HVFPLRARPGGVLARRGHTEATIDLVSLAGFRPAGVLCELTNDDGTMARAPQVMAFARQH 195

Query: 189 NLKIGKIEDLIAYR 202
            + +  IEDL+AYR
Sbjct: 196 EMPVVTIEDLVAYR 209


>RIBB_DESAA RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 215

 Score =  160 bits (405), Expect = 2e-41
 Identities = 85/195 (43%), Positives = 116/195 (59%), Gaps = 1/195 (0%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           +E  +   + G   ++ DDE RENEGDLI S    +   +  + +   G++CL +   + 
Sbjct: 16  VEKGLQALRDGQGVLVADDENRENEGDLIFSAESLTEAQMAMLIRECSGIVCLCMPDEKI 75

Query: 69  KRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPG 128
           + L L +M   N SR  TAFT+SIEA +G+TTG+SAKDR               D+  PG
Sbjct: 76  RSLELPMMVEDNSSRYGTAFTVSIEAAQGVTTGVSAKDRVTTVKTAAADGAKPADLSKPG 135

Query: 129 HVFPIIAKDGGVLVRAGHTEASVDISKLA-KKNNSAVICEIMNEDGTMAKGQDLFDFANK 187
           HVFP+ A+ GGVL R GHTEA+VD+ +LA  KN   V+CE+ N DGTMA+   L DFA K
Sbjct: 136 HVFPLRARPGGVLERRGHTEATVDMMRLAGLKNPCGVLCELTNPDGTMARLPQLADFAKK 195

Query: 188 HNLKIGKIEDLIAYR 202
           H + +  +EDL AYR
Sbjct: 196 HGMVLLTVEDLAAYR 210


>RIBB_AGRT5 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 213

 Score =  160 bits (405), Expect = 2e-41
 Identities = 85/195 (43%), Positives = 115/195 (58%)

Query: 7   ASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSV 66
           A IE  I    +G M I+VDDE RENEGD+I ++   + + I FM  + RGL+C+A+   
Sbjct: 4   AKIEDAIEAISRGEMVIVVDDEDRENEGDIIAASDSITPQQIAFMMNHARGLVCVAMPGE 63

Query: 67  QAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVS 126
           +   L++ LM   N    KTAFT+S++   G TTGISA DR               D   
Sbjct: 64  RLDALDIPLMVSRNTESLKTAFTVSVDYIPGTTTGISAADRAKTVRALVSEGSRPEDFAR 123

Query: 127 PGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFAN 186
           PGH+FP+ A   GVL R GHTEA+VD+ +LA K  S  ICE+ N+DGTMA+   L  FA 
Sbjct: 124 PGHIFPLRANPEGVLGRTGHTEAAVDLCRLAGKFPSGTICEVANDDGTMARLPQLEIFAE 183

Query: 187 KHNLKIGKIEDLIAY 201
           +H L +  I+DL++Y
Sbjct: 184 RHGLLVVTIKDLVSY 198


>RIBB_SALTY RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 217

 Score =  160 bits (404), Expect = 2e-41
 Identities = 77/197 (39%), Positives = 120/197 (60%)

Query: 6   YASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDS 65
           +  +E  ++  ++G   +++DDE RENEGD+I      + + +    ++G G++CL +  
Sbjct: 13  FERVELALDALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITE 72

Query: 66  VQAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIV 125
            + K+L+L +M   N S   T FT++IEA +G+TTG+SA DR               D+ 
Sbjct: 73  DRRKQLDLPMMVENNTSAYGTGFTVTIEAAEGVTTGVSAADRVTTVRAAIKDGAKPSDLN 132

Query: 126 SPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFA 185
            PGHVFP+ A+ GGVL R GHTEA++D+  LA    + V+CE+ N+DGTMA+  +   FA
Sbjct: 133 RPGHVFPLRAQAGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIAFA 192

Query: 186 NKHNLKIGKIEDLIAYR 202
            +HN+ +  IEDL+AYR
Sbjct: 193 GQHNMAVVTIEDLVAYR 209


>RIBB_SALTI RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 217

 Score =  160 bits (404), Expect = 2e-41
 Identities = 77/197 (39%), Positives = 120/197 (60%)

Query: 6   YASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDS 65
           +  +E  ++  ++G   +++DDE RENEGD+I      + + +    ++G G++CL +  
Sbjct: 13  FERVELALDALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITE 72

Query: 66  VQAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIV 125
            + K+L+L +M   N S   T FT++IEA +G+TTG+SA DR               D+ 
Sbjct: 73  DRRKQLDLPMMVENNTSAYGTGFTVTIEAAEGVTTGVSAADRVTTVRAAIKDGAKPSDLN 132

Query: 126 SPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFA 185
            PGHVFP+ A+ GGVL R GHTEA++D+  LA    + V+CE+ N+DGTMA+  +   FA
Sbjct: 133 RPGHVFPLRAQAGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIAFA 192

Query: 186 NKHNLKIGKIEDLIAYR 202
            +HN+ +  IEDL+AYR
Sbjct: 193 GQHNMAVVTIEDLVAYR 209


>RIBB_SALSV RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 217

 Score =  160 bits (404), Expect = 2e-41
 Identities = 77/197 (39%), Positives = 120/197 (60%)

Query: 6   YASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDS 65
           +  +E  ++  ++G   +++DDE RENEGD+I      + + +    ++G G++CL +  
Sbjct: 13  FERVELALDALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITE 72

Query: 66  VQAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIV 125
            + K+L+L +M   N S   T FT++IEA +G+TTG+SA DR               D+ 
Sbjct: 73  DRRKQLDLPMMVENNTSAYGTGFTVTIEAAEGVTTGVSAADRVTTVRAAIKDGAKPSDLN 132

Query: 126 SPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFA 185
            PGHVFP+ A+ GGVL R GHTEA++D+  LA    + V+CE+ N+DGTMA+  +   FA
Sbjct: 133 RPGHVFPLRAQAGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIAFA 192

Query: 186 NKHNLKIGKIEDLIAYR 202
            +HN+ +  IEDL+AYR
Sbjct: 193 GQHNMAVVTIEDLVAYR 209


>RIBB_SALPC RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 217

 Score =  160 bits (404), Expect = 2e-41
 Identities = 77/197 (39%), Positives = 120/197 (60%)

Query: 6   YASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDS 65
           +  +E  ++  ++G   +++DDE RENEGD+I      + + +    ++G G++CL +  
Sbjct: 13  FERVELALDALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITE 72

Query: 66  VQAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIV 125
            + K+L+L +M   N S   T FT++IEA +G+TTG+SA DR               D+ 
Sbjct: 73  DRRKQLDLPMMVENNTSAYGTGFTVTIEAAEGVTTGVSAADRVTTVRAAIKDGAKPSDLN 132

Query: 126 SPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFA 185
            PGHVFP+ A+ GGVL R GHTEA++D+  LA    + V+CE+ N+DGTMA+  +   FA
Sbjct: 133 RPGHVFPLRAQAGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIAFA 192

Query: 186 NKHNLKIGKIEDLIAYR 202
            +HN+ +  IEDL+AYR
Sbjct: 193 GQHNMAVVTIEDLVAYR 209


>RIBB_SALPB RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 217

 Score =  160 bits (404), Expect = 2e-41
 Identities = 77/197 (39%), Positives = 120/197 (60%)

Query: 6   YASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDS 65
           +  +E  ++  ++G   +++DDE RENEGD+I      + + +    ++G G++CL +  
Sbjct: 13  FERVELALDALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITE 72

Query: 66  VQAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIV 125
            + K+L+L +M   N S   T FT++IEA +G+TTG+SA DR               D+ 
Sbjct: 73  DRRKQLDLPMMVENNTSAYGTGFTVTIEAAEGVTTGVSAADRVTTVRAAIKDGAKPSDLN 132

Query: 126 SPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFA 185
            PGHVFP+ A+ GGVL R GHTEA++D+  LA    + V+CE+ N+DGTMA+  +   FA
Sbjct: 133 RPGHVFPLRAQAGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIAFA 192

Query: 186 NKHNLKIGKIEDLIAYR 202
            +HN+ +  IEDL+AYR
Sbjct: 193 GQHNMAVVTIEDLVAYR 209


>RIBB_SALNS RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 217

 Score =  160 bits (404), Expect = 2e-41
 Identities = 77/197 (39%), Positives = 120/197 (60%)

Query: 6   YASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDS 65
           +  +E  ++  ++G   +++DDE RENEGD+I      + + +    ++G G++CL +  
Sbjct: 13  FERVELALDALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITE 72

Query: 66  VQAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIV 125
            + K+L+L +M   N S   T FT++IEA +G+TTG+SA DR               D+ 
Sbjct: 73  DRRKQLDLPMMVENNTSAYGTGFTVTIEAAEGVTTGVSAADRVTTVRAAIKDGAKPSDLN 132

Query: 126 SPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFA 185
            PGHVFP+ A+ GGVL R GHTEA++D+  LA    + V+CE+ N+DGTMA+  +   FA
Sbjct: 133 RPGHVFPLRAQAGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIAFA 192

Query: 186 NKHNLKIGKIEDLIAYR 202
            +HN+ +  IEDL+AYR
Sbjct: 193 GQHNMAVVTIEDLVAYR 209


>RIBB_SALHS RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 217

 Score =  160 bits (404), Expect = 2e-41
 Identities = 77/197 (39%), Positives = 120/197 (60%)

Query: 6   YASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDS 65
           +  +E  ++  ++G   +++DDE RENEGD+I      + + +    ++G G++CL +  
Sbjct: 13  FERVELALDALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITE 72

Query: 66  VQAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIV 125
            + K+L+L +M   N S   T FT++IEA +G+TTG+SA DR               D+ 
Sbjct: 73  DRRKQLDLPMMVENNTSAYGTGFTVTIEAAEGVTTGVSAADRVTTVRAAIKDGAKPSDLN 132

Query: 126 SPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFA 185
            PGHVFP+ A+ GGVL R GHTEA++D+  LA    + V+CE+ N+DGTMA+  +   FA
Sbjct: 133 RPGHVFPLRAQAGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIAFA 192

Query: 186 NKHNLKIGKIEDLIAYR 202
            +HN+ +  IEDL+AYR
Sbjct: 193 GQHNMAVVTIEDLVAYR 209


>RIBB_SALG2 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 217

 Score =  160 bits (404), Expect = 2e-41
 Identities = 77/197 (39%), Positives = 120/197 (60%)

Query: 6   YASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDS 65
           +  +E  ++  ++G   +++DDE RENEGD+I      + + +    ++G G++CL +  
Sbjct: 13  FERVELALDALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITE 72

Query: 66  VQAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIV 125
            + K+L+L +M   N S   T FT++IEA +G+TTG+SA DR               D+ 
Sbjct: 73  DRRKQLDLPMMVENNTSAYGTGFTVTIEAAEGVTTGVSAADRVTTVRAAIKDGAKPSDLN 132

Query: 126 SPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFA 185
            PGHVFP+ A+ GGVL R GHTEA++D+  LA    + V+CE+ N+DGTMA+  +   FA
Sbjct: 133 RPGHVFPLRAQAGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIAFA 192

Query: 186 NKHNLKIGKIEDLIAYR 202
            +HN+ +  IEDL+AYR
Sbjct: 193 GQHNMAVVTIEDLVAYR 209


>RIBB_SALEP RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 217

 Score =  160 bits (404), Expect = 2e-41
 Identities = 77/197 (39%), Positives = 120/197 (60%)

Query: 6   YASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDS 65
           +  +E  ++  ++G   +++DDE RENEGD+I      + + +    ++G G++CL +  
Sbjct: 13  FERVELALDALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITE 72

Query: 66  VQAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIV 125
            + K+L+L +M   N S   T FT++IEA +G+TTG+SA DR               D+ 
Sbjct: 73  DRRKQLDLPMMVENNTSAYGTGFTVTIEAAEGVTTGVSAADRVTTVRAAIKDGAKPSDLN 132

Query: 126 SPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFA 185
            PGHVFP+ A+ GGVL R GHTEA++D+  LA    + V+CE+ N+DGTMA+  +   FA
Sbjct: 133 RPGHVFPLRAQAGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIAFA 192

Query: 186 NKHNLKIGKIEDLIAYR 202
            +HN+ +  IEDL+AYR
Sbjct: 193 GQHNMAVVTIEDLVAYR 209


>RIBB_SALDC RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 217

 Score =  160 bits (404), Expect = 2e-41
 Identities = 77/197 (39%), Positives = 120/197 (60%)

Query: 6   YASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDS 65
           +  +E  ++  ++G   +++DDE RENEGD+I      + + +    ++G G++CL +  
Sbjct: 13  FERVELALDALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITE 72

Query: 66  VQAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIV 125
            + K+L+L +M   N S   T FT++IEA +G+TTG+SA DR               D+ 
Sbjct: 73  DRRKQLDLPMMVENNTSAYGTGFTVTIEAAEGVTTGVSAADRVTTVRAAIKDGAKPSDLN 132

Query: 126 SPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFA 185
            PGHVFP+ A+ GGVL R GHTEA++D+  LA    + V+CE+ N+DGTMA+  +   FA
Sbjct: 133 RPGHVFPLRAQAGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIAFA 192

Query: 186 NKHNLKIGKIEDLIAYR 202
            +HN+ +  IEDL+AYR
Sbjct: 193 GQHNMAVVTIEDLVAYR 209


>RIBB_SALCH RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 217

 Score =  160 bits (404), Expect = 2e-41
 Identities = 77/197 (39%), Positives = 120/197 (60%)

Query: 6   YASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDS 65
           +  +E  ++  ++G   +++DDE RENEGD+I      + + +    ++G G++CL +  
Sbjct: 13  FERVELALDALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITE 72

Query: 66  VQAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIV 125
            + K+L+L +M   N S   T FT++IEA +G+TTG+SA DR               D+ 
Sbjct: 73  DRRKQLDLPMMVENNTSAYGTGFTVTIEAAEGVTTGVSAADRVTTVRAAIKDGAKPSDLN 132

Query: 126 SPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFA 185
            PGHVFP+ A+ GGVL R GHTEA++D+  LA    + V+CE+ N+DGTMA+  +   FA
Sbjct: 133 RPGHVFPLRAQAGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIAFA 192

Query: 186 NKHNLKIGKIEDLIAYR 202
            +HN+ +  IEDL+AYR
Sbjct: 193 GQHNMAVVTIEDLVAYR 209


>RIBB_SALA4 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 217

 Score =  160 bits (404), Expect = 2e-41
 Identities = 77/197 (39%), Positives = 120/197 (60%)

Query: 6   YASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDS 65
           +  +E  ++  ++G   +++DDE RENEGD+I      + + +    ++G G++CL +  
Sbjct: 13  FERVELALDALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITE 72

Query: 66  VQAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIV 125
            + K+L+L +M   N S   T FT++IEA +G+TTG+SA DR               D+ 
Sbjct: 73  DRRKQLDLPMMVENNTSAYGTGFTVTIEAAEGVTTGVSAADRVTTVRAAIKDGAKPSDLN 132

Query: 126 SPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFA 185
            PGHVFP+ A+ GGVL R GHTEA++D+  LA    + V+CE+ N+DGTMA+  +   FA
Sbjct: 133 RPGHVFPLRAQAGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIAFA 192

Query: 186 NKHNLKIGKIEDLIAYR 202
            +HN+ +  IEDL+AYR
Sbjct: 193 GQHNMAVVTIEDLVAYR 209


>RIBB_HAES2 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 214

 Score =  159 bits (403), Expect = 3e-41
 Identities = 80/193 (41%), Positives = 118/193 (61%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           ++  I   K+G   +++DDE RENEGDLI      + + +  + +YG G++CL +     
Sbjct: 16  VKRAIEAFKRGNGVLVLDDEDRENEGDLIFPAETITVEQMAKLIRYGSGIVCLCITDELC 75

Query: 69  KRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPG 128
           ++L+L  M   N S N+TAFT+SIEA +G++TG+SA+DR               D+  PG
Sbjct: 76  QQLDLPPMVQNNTSINQTAFTVSIEAAQGVSTGVSAQDRVTTIQVAIADNAKPQDLSRPG 135

Query: 129 HVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKH 188
           HVFP+ AK GGVL R GHTEA+VD++  A    + VICEI N+DG+MA+  ++ +F  K 
Sbjct: 136 HVFPLRAKKGGVLARRGHTEAAVDLASWAGHKPAGVICEITNDDGSMARTLEIVEFGKKF 195

Query: 189 NLKIGKIEDLIAY 201
           N  +  IEDL+ Y
Sbjct: 196 NYPVVTIEDLVRY 208


>RIBBA_RHOSR RecName: Full=Riboflavin biosynthesis protein
           ribBA;Includes:  RecName: Full=3,4-dihydroxy-2-butanone
           4-phosphate synthase;
          Length = 417

 Score =  159 bits (403), Expect = 3e-41
 Identities = 107/349 (30%), Positives = 179/349 (51%), Gaps = 24/349 (6%)

Query: 36  LIISTTDSSAKNINFMAKYGRGLICLALDSVQAKRLNLSLMSPINQSRNKTAFTISIEAK 95
           LI +   ++ + + FM +Y  G +C+ LD     RL L  M   NQ ++ TA+T++++A+
Sbjct: 34  LIFAAEKATPELVAFMVRYTSGYLCVPLDGADCDRLGLPPMYATNQDKHGTAYTVTVDAR 93

Query: 96  KGITTGISAKDRXXXXXXXXXXXXXXXDIVSPGHVFPIIAKDGGVLVRAGHTEASVDISK 155
           +GI TGISA DR               D   PGHV P+ AK+GGVL R GHTEA+VD+++
Sbjct: 94  EGIGTGISASDRAATMRLLADPSSGAQDFTRPGHVVPLRAKEGGVLRRPGHTEAAVDLAR 153

Query: 156 LAKKNNSAVICEIMN--EDGTMAKGQDLFDFANKHNLKIGKIEDLIAYRXXXXXXXXXXX 213
           +A    + VICEI++  ++G MA+  +L  FA+ HNL +  I DLIA+R           
Sbjct: 154 MADLRPAGVICEIVSQKDEGHMAQTDELRVFADDHNLALISIADLIAWRRKHEKHVERVA 213

Query: 214 QSDIKVKNQKYKIRIYENLLDGSEHFALIK----GNIKKGIIPRVRVISSNVVQNYL--I 267
            + I  ++ ++    Y ++ D  EH AL++               RV S  +  +    +
Sbjct: 214 SARIPTRHGEFTAVGYRSIYDDVEHVALVRXXXXXXXXXXXXXXXRVHSECLTGDVFGSL 273

Query: 268 NQQLPNSFDKTLNYFKKFNNCVLVFIKDTNLKSV--TQTLKDYKNKNFYKKGNDKL---- 321
                   D  L+   +    V+++++    + +     L+ Y+ ++    G+D +    
Sbjct: 274 RCDCGPQLDAALDMVAQEGRGVVLYMRGHEGRGIGLMHKLQAYQLQD---AGSDTVDANL 330

Query: 322 -------IRNYGIGAQIIKDLKIKNMILITKSLKKVIGLEGYDIKITKQ 363
                   R+YGIGAQI+ DL I +M L+T +  K +GL+GY ++IT++
Sbjct: 331 ELGLPADARDYGIGAQILVDLGISSMRLLTNNPAKRVGLDGYGLQITER 379


>RIBB_SALPK RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 217

 Score =  159 bits (402), Expect = 4e-41
 Identities = 77/197 (39%), Positives = 120/197 (60%)

Query: 6   YASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDS 65
           +  +E  ++  ++G   +++DDE RENEGD+I      + + +    ++G G++CL +  
Sbjct: 13  FERVELALDALREGRGVMVLDDEDRENEGDMIFPAEIMTVEQMALTIRHGSGIVCLCITE 72

Query: 66  VQAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIV 125
            + K+L+L +M   N S   T FT++IEA +G+TTG+SA DR               D+ 
Sbjct: 73  DRRKQLDLPMMVENNTSAYGTGFTVTIEAAEGVTTGVSAADRVTTVRAAIKDGAKPSDLN 132

Query: 126 SPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFA 185
            PGHVFP+ A+ GGVL R GHTEA++D+  LA    + V+CE+ N+DGTMA+  +   FA
Sbjct: 133 RPGHVFPLRAQAGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIAFA 192

Query: 186 NKHNLKIGKIEDLIAYR 202
            +HN+ +  IEDL+AYR
Sbjct: 193 GQHNMAVVTIEDLVAYR 209


>RIBB_SALPA RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 217

 Score =  159 bits (402), Expect = 4e-41
 Identities = 77/197 (39%), Positives = 120/197 (60%)

Query: 6   YASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDS 65
           +  +E  ++  ++G   +++DDE RENEGD+I      + + +    ++G G++CL +  
Sbjct: 13  FERVELALDALREGRGVMVLDDEDRENEGDMIFPAEIMTVEQMALTIRHGSGIVCLCITE 72

Query: 66  VQAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIV 125
            + K+L+L +M   N S   T FT++IEA +G+TTG+SA DR               D+ 
Sbjct: 73  DRRKQLDLPMMVENNTSAYGTGFTVTIEAAEGVTTGVSAADRVTTVRAAIKDGAKPSDLN 132

Query: 126 SPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFA 185
            PGHVFP+ A+ GGVL R GHTEA++D+  LA    + V+CE+ N+DGTMA+  +   FA
Sbjct: 133 RPGHVFPLRAQAGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGTMARAPECIAFA 192

Query: 186 NKHNLKIGKIEDLIAYR 202
            +HN+ +  IEDL+AYR
Sbjct: 193 GQHNMAVVTIEDLVAYR 209


>RIBB_PROMH RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 217

 Score =  159 bits (402), Expect = 4e-41
 Identities = 76/194 (39%), Positives = 120/194 (61%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           +E  +   + G   +++DDE RENEGD++      + + +    ++G G++C+ +   + 
Sbjct: 16  VERALEALRAGKGVMVLDDENRENEGDMVFVAETMTTEQMAMSIRHGSGIVCVCITEERR 75

Query: 69  KRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPG 128
           ++L+L +M   N S   TAFT++IEA +G+TTG+SA DR               D+  PG
Sbjct: 76  QQLDLPMMVENNTSHFHTAFTVTIEAAQGVTTGVSAADRLTTVRAAAADNAKPSDLNRPG 135

Query: 129 HVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKH 188
           HVFP+ A+ GGVL R GHTEAS+D++ LA     AV+CE+ N+DGTMA+  ++  FA +H
Sbjct: 136 HVFPLRAQPGGVLTRGGHTEASIDLATLAGFKPVAVLCELTNDDGTMARAPEVVTFAKQH 195

Query: 189 NLKIGKIEDLIAYR 202
           ++ +  IEDL+AYR
Sbjct: 196 DMPVLTIEDLVAYR 209


>RIBB_BUCAT RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 215

 Score =  159 bits (402), Expect = 4e-41
 Identities = 80/193 (41%), Positives = 119/193 (61%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           I++ I   K G   I++DDE+RENEGDL+ +  + + + +    +YG G++CL +   + 
Sbjct: 16  IKNAILALKSGQGVIILDDEERENEGDLVFACENMTVEQMALSIRYGSGIVCLCITESKR 75

Query: 69  KRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPG 128
           K+LNL +M   N S  +T FT++IEA KGI+TG+SAKDR               D+  PG
Sbjct: 76  KQLNLPMMVKKNTSAYRTGFTVTIEASKGISTGVSAKDRLTTIKTAIADDAKPSDLNRPG 135

Query: 129 HVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKH 188
           HVFP+ A  GGVL R GHTEA+++I  LA    + VICE+ N+DGTMA+  ++  F+   
Sbjct: 136 HVFPLRAHKGGVLSRPGHTEAAIEIVSLAGFKPAGVICELTNKDGTMARTPEIIKFSENK 195

Query: 189 NLKIGKIEDLIAY 201
            +++  I+DLI Y
Sbjct: 196 KMQVLTIQDLIFY 208


>RIBB_BUCAI RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 215

 Score =  159 bits (402), Expect = 4e-41
 Identities = 80/193 (41%), Positives = 119/193 (61%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           I++ I   K G   I++DDE+RENEGDL+ +  + + + +    +YG G++CL +   + 
Sbjct: 16  IKNAILALKSGQGVIILDDEERENEGDLVFACENMTVEQMALSIRYGSGIVCLCITESKR 75

Query: 69  KRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPG 128
           K+LNL +M   N S  +T FT++IEA KGI+TG+SAKDR               D+  PG
Sbjct: 76  KQLNLPMMVKKNTSAYRTGFTVTIEASKGISTGVSAKDRLTTIKTAIADDAKPSDLNRPG 135

Query: 129 HVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKH 188
           HVFP+ A  GGVL R GHTEA+++I  LA    + VICE+ N+DGTMA+  ++  F+   
Sbjct: 136 HVFPLRAHKGGVLSRPGHTEAAIEIVSLAGFKPAGVICELTNKDGTMARTPEIIKFSENK 195

Query: 189 NLKIGKIEDLIAY 201
            +++  I+DLI Y
Sbjct: 196 KMQVLTIQDLIFY 208


>RIBB_BUCA5 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 215

 Score =  159 bits (402), Expect = 4e-41
 Identities = 80/193 (41%), Positives = 119/193 (61%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           I++ I   K G   I++DDE+RENEGDL+ +  + + + +    +YG G++CL +   + 
Sbjct: 16  IKNAILALKSGQGVIILDDEERENEGDLVFACENMTVEQMALSIRYGSGIVCLCITESKR 75

Query: 69  KRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPG 128
           K+LNL +M   N S  +T FT++IEA KGI+TG+SAKDR               D+  PG
Sbjct: 76  KQLNLPMMVKKNTSAYRTGFTVTIEASKGISTGVSAKDRLTTIKTAIADDAKPSDLNRPG 135

Query: 129 HVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKH 188
           HVFP+ A  GGVL R GHTEA+++I  LA    + VICE+ N+DGTMA+  ++  F+   
Sbjct: 136 HVFPLRAHKGGVLSRPGHTEAAIEIVSLAGFKPAGVICELTNKDGTMARTPEIIKFSENK 195

Query: 189 NLKIGKIEDLIAY 201
            +++  I+DLI Y
Sbjct: 196 KMQVLTIQDLIFY 208


>RIBB_SHESH RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 217

 Score =  159 bits (401), Expect = 5e-41
 Identities = 81/194 (41%), Positives = 117/194 (60%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           +E+ +   K+G   ++VDDE RENEGDLI S    + + +  + + G G++CL L   + 
Sbjct: 16  VETALISLKQGRGVLVVDDEDRENEGDLIYSAETLTNEQMALLIREGSGIVCLCLPDERV 75

Query: 69  KRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPG 128
           K L L  M   N S+  TAFT+SIEAK+G+TTG+SA DR               D+  PG
Sbjct: 76  KHLALPPMVENNSSQYGTAFTVSIEAKEGVTTGVSAADRVTTIKTAIADDAQPDDLARPG 135

Query: 129 HVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKH 188
           HV+P+ A+ GGV+ R GHTE ++D+  LA    + V+CEI N DGTMA+  ++  F  KH
Sbjct: 136 HVYPLRAQPGGVMTRRGHTEGTIDLMILAGLKPAGVLCEITNPDGTMARLAEIISFGAKH 195

Query: 189 NLKIGKIEDLIAYR 202
           +L +  IED++ YR
Sbjct: 196 DLPVLTIEDIVEYR 209


>RIBB_HAMD5 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 218

 Score =  158 bits (400), Expect = 6e-41
 Identities = 77/199 (38%), Positives = 119/199 (59%)

Query: 4   NNYASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLAL 63
           N+ A ++  +   K G   +++DDE RENEGD + +    + + +    ++G G++CL L
Sbjct: 11  NSVARVKKALENLKNGHGVMVLDDENRENEGDFVFAAETMTVEQMALTIRHGSGIVCLCL 70

Query: 64  DSVQAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXD 123
              + ++L L +M   N S  +T FT+SIEA KG+TTG+SA DR               D
Sbjct: 71  TEERCQQLELPMMVEKNSSTFQTPFTVSIEAAKGVTTGVSASDRITTIKAAISQTAKPAD 130

Query: 124 IVSPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFD 183
           +  PGHVFP+     GVL R+GHTEA++D+++LA    + V+CE+ N++GTMA+  ++  
Sbjct: 131 LHRPGHVFPLKGHPKGVLGRSGHTEAAIDLARLAGLKPAGVLCELTNDNGTMARAPEVIA 190

Query: 184 FANKHNLKIGKIEDLIAYR 202
           FA KH + +  IEDLI YR
Sbjct: 191 FAKKHKMTVLSIEDLIEYR 209


>RIBB_SALAR RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 217

 Score =  158 bits (399), Expect = 8e-41
 Identities = 76/197 (38%), Positives = 120/197 (60%)

Query: 6   YASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDS 65
           +  +E  ++  ++G   +++DDE RENEGD+I      + + +    ++G G++CL +  
Sbjct: 13  FERVELALDALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITE 72

Query: 66  VQAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIV 125
            + K+L+L +M   N S   T FT++IEA +G+TTG+SA DR               D+ 
Sbjct: 73  DRRKQLDLPMMVQNNTSAYGTGFTVTIEAAEGVTTGVSAADRVTTVRAAIADGAKPSDLN 132

Query: 126 SPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFA 185
            PGHVFP+ A+ GGVL R GHTEA++D+  LA    + V+CE+ N++GTMA+  +   FA
Sbjct: 133 RPGHVFPLRAQAGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDNGTMARAPECIAFA 192

Query: 186 NKHNLKIGKIEDLIAYR 202
            +HN+ +  IEDL+AYR
Sbjct: 193 GQHNMAVVTIEDLVAYR 209


>RIBB_PELCD RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 217

 Score =  157 bits (398), Expect = 1e-40
 Identities = 81/186 (43%), Positives = 113/186 (60%)

Query: 13  INIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQAKRLN 72
           I+  ++G   +LVDDE RENEGDLI      +   +  M +   G++CL L   + K+L 
Sbjct: 20  IDRLRQGRGVLLVDDENRENEGDLIFPAETITPAQMAMMIRECSGIVCLCLTEDKLKQLE 79

Query: 73  LSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPGHVFP 132
           L  M   N S N+TAFT+SIEA++G+TTG+SA DR               D+  PGHVFP
Sbjct: 80  LPQMVSDNTSANQTAFTLSIEARQGVTTGVSAADRVTTIRTAVADDCRPDDLARPGHVFP 139

Query: 133 IIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKHNLKI 192
           + A+ GGVL R GHTE +VD+ ++A    + V+CE+ NEDGTMA+  ++  FA +H L +
Sbjct: 140 LRARPGGVLTRRGHTEGTVDLMRMAGYKPAGVLCELTNEDGTMARLPEIITFAERHYLSV 199

Query: 193 GKIEDL 198
             IEDL
Sbjct: 200 VSIEDL 205


>RIBB_ENT38 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 217

 Score =  157 bits (397), Expect = 1e-40
 Identities = 76/194 (39%), Positives = 119/194 (61%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           +E  ++  ++G   +++DDE RENEGD+I +  + + + +    ++G G++CL ++  + 
Sbjct: 16  VEHALDALREGRGVMVLDDEHRENEGDMIFAAENMTVEQMALTIRHGSGIVCLCINEERR 75

Query: 69  KRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPG 128
           K+L+L +M   N S   T FT++IEA  G+TTG+SA DR               D+  PG
Sbjct: 76  KQLDLPMMVENNTSAFGTGFTVTIEAAHGVTTGVSAADRLTTVRAAIADGAKPSDLHRPG 135

Query: 129 HVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKH 188
           HVFP+ A+ GGVL R GHTEA++D+  LA    + V+CE+ N+DGTMA+  +   FA  H
Sbjct: 136 HVFPLRAQAGGVLTRGGHTEATLDLVTLAGFKPAGVLCELTNDDGTMARAPECVTFARLH 195

Query: 189 NLKIGKIEDLIAYR 202
           N+ +  IEDL+ YR
Sbjct: 196 NMPVVTIEDLVEYR 209


>RIBB_DESAD RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 217

 Score =  157 bits (397), Expect = 1e-40
 Identities = 78/194 (40%), Positives = 118/194 (60%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           +E  +   ++G   ++ D+E RENEGDLI S    S + +  M +   G++CL L   + 
Sbjct: 16  VEKGLQALREGRGILVTDNESRENEGDLIFSAEKLSDEQMAMMIRECSGIVCLCLTDEKT 75

Query: 69  KRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPG 128
           ++L L +M   N SR +T FT++IEA +G+TTG+SA DR               D+  PG
Sbjct: 76  EQLGLPMMVESNSSRYQTGFTVTIEAAEGVTTGVSAADRVTTVKAAIADGAKPADLHRPG 135

Query: 129 HVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKH 188
           HVFP+ A++GGVL R GHTEA+VD+  LA  N   V+CE+ N DGTMA+  ++ +F  KH
Sbjct: 136 HVFPLRAREGGVLEREGHTEATVDMMTLAGLNPCGVLCELTNPDGTMARLPEIVEFGQKH 195

Query: 189 NLKIGKIEDLIAYR 202
           ++ +  ++D+I YR
Sbjct: 196 DMPVLTVDDIINYR 209


>RIBB_SERP5 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 217

 Score =  157 bits (396), Expect = 2e-40
 Identities = 75/194 (38%), Positives = 120/194 (61%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           +E  +   + G   +++DDE RENEGD+I +    + + +    ++G G++CL L   + 
Sbjct: 16  VERALEALRNGRGVMVLDDENRENEGDMIFAAETMTVEQMALTIRHGSGIVCLCLTEERR 75

Query: 69  KRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPG 128
           ++L L +M   N S+ +TAFT++IEA +G+TTG+SA DR               D+  PG
Sbjct: 76  QQLELPMMVTNNSSQFQTAFTVTIEAAQGVTTGVSASDRLTTIRAAVADNAKPSDLNRPG 135

Query: 129 HVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKH 188
           HVFP+ A+ GGVL R GHTEA++D+  +A    + V+CE+ N+DG+MA   ++  FA +H
Sbjct: 136 HVFPLRAQPGGVLSRRGHTEATIDLVSMAGFKPAGVLCELTNDDGSMAHAPEVILFAKQH 195

Query: 189 NLKIGKIEDLIAYR 202
           ++ +  IEDL+AYR
Sbjct: 196 DMTVLTIEDLVAYR 209


>RIBB_YERE8 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 217

 Score =  156 bits (395), Expect = 2e-40
 Identities = 74/194 (38%), Positives = 120/194 (61%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           +E  I+  + G   +++DDE RENEGD++ +    + + +    ++G G++CL +   + 
Sbjct: 16  VERAIDALRNGRGVMVLDDESRENEGDMVFAAEAMTVEQMALTIRHGSGIVCLCITDERR 75

Query: 69  KRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPG 128
           ++L+L +M   N S+ +TAFT++IEA KG+TTG+SA DR               D+  PG
Sbjct: 76  QQLDLPMMVANNSSQFQTAFTVTIEAAKGVTTGVSAADRLTTIRAAIADNAKPTDLNRPG 135

Query: 129 HVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKH 188
           HVFP+  + GGVL R GHTEAS+D++ LA    + V+CE+ N+DG+MA   ++ +FA  H
Sbjct: 136 HVFPLRGQPGGVLSRRGHTEASIDLATLAGYKPAGVLCELTNDDGSMAHAPEVIEFAKLH 195

Query: 189 NLKIGKIEDLIAYR 202
           ++ +  I+DL  YR
Sbjct: 196 DMPVVTIDDLAEYR 209


>RIBB_SHEWM RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 217

 Score =  156 bits (394), Expect = 3e-40
 Identities = 79/194 (40%), Positives = 116/194 (59%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           +E+ +   ++G   ++VDDE RENEGDLI S    + + +  + +   G++CL L   + 
Sbjct: 16  VEAALTSLRQGQGVLVVDDEDRENEGDLIYSAQSLTNEQMALLIRECSGIVCLCLTDERI 75

Query: 69  KRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPG 128
           K+L+L  M   N S+  TAFT+SIEAK G+TTG+SA DR               D+  PG
Sbjct: 76  KQLDLPPMVEDNSSQYGTAFTVSIEAKVGVTTGVSAADRVTTIKAAIADNAVPEDLARPG 135

Query: 129 HVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKH 188
           HV+P+ A+ GGV  R GHTE ++D+  LA    + V+CEI N DGTMA+  ++  F  +H
Sbjct: 136 HVYPLRAQSGGVFSRRGHTEGTIDLMLLAGLKPAGVLCEITNPDGTMARLPEIIQFGQQH 195

Query: 189 NLKIGKIEDLIAYR 202
           NL +  IED++ YR
Sbjct: 196 NLPVLTIEDIVEYR 209


>RIBB_DESDG RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 219

 Score =  156 bits (394), Expect = 3e-40
 Identities = 77/194 (39%), Positives = 116/194 (59%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           +E+ ++  ++G   ++ DDE RENEGDLI +    S   +  + +   G++CL L   + 
Sbjct: 16  VEAALDALRRGHGVLVTDDEDRENEGDLIFAAETLSDSQMAMLIRECSGIVCLCLTDEKV 75

Query: 69  KRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPG 128
           + L L +M   N S+ +TAFT+SIEA  G++TG+SA DR               D+  PG
Sbjct: 76  RALGLPMMVENNSSQYQTAFTVSIEASCGVSTGVSAADRVCTIQAAIADDACPSDLCRPG 135

Query: 129 HVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKH 188
           HVFP+ A+ GGVL R GHTEA+VD+ +LA      V+CE+ N DGTMA+   + DF  KH
Sbjct: 136 HVFPLRARPGGVLERRGHTEATVDLMRLAGLKPCGVLCEVTNPDGTMARLPQIVDFGRKH 195

Query: 189 NLKIGKIEDLIAYR 202
           ++ +  ++DL+ YR
Sbjct: 196 DMVVLTVDDLVRYR 209


>RIBB_DESRM RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 217

 Score =  155 bits (393), Expect = 4e-40
 Identities = 82/197 (41%), Positives = 114/197 (57%)

Query: 6   YASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDS 65
           +  +E  +   + G   ++ DDE RENEGDLI      +   +  + +   G++CL L  
Sbjct: 13  FERVERALRSLRNGNGVLVTDDENRENEGDLIFPAQTLNEVQMAMLIRECSGIVCLCLTD 72

Query: 66  VQAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIV 125
            + + L L +M   N SR KTAFT++IEA  G+TTG+SA DR               D+ 
Sbjct: 73  EKVRSLGLPMMVENNSSRFKTAFTVTIEAAHGVTTGVSAADRVKTVKTAVAENAKPEDLN 132

Query: 126 SPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFA 185
            PGHVFP+ A  GGVL R GHTEA+VD+ KLA      V+CE+ N DGTMA+  ++  FA
Sbjct: 133 RPGHVFPLRACPGGVLERQGHTEATVDLMKLAGLQPYGVLCELTNIDGTMARLPEVVTFA 192

Query: 186 NKHNLKIGKIEDLIAYR 202
           NK+N+ +  I+DLI YR
Sbjct: 193 NKNNIPVVTIDDLIMYR 209


>RIBB_SHESW RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 217

 Score =  155 bits (392), Expect = 5e-40
 Identities = 78/194 (40%), Positives = 116/194 (59%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           +E+ +N  ++G   ++VDDE RENEGDLI +    +   +  + +   G++CL L   + 
Sbjct: 16  VEAGLNALRQGQGVLVVDDEDRENEGDLIFAAQTLTNAQMAMLIRECSGIVCLCLPDEKV 75

Query: 69  KRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPG 128
           K L L  M   N S+  TAFT+SIEAK G+TTG+SA DR               D+  PG
Sbjct: 76  KALELPPMVENNSSQYGTAFTVSIEAKVGVTTGVSAADRVTTIKAAIADGAKPSDLARPG 135

Query: 129 HVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKH 188
           HV+P+ A+ GGVL R GHTE ++D+ +LA    + V+CE+ N DGTMA+  ++  F  +H
Sbjct: 136 HVYPLRAQPGGVLTRRGHTEGTIDLMQLAGLKPAGVLCEVTNPDGTMARLPEIIAFGAQH 195

Query: 189 NLKIGKIEDLIAYR 202
           N+ +  IED++ YR
Sbjct: 196 NIPVLTIEDIVLYR 209


>RIBB_SHEPC RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 217

 Score =  155 bits (392), Expect = 5e-40
 Identities = 78/194 (40%), Positives = 116/194 (59%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           +E+ +N  ++G   ++VDDE RENEGDLI +    +   +  + +   G++CL L   + 
Sbjct: 16  VEAGLNALRQGQGVLVVDDEDRENEGDLIFAAQTLTNTQMAMLIRECSGIVCLCLPDEKV 75

Query: 69  KRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPG 128
           K L L  M   N S+  TAFT+SIEAK G+TTG+SA DR               D+  PG
Sbjct: 76  KALELPPMVENNSSQYGTAFTVSIEAKVGVTTGVSAADRVTTIKAAIADGAKPSDLARPG 135

Query: 129 HVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKH 188
           HV+P+ A+ GGVL R GHTE ++D+ +LA    + V+CE+ N DGTMA+  ++  F  +H
Sbjct: 136 HVYPLRAQPGGVLTRRGHTEGTIDLMQLAGLKPAGVLCEVTNPDGTMARLPEIIAFGAQH 195

Query: 189 NLKIGKIEDLIAYR 202
           N+ +  IED++ YR
Sbjct: 196 NIPVLTIEDIVLYR 209


>RIBBA_CORAM RecName: Full=Riboflavin biosynthesis protein
           ribBA;Includes:  RecName: Full=3,4-dihydroxy-2-butanone
           4-phosphate synthase;
          Length = 423

 Score =  155 bits (392), Expect = 5e-40
 Identities = 108/352 (30%), Positives = 177/352 (50%), Gaps = 20/352 (5%)

Query: 26  DDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQAKRLNLSLMSPINQSRNK 85
           D+E RENEGDLI +   ++ + + FM +Y  G IC+ L     KRLNL  M   N+    
Sbjct: 31  DNEDRENEGDLIFAAELATPELVAFMVRYSSGYICVPLLPEDCKRLNLPPMMGRNEDVRG 90

Query: 86  TAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPGHVFPIIAKDGGVLVRAG 145
           TA+T++++A  G TTGISA  R               D   PGHV P+ A+  GVL R G
Sbjct: 91  TAYTVTVDANTG-TTGISATSRAETMLRLADPMSVVDDFTRPGHVVPLAARPNGVLERDG 149

Query: 146 HTEASVDISKLAKKNNSAVICEIMNEDG--TMAKGQDLFDFANKHNLKIGKIEDLIAYRX 203
           HTEA++D+++LA    + V+CEI++E+   TMA+ ++L  F+++H+LK+  IE LI +R 
Sbjct: 150 HTEAAIDLARLAGLRPAGVLCEIVSEEDPTTMARSEELRRFSDEHDLKMISIEQLIEWRR 209

Query: 204 XXXXXXXXXXQSDIKVKNQKYKIRIYENLLDGSEHFALIKGNIK-----KGIIPRV--RV 256
                     ++ +      +    Y++ +DG EH ALI G ++     + +  RV    
Sbjct: 210 HNETQVRRTVETQLPTDFGSFTALGYKHEIDGQEHVALIAGGVEELNGAEDVFVRVHSEC 269

Query: 257 ISSNVVQNYLIN--QQLPNSF-------DKTLNYFKKFNNCVLVFIKDTNLKSVTQTLKD 307
           ++ +V  +   +  QQL  S             Y +      +  +      S+  +  D
Sbjct: 270 LTGDVFHSRRCDCGQQLHQSMXXXXXXXXXXXXYLRGHEGRGIGLLAKLKAYSLQDSGLD 329

Query: 308 YKNKNFYKKGNDKLIRNYGIGAQIIKDLKIKNMILITKSLKKVIGLEGYDIK 359
             + N  ++G  +  R Y +  QI++DL IK+  L+T +  K  GL G+ ++
Sbjct: 330 TVDANL-EQGLPEDAREYSVAGQILRDLGIKSANLLTNNPHKGEGLRGFGVE 380


>RIBB_PELPD RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 234

 Score =  154 bits (390), Expect = 9e-40
 Identities = 77/194 (39%), Positives = 117/194 (60%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           +E+ ++  + G   ++ DDE+RENEGDLI +    + + +  + +   G++CL L     
Sbjct: 18  VEAALDALRAGQGVLVTDDEQRENEGDLIFAAQSLTREQVAMLIRECSGIVCLCLTDEAV 77

Query: 69  KRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPG 128
           +RL+L LM   N SR +TAFT+SIEA +G+TTG+SA DR                +  PG
Sbjct: 78  RRLDLPLMVSDNSSRYQTAFTVSIEAAEGVTTGVSAADRLTTIRAAIADDAGPLCLSRPG 137

Query: 129 HVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKH 188
           HVFP+ A+ GGVL R GHTEA+VD+ +LA      V+CE+ N DG+MA+  ++  F+ KH
Sbjct: 138 HVFPLRARPGGVLERRGHTEATVDLMRLAGLKPCGVLCELTNPDGSMARMPEIVAFSRKH 197

Query: 189 NLKIGKIEDLIAYR 202
              +  +E+L+ YR
Sbjct: 198 GFPLITVEELVQYR 211


>RIBB_SHELP RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 217

 Score =  154 bits (389), Expect = 1e-39
 Identities = 77/194 (39%), Positives = 115/194 (59%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           +E+ +   + G   ++VDDE RENEGDLI S    + + +  + +   G++CL L   + 
Sbjct: 16  VEAALTALRAGQGVLVVDDEDRENEGDLIYSAEHLTQEQMALLIRECSGIVCLCLTDERV 75

Query: 69  KRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPG 128
           K+L L  M   N S+  TAFT+SIEAK G+TTG+SA DR               D+  PG
Sbjct: 76  KQLELPPMVEDNSSQYGTAFTVSIEAKVGVTTGVSAADRVTTIKAAIADDAKPSDLARPG 135

Query: 129 HVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKH 188
           HV+P+ A+ GGVL R GHTE ++D+ KLA    + V+CE+ N +GTMA+  ++  F  +H
Sbjct: 136 HVYPLRAQPGGVLTRRGHTEGTIDLMKLAGLKPAGVLCEVTNVNGTMARLPEIIAFGEQH 195

Query: 189 NLKIGKIEDLIAYR 202
            + +  IED++ YR
Sbjct: 196 KMPVLTIEDIVCYR 209


>RIBB_PHOLL RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 217

 Score =  154 bits (389), Expect = 1e-39
 Identities = 86/194 (44%), Positives = 127/194 (65%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           +E  IN  + G   +++D+E RENEGD+I +    + + +    +YG G++CL L   + 
Sbjct: 16  VEHAINALRDGKGVMVLDNEDRENEGDIIFAAETMTVEQMALTIRYGSGIVCLCLTEERR 75

Query: 69  KRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPG 128
           ++L L +M   N S  +TAFT++IEA +G+TTG+S                   D+  PG
Sbjct: 76  QQLQLPMMVENNSSPFQTAFTVTIEAAQGVTTGVSXXXXXXXXXXXXXXNAKPSDLNRPG 135

Query: 129 HVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKH 188
           HVFP+ A+ GGVLVR GHTEA++D+  LA    + V+CE+ N+DG+MA+  ++  FA  H
Sbjct: 136 HVFPLRAQPGGVLVRQGHTEAAIDLVSLAGFKPAGVLCELTNDDGSMARTLEVVQFAKLH 195

Query: 189 NLKIGKIEDLIAYR 202
           N+ +  IEDL+ YR
Sbjct: 196 NMPVVTIEDLVIYR 209


>RIBB_ENTS8 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 217

 Score =  154 bits (389), Expect = 1e-39
 Identities = 87/197 (44%), Positives = 129/197 (65%)

Query: 6   YASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDS 65
           +  +E+ I   ++G   +++DDE RENEGD+I +    + + +    ++G G++CL L  
Sbjct: 13  FERVENAIAALREGRGVMVLDDENRENEGDMIFAAETMTVEQMALTIRHGSGIVCLCLTE 72

Query: 66  VQAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIV 125
            + K+L+L +M   N S   T FT++IEA  G+TTG+S                   D+ 
Sbjct: 73  ERRKQLDLPMMVENNTSAFGTGFTVTIEAAHGVTTGVSXXXXXXXXXXXXXXXXKPSDLH 132

Query: 126 SPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFA 185
            PGHVFP+ A+ GGVL R GHTEA++D+  LA    + V+CE+ N+DGTMA+  +   FA
Sbjct: 133 RPGHVFPLRAQPGGVLTRGGHTEATIDLVSLAGFKPAGVLCELTNDDGTMARAPECIAFA 192

Query: 186 NKHNLKIGKIEDLIAYR 202
            +HN+ +  IEDL++YR
Sbjct: 193 REHNMPVVTIEDLVSYR 209


>RIBB_SHEPW RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 212

 Score =  154 bits (388), Expect = 2e-39
 Identities = 79/199 (39%), Positives = 117/199 (58%)

Query: 4   NNYASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLAL 63
           N    + + +   ++G   ++VDDE RENEGDLI S    + + +  + +   G++CL L
Sbjct: 11  NAIERVNAALTALREGKGVLVVDDEDRENEGDLIYSAETLTNEQMALLIRECSGIVCLCL 70

Query: 64  DSVQAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXD 123
              +  +L L  M   N S+  TAFT+SIEAK+G+TTG+SA DR               D
Sbjct: 71  TDERITQLELPPMVVDNNSQYGTAFTVSIEAKEGVTTGVSAADRVTTVKAAIADGAKPGD 130

Query: 124 IVSPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFD 183
           +  PGHV+P+ A+ GGVL R GHTE +VD+ KLA      V+CE+   DGTMA+  ++ +
Sbjct: 131 LARPGHVYPLRARPGGVLERRGHTEGTVDLMKLAGLKPFGVLCEVTLPDGTMARLPEIVE 190

Query: 184 FANKHNLKIGKIEDLIAYR 202
           F  +HN+ +  IED++AYR
Sbjct: 191 FGQQHNMPVLTIEDIVAYR 209


>RIBB_SHEPA RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 212

 Score =  154 bits (388), Expect = 2e-39
 Identities = 91/199 (45%), Positives = 131/199 (65%)

Query: 4   NNYASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLAL 63
           N    + + ++  ++G   ++VDDE RENEGDLI S    + + +  + +   G++CL L
Sbjct: 11  NPIERVNAALSALRQGKGVLVVDDEDRENEGDLIYSAETLTNQQMALLIRECSGIVCLCL 70

Query: 64  DSVQAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXD 123
              + K+L L  M   N S+  TAFT+SIEAK+G+TTG+SA DR                
Sbjct: 71  TDERIKQLQLPPMVSDNNSQYGTAFTVSIEAKQGVTTGVSAADRVTTXXXXXXXXXXXXX 130

Query: 124 IVSPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFD 183
           +  PGHV+P+ A+ GGVL R GHTE +VD+ KLA      V+CE+   DGTMA+  ++ +
Sbjct: 131 LARPGHVYPLRARPGGVLERRGHTEGTVDLMKLAGLQPFGVLCEVTLPDGTMARLPEIVE 190

Query: 184 FANKHNLKIGKIEDLIAYR 202
           FA +H++ +  IED++AYR
Sbjct: 191 FAQQHDMPVLTIEDIVAYR 209


>RIBB_SHESA RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 217

 Score =  153 bits (387), Expect = 2e-39
 Identities = 77/194 (39%), Positives = 115/194 (59%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           +E+ +   ++G   ++VDDE RENEGDLI +    +   +  + +   G++CL L   + 
Sbjct: 16  VEAGLEALRQGQGVLVVDDEDRENEGDLIFAAESLTNAQMAMLIRECSGIVCLCLPDEKV 75

Query: 69  KRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPG 128
           K L L  M   N S+  TAFT+SIEAK G+TTG+SA DR               D+  PG
Sbjct: 76  KALELPPMVENNSSQYGTAFTVSIEAKVGVTTGVSAADRVTTIKTAIADNAKPSDLARPG 135

Query: 129 HVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKH 188
           HV+P+ A+ GGVL R GHTE ++D+ +LA    + V+CE+ N DGTMA+  ++  F  +H
Sbjct: 136 HVYPLRAQPGGVLTRRGHTEGTIDLMQLAGLKPAGVLCEVTNPDGTMARLPEIIAFGAEH 195

Query: 189 NLKIGKIEDLIAYR 202
           N+ +  IED++ YR
Sbjct: 196 NMPVLTIEDIVIYR 209


>RIBB_SHEON RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 217

 Score =  153 bits (387), Expect = 2e-39
 Identities = 78/194 (40%), Positives = 115/194 (59%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           +E+ +N  ++G   ++VDDE RENEGDLI +    +   +  + +   G++CL L   + 
Sbjct: 16  VEAGLNALRQGLGVLVVDDEDRENEGDLIFAAESLTNAQMAMLIRECSGIVCLCLPDEKV 75

Query: 69  KRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPG 128
           K L L  M   N S+  TAFT+SIEAK G+TTG+SA DR               D+  PG
Sbjct: 76  KALALPPMVENNSSQYGTAFTVSIEAKVGVTTGVSAADRVTTIKTAIADHAKPSDLARPG 135

Query: 129 HVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKH 188
           HV+P+ A+ GGVL R GHTE ++D+ +LA    + V+CE+ N DGTMA+  ++  F   H
Sbjct: 136 HVYPLRAQPGGVLTRRGHTEGTIDLMQLAGLKPAGVLCEVTNPDGTMARLPEIIAFGALH 195

Query: 189 NLKIGKIEDLIAYR 202
           N+ +  IED++ YR
Sbjct: 196 NMPVLTIEDIVVYR 209


>RIBB_METLZ RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 219

 Score =  153 bits (387), Expect = 2e-39
 Identities = 84/197 (42%), Positives = 116/197 (58%), Gaps = 1/197 (0%)

Query: 6   YASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDS 65
           + +IE  +   + G M I+ DDE RENEGDLI +   ++ +N+NFMAKYGRGLIC+ +  
Sbjct: 4   FNTIEEALKSLQNGEMIIVTDDENRENEGDLICAAEYATTENVNFMAKYGRGLICMPMGR 63

Query: 66  VQAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIV 125
              ++L L  M   N   ++TAFT+SI+     TTGISA +R               D  
Sbjct: 64  SLVEKLCLPPMVLKNTDNHETAFTVSID-HVDTTTGISAVERGITARKCIDPNARPEDFR 122

Query: 126 SPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFA 185
            PGH+FP+ AKD GV  R GHTEA+VD+ KLA    + + CEIM ++G M +  +L   A
Sbjct: 123 RPGHMFPLQAKDNGVFEREGHTEATVDLMKLAGLREAGLCCEIMADNGEMMRTPELISMA 182

Query: 186 NKHNLKIGKIEDLIAYR 202
            ++NL    I+DL AYR
Sbjct: 183 KQYNLTFVTIKDLQAYR 199


>RIBB_DESAH RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 217

 Score =  153 bits (387), Expect = 2e-39
 Identities = 84/199 (42%), Positives = 116/199 (58%)

Query: 4   NNYASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLAL 63
           N    ++  I+    G   +LVDDE RENEGDLI    + +A+ +  + +   G+ICL L
Sbjct: 11  NPIERVDRAIDALVSGRGVLLVDDEDRENEGDLIFPAGNITAEQVALLIRECSGIICLCL 70

Query: 64  DSVQAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXD 123
              + ++L L  M   N S  +TAFTISIEA +G+TTG+SA DR               D
Sbjct: 71  PPERIEQLGLPQMVTCNTSAYQTAFTISIEAAEGVTTGVSAADRATTIRCAAALDARPED 130

Query: 124 IVSPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFD 183
           I SPGHVFP+ A + GVL R GHTE +VD+ +LA    + V+CE+ N DGTMA+   +  
Sbjct: 131 IHSPGHVFPLRAVEQGVLGRRGHTEGTVDLMRLAGLAPAGVLCELTNVDGTMARLPQIIT 190

Query: 184 FANKHNLKIGKIEDLIAYR 202
           FA++H   +  IED+ AYR
Sbjct: 191 FADEHGFPVLSIEDIAAYR 209


>RIBB_YERPY RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 217

 Score =  153 bits (386), Expect = 3e-39
 Identities = 73/193 (37%), Positives = 119/193 (61%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           +E  I+  + G   +++DDE RENEGD++ +    + + +    ++G G++CL +   + 
Sbjct: 16  VERAIDALRNGRGVMVLDDESRENEGDMVFAAEAMTLEQMALTIRHGSGIVCLCITDERR 75

Query: 69  KRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPG 128
           ++L+L +M   N S+ +TAFT++IEA +G+TTG+SA DR               D+  PG
Sbjct: 76  QQLDLPMMVTHNSSQFQTAFTVTIEAAEGVTTGVSAADRLTTIRKAIADNAKPADLNRPG 135

Query: 129 HVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKH 188
           HVFP+  + GGVL R GHTEAS+D++ LA    + V+CE+ N+DG+MA   ++  FA  H
Sbjct: 136 HVFPLRGQPGGVLSRRGHTEASIDLATLAGYKPAGVLCELTNDDGSMAHAPEVIAFAKLH 195

Query: 189 NLKIGKIEDLIAY 201
           ++ +  I+DL AY
Sbjct: 196 DMPVVTIDDLAAY 208


>RIBB_YERPS RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 217

 Score =  153 bits (386), Expect = 3e-39
 Identities = 73/193 (37%), Positives = 119/193 (61%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           +E  I+  + G   +++DDE RENEGD++ +    + + +    ++G G++CL +   + 
Sbjct: 16  VERAIDALRNGRGVMVLDDESRENEGDMVFAAEAMTLEQMALTIRHGSGIVCLCITDERR 75

Query: 69  KRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPG 128
           ++L+L +M   N S+ +TAFT++IEA +G+TTG+SA DR               D+  PG
Sbjct: 76  QQLDLPMMVTHNSSQFQTAFTVTIEAAEGVTTGVSAADRLTTIRKAIADNAKPADLNRPG 135

Query: 129 HVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKH 188
           HVFP+  + GGVL R GHTEAS+D++ LA    + V+CE+ N+DG+MA   ++  FA  H
Sbjct: 136 HVFPLRGQPGGVLSRRGHTEASIDLATLAGYKPAGVLCELTNDDGSMAHAPEVIAFAKLH 195

Query: 189 NLKIGKIEDLIAY 201
           ++ +  I+DL AY
Sbjct: 196 DMPVVTIDDLAAY 208


>RIBB_YERPP RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 217

 Score =  153 bits (386), Expect = 3e-39
 Identities = 73/193 (37%), Positives = 119/193 (61%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           +E  I+  + G   +++DDE RENEGD++ +    + + +    ++G G++CL +   + 
Sbjct: 16  VERAIDALRNGRGVMVLDDESRENEGDMVFAAEAMTLEQMALTIRHGSGIVCLCITDERR 75

Query: 69  KRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPG 128
           ++L+L +M   N S+ +TAFT++IEA +G+TTG+SA DR               D+  PG
Sbjct: 76  QQLDLPMMVTHNSSQFQTAFTVTIEAAEGVTTGVSAADRLTTIRKAIADNAKPADLNRPG 135

Query: 129 HVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKH 188
           HVFP+  + GGVL R GHTEAS+D++ LA    + V+CE+ N+DG+MA   ++  FA  H
Sbjct: 136 HVFPLRGQPGGVLSRRGHTEASIDLATLAGYKPAGVLCELTNDDGSMAHAPEVIAFAKLH 195

Query: 189 NLKIGKIEDLIAY 201
           ++ +  I+DL AY
Sbjct: 196 DMPVVTIDDLAAY 208


>RIBB_YERPN RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 217

 Score =  153 bits (386), Expect = 3e-39
 Identities = 73/193 (37%), Positives = 119/193 (61%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           +E  I+  + G   +++DDE RENEGD++ +    + + +    ++G G++CL +   + 
Sbjct: 16  VERAIDALRNGRGVMVLDDESRENEGDMVFAAEAMTLEQMALTIRHGSGIVCLCITDERR 75

Query: 69  KRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPG 128
           ++L+L +M   N S+ +TAFT++IEA +G+TTG+SA DR               D+  PG
Sbjct: 76  QQLDLPMMVTHNSSQFQTAFTVTIEAAEGVTTGVSAADRLTTIRKAIADNAKPADLNRPG 135

Query: 129 HVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKH 188
           HVFP+  + GGVL R GHTEAS+D++ LA    + V+CE+ N+DG+MA   ++  FA  H
Sbjct: 136 HVFPLRGQPGGVLSRRGHTEASIDLATLAGYKPAGVLCELTNDDGSMAHAPEVIAFAKLH 195

Query: 189 NLKIGKIEDLIAY 201
           ++ +  I+DL AY
Sbjct: 196 DMPVVTIDDLAAY 208


>RIBB_YERPG RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 217

 Score =  153 bits (386), Expect = 3e-39
 Identities = 73/193 (37%), Positives = 119/193 (61%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           +E  I+  + G   +++DDE RENEGD++ +    + + +    ++G G++CL +   + 
Sbjct: 16  VERAIDALRNGRGVMVLDDESRENEGDMVFAAEAMTLEQMALTIRHGSGIVCLCITDERR 75

Query: 69  KRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPG 128
           ++L+L +M   N S+ +TAFT++IEA +G+TTG+SA DR               D+  PG
Sbjct: 76  QQLDLPMMVTHNSSQFQTAFTVTIEAAEGVTTGVSAADRLTTIRKAIADNAKPADLNRPG 135

Query: 129 HVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKH 188
           HVFP+  + GGVL R GHTEAS+D++ LA    + V+CE+ N+DG+MA   ++  FA  H
Sbjct: 136 HVFPLRGQPGGVLSRRGHTEASIDLATLAGYKPAGVLCELTNDDGSMAHAPEVIAFAKLH 195

Query: 189 NLKIGKIEDLIAY 201
           ++ +  I+DL AY
Sbjct: 196 DMPVVTIDDLAAY 208


>RIBB_YERPE RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 217

 Score =  153 bits (386), Expect = 3e-39
 Identities = 73/193 (37%), Positives = 119/193 (61%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           +E  I+  + G   +++DDE RENEGD++ +    + + +    ++G G++CL +   + 
Sbjct: 16  VERAIDALRNGRGVMVLDDESRENEGDMVFAAEAMTLEQMALTIRHGSGIVCLCITDERR 75

Query: 69  KRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPG 128
           ++L+L +M   N S+ +TAFT++IEA +G+TTG+SA DR               D+  PG
Sbjct: 76  QQLDLPMMVTHNSSQFQTAFTVTIEAAEGVTTGVSAADRLTTIRKAIADNAKPADLNRPG 135

Query: 129 HVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKH 188
           HVFP+  + GGVL R GHTEAS+D++ LA    + V+CE+ N+DG+MA   ++  FA  H
Sbjct: 136 HVFPLRGQPGGVLSRRGHTEASIDLATLAGYKPAGVLCELTNDDGSMAHAPEVIAFAKLH 195

Query: 189 NLKIGKIEDLIAY 201
           ++ +  I+DL AY
Sbjct: 196 DMPVVTIDDLAAY 208


>RIBB_YERPB RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 217

 Score =  153 bits (386), Expect = 3e-39
 Identities = 73/193 (37%), Positives = 119/193 (61%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           +E  I+  + G   +++DDE RENEGD++ +    + + +    ++G G++CL +   + 
Sbjct: 16  VERAIDALRNGRGVMVLDDESRENEGDMVFAAEAMTLEQMALTIRHGSGIVCLCITDERR 75

Query: 69  KRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPG 128
           ++L+L +M   N S+ +TAFT++IEA +G+TTG+SA DR               D+  PG
Sbjct: 76  QQLDLPMMVTHNSSQFQTAFTVTIEAAEGVTTGVSAADRLTTIRKAIADNAKPADLNRPG 135

Query: 129 HVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKH 188
           HVFP+  + GGVL R GHTEAS+D++ LA    + V+CE+ N+DG+MA   ++  FA  H
Sbjct: 136 HVFPLRGQPGGVLSRRGHTEASIDLATLAGYKPAGVLCELTNDDGSMAHAPEVIAFAKLH 195

Query: 189 NLKIGKIEDLIAY 201
           ++ +  I+DL AY
Sbjct: 196 DMPVVTIDDLAAY 208


>RIBB_YERPA RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 217

 Score =  153 bits (386), Expect = 3e-39
 Identities = 73/193 (37%), Positives = 119/193 (61%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           +E  I+  + G   +++DDE RENEGD++ +    + + +    ++G G++CL +   + 
Sbjct: 16  VERAIDALRNGRGVMVLDDESRENEGDMVFAAEAMTLEQMALTIRHGSGIVCLCITDERR 75

Query: 69  KRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPG 128
           ++L+L +M   N S+ +TAFT++IEA +G+TTG+SA DR               D+  PG
Sbjct: 76  QQLDLPMMVTHNSSQFQTAFTVTIEAAEGVTTGVSAADRLTTIRKAIADNAKPADLNRPG 135

Query: 129 HVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKH 188
           HVFP+  + GGVL R GHTEAS+D++ LA    + V+CE+ N+DG+MA   ++  FA  H
Sbjct: 136 HVFPLRGQPGGVLSRRGHTEASIDLATLAGYKPAGVLCELTNDDGSMAHAPEVIAFAKLH 195

Query: 189 NLKIGKIEDLIAY 201
           ++ +  I+DL AY
Sbjct: 196 DMPVVTIDDLAAY 208


>RIBB_YERP3 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 217

 Score =  153 bits (386), Expect = 3e-39
 Identities = 73/193 (37%), Positives = 119/193 (61%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           +E  I+  + G   +++DDE RENEGD++ +    + + +    ++G G++CL +   + 
Sbjct: 16  VERAIDALRNGRGVMVLDDESRENEGDMVFAAEAMTLEQMALTIRHGSGIVCLCITDERR 75

Query: 69  KRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPG 128
           ++L+L +M   N S+ +TAFT++IEA +G+TTG+SA DR               D+  PG
Sbjct: 76  QQLDLPMMVTHNSSQFQTAFTVTIEAAEGVTTGVSAADRLTTIRKAIADNAKPADLNRPG 135

Query: 129 HVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKH 188
           HVFP+  + GGVL R GHTEAS+D++ LA    + V+CE+ N+DG+MA   ++  FA  H
Sbjct: 136 HVFPLRGQPGGVLSRRGHTEASIDLATLAGYKPAGVLCELTNDDGSMAHAPEVIAFAKLH 195

Query: 189 NLKIGKIEDLIAY 201
           ++ +  I+DL AY
Sbjct: 196 DMPVVTIDDLAAY 208


>RIBB_SHESR RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 217

 Score =  153 bits (386), Expect = 3e-39
 Identities = 77/194 (39%), Positives = 114/194 (58%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           +E+ +   ++G   ++VDDE RENEGDLI +    +   +  + +   G++CL L   + 
Sbjct: 16  VEAGLEALRQGQGVLVVDDEDRENEGDLIFAAESLTNAQMAMLIRECSGIVCLCLPDEKV 75

Query: 69  KRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPG 128
           K L L  M   N S+  TAFT+SIEAK G+TTG+SA DR               D+  PG
Sbjct: 76  KALELPPMVENNSSQYGTAFTVSIEAKVGVTTGVSAADRVTTIKAAIADNAKPSDLARPG 135

Query: 129 HVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKH 188
           HV+P+ A+ GGVL R GHTE ++D+ +LA    + V+CE+ N DGTMA+  ++  F   H
Sbjct: 136 HVYPLRAQPGGVLTRRGHTEGTIDLMQLAGLKPAGVLCEVTNPDGTMARLPEIIAFGAAH 195

Query: 189 NLKIGKIEDLIAYR 202
           N+ +  IED++ YR
Sbjct: 196 NMPVLTIEDIVVYR 209


>RIBB_SHESM RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 217

 Score =  153 bits (386), Expect = 3e-39
 Identities = 77/194 (39%), Positives = 114/194 (58%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           +E+ +   ++G   ++VDDE RENEGDLI +    +   +  + +   G++CL L   + 
Sbjct: 16  VEAGLEALRQGQGVLVVDDEDRENEGDLIFAAESLTNAQMAMLIRECSGIVCLCLPDEKV 75

Query: 69  KRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPG 128
           K L L  M   N S+  TAFT+SIEAK G+TTG+SA DR               D+  PG
Sbjct: 76  KALELPPMVENNSSQYGTAFTVSIEAKVGVTTGVSAADRVTTIKAAIADNAKPSDLARPG 135

Query: 129 HVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKH 188
           HV+P+ A+ GGVL R GHTE ++D+ +LA    + V+CE+ N DGTMA+  ++  F   H
Sbjct: 136 HVYPLRAQPGGVLTRRGHTEGTIDLMQLAGLKPAGVLCEVTNPDGTMARLPEIIAFGAAH 195

Query: 189 NLKIGKIEDLIAYR 202
           N+ +  IED++ YR
Sbjct: 196 NMPVLTIEDIVVYR 209


>RIBB_SHEHH RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 212

 Score =  153 bits (386), Expect = 3e-39
 Identities = 78/199 (39%), Positives = 118/199 (59%)

Query: 4   NNYASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLAL 63
           N    + + +   ++G   ++VDDE RENEGDLI S    + + +  + +   G++CL L
Sbjct: 11  NAIERVNAALTALRQGKGVLVVDDEDRENEGDLIYSAETLTNEQMALLIRECSGIVCLCL 70

Query: 64  DSVQAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXD 123
              + ++L L  M   N S+  TAFT+SIEAK+G+TTG+SA DR               D
Sbjct: 71  TDERIEQLQLPPMVSDNNSQYGTAFTVSIEAKQGVTTGVSAADRVTTIKTAIADNAKPDD 130

Query: 124 IVSPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFD 183
           +  PGHV+P+ A+ GGVL R GHTE +VD+ KLA      V+CE+   DGTMA+  ++ +
Sbjct: 131 LARPGHVYPLRARPGGVLERRGHTEGTVDLMKLAGLKPYGVLCEVTLVDGTMARLPEIIE 190

Query: 184 FANKHNLKIGKIEDLIAYR 202
           F  +H++ +  IED++AYR
Sbjct: 191 FGQQHDMPVLTIEDIVAYR 209


>RIBB_ERWT9 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 218

 Score =  153 bits (386), Expect = 3e-39
 Identities = 74/190 (38%), Positives = 117/190 (61%)

Query: 13  INIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQAKRLN 72
           I   + G   +++DDE RENEGD+I +    + + +    ++G G++CL L+  + ++L+
Sbjct: 20  IEALRAGRGVMVLDDEDRENEGDMIFAAETMTVEQMALTIRHGSGIVCLCLNEERLEQLD 79

Query: 73  LSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPGHVFP 132
           L +M   N S   T FT++IEA +G+TTG+SA DR               D+  PGHVFP
Sbjct: 80  LPMMVQNNTSAYGTGFTVTIEAAEGVTTGVSATDRLTTIRAAIADDARPSDLNRPGHVFP 139

Query: 133 IIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKHNLKI 192
           + A+ GGVL R GHTEA++D+  LA    + V+CE+ N+DG+MA   ++  FA +H++ +
Sbjct: 140 LRARSGGVLTRGGHTEATLDLVTLAGFKPAGVLCELTNDDGSMAHAPEVIVFARQHDMPV 199

Query: 193 GKIEDLIAYR 202
             IEDL++YR
Sbjct: 200 VTIEDLVSYR 209


>RIBB_SHEB9 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 217

 Score =  152 bits (385), Expect = 3e-39
 Identities = 77/194 (39%), Positives = 114/194 (58%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           +E+ +N  ++G   ++VDDE RENEGDLI +    +   +  + +   G++CL L   + 
Sbjct: 16  VEAGLNALRQGQGVLVVDDEDRENEGDLIFAAETLTNAQMAMLIRECSGIVCLCLPDEKV 75

Query: 69  KRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPG 128
           K L L  M   N S+  TAFT+SIEA  G+TTG+SA DR               D+  PG
Sbjct: 76  KALELPAMVEHNSSQYGTAFTVSIEATVGVTTGVSAADRVTTIKAAIADNAKPSDLARPG 135

Query: 129 HVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKH 188
           HV+P+ A+ GGVL R GHTE ++D+ +LA    + V+CE+ N DGTMA+  ++  F   H
Sbjct: 136 HVYPLRAQPGGVLTRRGHTEGTIDLVQLAGLKPAGVLCEVTNPDGTMARLPEIIAFGALH 195

Query: 189 NLKIGKIEDLIAYR 202
           N+ +  IED++ YR
Sbjct: 196 NMPVLTIEDIVVYR 209


>RIBB_SHEB2 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 217

 Score =  152 bits (385), Expect = 3e-39
 Identities = 77/194 (39%), Positives = 114/194 (58%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           +E+ +N  ++G   ++VDDE RENEGDLI +    +   +  + +   G++CL L   + 
Sbjct: 16  VEAGLNALRQGQGVLVVDDEDRENEGDLIFAAETLTNAQMAMLIRECSGIVCLCLPDEKV 75

Query: 69  KRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPG 128
           K L L  M   N S+  TAFT+SIEA  G+TTG+SA DR               D+  PG
Sbjct: 76  KALELPAMVEHNSSQYGTAFTVSIEATVGVTTGVSAADRVTTIKAAIADNAKPSDLARPG 135

Query: 129 HVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKH 188
           HV+P+ A+ GGVL R GHTE ++D+ +LA    + V+CE+ N DGTMA+  ++  F   H
Sbjct: 136 HVYPLRAQPGGVLTRRGHTEGTIDLVQLAGLKPAGVLCEVTNPDGTMARLPEIIAFGALH 195

Query: 189 NLKIGKIEDLIAYR 202
           N+ +  IED++ YR
Sbjct: 196 NMPVLTIEDIVVYR 209


>RIBB_SHEB8 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 217

 Score =  152 bits (384), Expect = 4e-39
 Identities = 77/194 (39%), Positives = 114/194 (58%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           +E+ +N  ++G   ++VDDE RENEGDLI +    +   +  + +   G++CL L   + 
Sbjct: 16  VEAGLNALRQGQGVLVVDDEDRENEGDLIFAAETLTNAQMAMLIRECSGIVCLCLPDEKI 75

Query: 69  KRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPG 128
           K L L  M   N S+  TAFT+SIEA  G+TTG+SA DR               D+  PG
Sbjct: 76  KALELPAMVEHNSSQYGTAFTVSIEATVGVTTGVSAADRVTTIKAAIADNAKPSDLARPG 135

Query: 129 HVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKH 188
           HV+P+ A+ GGVL R GHTE ++D+ +LA    + V+CE+ N DGTMA+  ++  F   H
Sbjct: 136 HVYPLRAQPGGVLTRRGHTEGTIDLVQLAGLKPAGVLCEVTNPDGTMARLPEIIAFGALH 195

Query: 189 NLKIGKIEDLIAYR 202
           N+ +  IED++ YR
Sbjct: 196 NMPVLTIEDIVVYR 209


>RIBB_SHEB5 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 217

 Score =  152 bits (384), Expect = 4e-39
 Identities = 77/194 (39%), Positives = 114/194 (58%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           +E+ +N  ++G   ++VDDE RENEGDLI +    +   +  + +   G++CL L   + 
Sbjct: 16  VEAGLNALRQGQGVLVVDDEDRENEGDLIFAAETLTNAQMAMLIRECSGIVCLCLPDEKI 75

Query: 69  KRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPG 128
           K L L  M   N S+  TAFT+SIEA  G+TTG+SA DR               D+  PG
Sbjct: 76  KALELPAMVEHNSSQYGTAFTVSIEATVGVTTGVSAADRVTTIKAAIADNAKPSDLARPG 135

Query: 129 HVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKH 188
           HV+P+ A+ GGVL R GHTE ++D+ +LA    + V+CE+ N DGTMA+  ++  F   H
Sbjct: 136 HVYPLRAQPGGVLTRRGHTEGTIDLVQLAGLKPAGVLCEVTNPDGTMARLPEIIAFGALH 195

Query: 189 NLKIGKIEDLIAYR 202
           N+ +  IED++ YR
Sbjct: 196 NMPVLTIEDIVVYR 209


>RIBB_RHORT RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 214

 Score =  152 bits (384), Expect = 4e-39
 Identities = 80/192 (41%), Positives = 112/192 (58%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           +   ++  ++G   I+VDDE RENEGDLI +    +A+ ++ M + G G++CL L     
Sbjct: 19  VSRAVDSLRQGQGVIVVDDEDRENEGDLIFAAETLTAEQMSRMIRDGSGIVCLILTDPDL 78

Query: 69  KRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPG 128
            RL L  M   N SRN T FT+SIEA++G+TTG+SA DR               D+  PG
Sbjct: 79  DRLALPPMVAHNTSRNGTGFTVSIEAREGVTTGVSAADRVTTIRAAIDPASTADDLARPG 138

Query: 129 HVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKH 188
           HVFP+ A   G+  R GHTEA++ + +LA    + V+CE+MN DGTMA+   L  +   H
Sbjct: 139 HVFPLRAHADGLSARRGHTEATIALMRLAGLRPAGVLCEVMNPDGTMARLPTLIGYGQAH 198

Query: 189 NLKIGKIEDLIA 200
            L I  IEDL+A
Sbjct: 199 GLPIVSIEDLVA 210


>RIBB_PHOPR RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 228

 Score =  152 bits (384), Expect = 4e-39
 Identities = 78/197 (39%), Positives = 117/197 (59%)

Query: 6   YASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDS 65
           +  +E+ +   ++G   ++VDDE RENEGD+I +    +++ +  M +   G++CL L  
Sbjct: 13  FERVEAGLTAIREGRGVLVVDDEDRENEGDIIFAAETLTSEQMALMIRECSGIVCLCLTD 72

Query: 66  VQAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIV 125
            + K+L L +M   N S N+T FT++IEA KG+TTG+SA DR               D+ 
Sbjct: 73  ERVKQLELPMMVENNTSANETGFTVTIEAAKGVTTGVSAADRVTTIKTAIADGAVPADLN 132

Query: 126 SPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFA 185
            PGHVFP+ A   GVL R GHTEA++D+ +L+      V+CE+ N DGTMA+  ++  F 
Sbjct: 133 HPGHVFPLKANADGVLGRRGHTEATIDLMRLSGLKPYGVLCELTNIDGTMARLPEVIVFG 192

Query: 186 NKHNLKIGKIEDLIAYR 202
            K N+ +  IEDL AYR
Sbjct: 193 KKFNMPVLTIEDLAAYR 209


>RIBB_BUCAP RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 213

 Score =  150 bits (379), Expect = 2e-38
 Identities = 77/198 (38%), Positives = 114/198 (57%)

Query: 4   NNYASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLAL 63
           N    ++  I+  + G   I++DDEKRENEGDL+ S+   + + +    +YG G++CL +
Sbjct: 11  NPIERVKKAISALQLGEGIIILDDEKRENEGDLVFSSETMTVEQMALTIRYGSGIVCLCI 70

Query: 64  DSVQAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXD 123
              + K+LNL +M   N S  +T FT++IEA KG++TG+SAKDR               D
Sbjct: 71  TESKRKKLNLPMMVKHNTSTYRTGFTVTIEASKGVSTGVSAKDRLTTIKTATADDAQPSD 130

Query: 124 IVSPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFD 183
           +  PGHVFP+ A  GG+L RAGHTEA+++I  LA      VICE+ N+DG+M++  +   
Sbjct: 131 LNRPGHVFPLRANGGGILARAGHTEAAIEIVSLAGFKPYGVICELTNKDGSMSRTPEXXX 190

Query: 184 FANKHNLKIGKIEDLIAY 201
                      I+DLI Y
Sbjct: 191 XXXXXXXXXLTIKDLILY 208


>RIBB_BORPE RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 230

 Score =  150 bits (378), Expect = 2e-38
 Identities = 82/193 (42%), Positives = 113/193 (58%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           +E  +   + G   IL+DD  RENE DLI++    +   +  + + G G++CL L     
Sbjct: 21  LERALQHLRIGRPVILMDDFDRENEADLIVAADKLTVPVMAQLIRDGSGIVCLCLPGETL 80

Query: 69  KRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPG 128
            RL L  M   N+SR  TAFT+SIEA++G+TTG+SA DR               D+VSPG
Sbjct: 81  DRLELPPMVDSNRSRYSTAFTVSIEAREGVTTGVSAVDRVTTIRAAIAPGARSGDVVSPG 140

Query: 129 HVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKH 188
           HVFP+ A+ GGVL R GHTE SVD++ LA    + V+CE+MN DGTM +G  L  +A K 
Sbjct: 141 HVFPLRAQPGGVLTRRGHTEGSVDLAALAGLRPAGVLCELMNADGTMMRGASLERYAAKE 200

Query: 189 NLKIGKIEDLIAY 201
            L    I++L A+
Sbjct: 201 GLVALAIDELAAH 213


>RIBB_BORPA RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 230

 Score =  150 bits (378), Expect = 2e-38
 Identities = 82/193 (42%), Positives = 113/193 (58%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           +E  +   + G   IL+DD  RENE DLI++    +   +  + + G G++CL L     
Sbjct: 21  LERALQHLRIGRPVILMDDFDRENEADLIVAADKLTVPVMAQLIRDGSGIVCLCLPGETL 80

Query: 69  KRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPG 128
            RL L  M   N+SR  TAFT+SIEA++G+TTG+SA DR               D+VSPG
Sbjct: 81  DRLELPPMVDSNRSRYSTAFTVSIEAREGVTTGVSAVDRVTTIRAAIAPGARSGDVVSPG 140

Query: 129 HVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKH 188
           HVFP+ A+ GGVL R GHTE SVD++ LA    + V+CE+MN DGTM +G  L  +A K 
Sbjct: 141 HVFPLRAQPGGVLTRRGHTEGSVDLAALAGLRPAGVLCELMNADGTMMRGASLERYAAKE 200

Query: 189 NLKIGKIEDLIAY 201
            L    I++L A+
Sbjct: 201 GLVALAIDELAAH 213


>RIBB_BORBR RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 230

 Score =  150 bits (378), Expect = 2e-38
 Identities = 82/193 (42%), Positives = 113/193 (58%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           +E  +   + G   IL+DD  RENE DLI++    +   +  + + G G++CL L     
Sbjct: 21  LERALQHLRIGRPVILMDDFDRENEADLIVAADKLTVPVMAQLIRDGSGIVCLCLPGETL 80

Query: 69  KRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPG 128
            RL L  M   N+SR  TAFT+SIEA++G+TTG+SA DR               D+VSPG
Sbjct: 81  DRLELPPMVDSNRSRYSTAFTVSIEAREGVTTGVSAVDRVTTIRAAIAPGARSGDVVSPG 140

Query: 129 HVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKH 188
           HVFP+ A+ GGVL R GHTE SVD++ LA    + V+CE+MN DGTM +G  L  +A K 
Sbjct: 141 HVFPLRAQPGGVLTRRGHTEGSVDLAALAGLRPAGVLCELMNADGTMMRGASLERYAAKE 200

Query: 189 NLKIGKIEDLIAY 201
            L    I++L A+
Sbjct: 201 GLVALAIDELAAH 213


>RIBB_DESVV RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 214

 Score =  149 bits (377), Expect = 3e-38
 Identities = 81/194 (41%), Positives = 111/194 (57%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           +E  +   + G   ++ DD  RENEGDLI +    +   +  M +   G++CL L   + 
Sbjct: 16  VERGLAALRTGQGVLVADDADRENEGDLIFAAETLTPAQMAMMIRECSGIVCLCLPEERV 75

Query: 69  KRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPG 128
            RL L +M   N S   TAFTISIEA +G+TTG+SA DR                + SPG
Sbjct: 76  SRLGLPMMVAHNTSSMGTAFTISIEAAEGVTTGVSAADRVRTVQAAIDDAACPGCLRSPG 135

Query: 129 HVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKH 188
           HVFP+ A  GGVL R GHTEA+VD+ +LA      V+CE+ N DGTMA+   L DFA ++
Sbjct: 136 HVFPLRASPGGVLERRGHTEATVDLMRLAGLKPYGVLCELTNPDGTMARLPQLVDFAQRN 195

Query: 189 NLKIGKIEDLIAYR 202
            + +  +EDL+AYR
Sbjct: 196 RMTVLTVEDLVAYR 209


>RIBB_DESVH RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 214

 Score =  149 bits (377), Expect = 3e-38
 Identities = 81/194 (41%), Positives = 111/194 (57%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           +E  +   + G   ++ DD  RENEGDLI +    +   +  M +   G++CL L   + 
Sbjct: 16  VERGLAALRTGQGVLVADDADRENEGDLIFAAETLTPAQMAMMIRECSGIVCLCLPEERV 75

Query: 69  KRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPG 128
            RL L +M   N S   TAFTISIEA +G+TTG+SA DR                + SPG
Sbjct: 76  SRLGLPMMVAHNTSSMGTAFTISIEAAEGVTTGVSAADRVRTVKAAIDDAACPGCLRSPG 135

Query: 129 HVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKH 188
           HVFP+ A  GGVL R GHTEA+VD+ +LA      V+CE+ N DGTMA+   L DFA ++
Sbjct: 136 HVFPLRASPGGVLERRGHTEATVDLMRLAGLKPYGVLCELTNPDGTMARLPQLVDFAQRN 195

Query: 189 NLKIGKIEDLIAYR 202
            + +  +EDL+AYR
Sbjct: 196 RMTVLTVEDLVAYR 209


>RIBB_RALSO RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 227

 Score =  149 bits (376), Expect = 4e-38
 Identities = 77/180 (42%), Positives = 112/180 (62%)

Query: 23  ILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQAKRLNLSLMSPINQS 82
           +++DD  RENE DLII+    +   +  + +   G++CL L + +A  L L  M   N+S
Sbjct: 38  VVLDDADRENEADLIIAADRLTHAGMAMLIRECSGIVCLCLTAEKAAVLGLRPMVEHNRS 97

Query: 83  RNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPGHVFPIIAKDGGVLV 142
           +  TAFT+SIEA+ G++TG+SA DR                +VSPGHVFP++A+ GGVL 
Sbjct: 98  QYGTAFTVSIEARVGVSTGVSAADRITTIRAAVAPDADAQSVVSPGHVFPLVAQAGGVLA 157

Query: 143 RAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKHNLKIGKIEDLIAYR 202
           R GHTE SVD+++LA  + + V+CE+M  DGTMA+  D   FA++H L +  IED+  YR
Sbjct: 158 RRGHTEGSVDLARLAGLSPAGVLCELMLPDGTMARRDDAVRFADQHGLPVLTIEDIARYR 217


>RIBB_VIBC3 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 218

 Score =  147 bits (372), Expect = 1e-37
 Identities = 75/194 (38%), Positives = 109/194 (56%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           +E+ +   ++G   +L+DDE RENEGD+I +    +   +  M +   G++CL L   QA
Sbjct: 17  VENALQALREGRGVLLLDDEDRENEGDIIYAVESLTTVQMALMIRECSGIVCLCLTEAQA 76

Query: 69  KRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPG 128
            RL L LM   N S N+TAFT+SIEAK G+TTG+SA+DR               D+  PG
Sbjct: 77  DRLALPLMVVNNNSANQTAFTVSIEAKHGVTTGVSAQDRVTTIKTAANPQAKPEDLARPG 136

Query: 129 HVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKH 188
           HVFP             HTE +VD+ ++A    + V+CE+ N DG+MAK  ++  F   H
Sbjct: 137 HVFPXXXXXXXXXXXXXHTEGTVDLMQMAGLQPAGVLCELTNPDGSMAKTPEIIAFGKLH 196

Query: 189 NLKIGKIEDLIAYR 202
           N+ +  IED++ YR
Sbjct: 197 NMPVLTIEDMVQYR 210


>RIBB_VIBCM RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 218

 Score =  147 bits (370), Expect = 2e-37
 Identities = 74/194 (38%), Positives = 109/194 (56%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           +E+ +   ++G   +L+DDE RENEGD+I +    +   +  M +   G++CL L   QA
Sbjct: 17  VENALQALREGRGVLLLDDEDRENEGDIIYAVESLTTAQMALMIRECSGIVCLCLTEAQA 76

Query: 69  KRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPG 128
            RL L  M   N S N+TAFT+SIEAK G+TTG+SA+DR               D+  PG
Sbjct: 77  DRLALPPMVVNNNSANQTAFTVSIEAKHGVTTGVSAQDRVTTIKTAANPQAKPEDLARPG 136

Query: 129 HVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKH 188
           HVFP             HTE +VD+ ++A    + V+CE+ N DG+MAK  ++ +F   H
Sbjct: 137 HVFPXXXXXXXXXXXXXHTEGTVDLMQMAGLQPAGVLCELTNPDGSMAKTPEIIEFGKLH 196

Query: 189 NLKIGKIEDLIAYR 202
           N+ +  IED++ YR
Sbjct: 197 NMPVLTIEDMVQYR 210


>RIBB_VIBCH RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 218

 Score =  147 bits (370), Expect = 2e-37
 Identities = 74/194 (38%), Positives = 109/194 (56%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           +E+ +   ++G   +L+DDE RENEGD+I +    +   +  M +   G++CL L   QA
Sbjct: 17  VENALQALREGRGVLLLDDEDRENEGDIIYAVESLTTAQMALMIRECSGIVCLCLTEAQA 76

Query: 69  KRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPG 128
            RL L  M   N S N+TAFT+SIEAK G+TTG+SA+DR               D+  PG
Sbjct: 77  DRLALPPMVVNNNSANQTAFTVSIEAKHGVTTGVSAQDRVTTIKTAANPQAKPEDLARPG 136

Query: 129 HVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKH 188
           HVFP             HTE +VD+ ++A    + V+CE+ N DG+MAK  ++ +F   H
Sbjct: 137 HVFPXXXXXXXXXXXXXHTEGTVDLMQMAGLQPAGVLCELTNPDGSMAKTPEIIEFGKLH 196

Query: 189 NLKIGKIEDLIAYR 202
           N+ +  IED++ YR
Sbjct: 197 NMPVLTIEDMVQYR 210


>RIBB_OCEIH RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 207

 Score =  147 bits (370), Expect = 2e-37
 Identities = 81/199 (40%), Positives = 114/199 (57%), Gaps = 1/199 (0%)

Query: 4   NNYASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLAL 63
           N  + IE  I   + G + I+ DD  RE EGDL+  +   + + +NFM KYGRGLIC+ +
Sbjct: 2   NELSKIEQAIEDLRNGKLIIVADDADREAEGDLVGLSEFVTPEKVNFMTKYGRGLICVPI 61

Query: 64  DSVQAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXD 123
              +A  L+L  M+  N     T FT+S++     +TGIS  DR               D
Sbjct: 62  TEERALELDLHAMATNNTDTYGTQFTVSVDYYTN-STGISTADRADTIRALAEPLSKAAD 120

Query: 124 IVSPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFD 183
              PGH+FP+IAK+ GVL R GHTEA+VD+++L+    SA ICEI+N+DGTMA+   L  
Sbjct: 121 FKRPGHMFPLIAKNAGVLERRGHTEAAVDLARLSNSIPSAYICEILNDDGTMARYPALET 180

Query: 184 FANKHNLKIGKIEDLIAYR 202
            A   +L +  +EDL+ YR
Sbjct: 181 LAKDWDLTLITVEDLVQYR 199


>RIBBA_CORGL RecName: Full=Riboflavin biosynthesis protein
           ribBA;Includes:  RecName: Full=3,4-dihydroxy-2-butanone
           4-phosphate synthase;
          Length = 422

 Score =  146 bits (369), Expect = 2e-37
 Identities = 101/345 (29%), Positives = 176/345 (51%), Gaps = 19/345 (5%)

Query: 36  LIISTTDSSAKNINFMAKYGRGLICLALDSVQAKRLNLSLMSPINQSRNKTAFTISIEAK 95
           +I +   ++ + + FM +Y  G IC  L +  A RL+L  M+  NQ    TA+T++++A 
Sbjct: 41  IIFAAELATPELVAFMVRYSSGYICAPLTAKDADRLDLPPMTAHNQDARGTAYTVTVDAN 100

Query: 96  KGITTGISAKDRXXXXXXXXXXXXXXXDIVSPGHVFPIIAKDGGVLVRAGHTEASVDISK 155
            G TTGISA DR               D   PGHV P+ A++GGVLVRAGHTEA+VD+++
Sbjct: 101 TG-TTGISATDRAHTLRLLADPEADRTDFTRPGHVVPLRAREGGVLVRAGHTEAAVDLAR 159

Query: 156 LAKKNNSAVICEIMNEDGT--MAKGQDLFDFANKHNLKIGKIEDLIAYRXXXXXXXXXXX 213
            A    + VICE+++E+    MA+  +L  F ++H+LK+  IE LI +R           
Sbjct: 160 AAGLRPAGVICEVVSEEDPTGMARVPELRRFCDEHDLKLISIEQLIEWRRKNEILVERQV 219

Query: 214 QSDIKVKNQKYKIRIYENLLDGSEHFALIKGNIKK--GIIPRVRVISSNVVQNYLINQQL 271
           ++ +      +K   Y +++DG+E  A++ G++    G    VRV S  +  +   +++ 
Sbjct: 220 ETVLPTDFGTFKAVGYRSIIDGTELVAIVAGDVASDGGENVLVRVHSECLTGDVFGSRRC 279

Query: 272 P--NSFDKTLNYFKKFNNCVLVFIKDTNLKSVTQTLKDYKNKNFYKKGNDKL-------- 321
                  ++L   ++    V+V+++    + +   L   +      +G D +        
Sbjct: 280 DCGQQLHESLRLIQEAGRGVVVYMRGHEGRGI-GLLAKLRAYQLQDEGADTVDANLALGL 338

Query: 322 ---IRNYGIGAQIIKDLKIKNMILITKSLKKVIGLEGYDIKITKQ 363
               R +G  AQI+ DL ++++ LI+ +  K +GLEG+ I I  +
Sbjct: 339 PADAREFGTSAQILYDLGVRSLNLISNNPAKKVGLEGHGISIASR 383


>RIBBA_CORGB RecName: Full=Riboflavin biosynthesis protein
           ribBA;Includes:  RecName: Full=3,4-dihydroxy-2-butanone
           4-phosphate synthase;
          Length = 422

 Score =  146 bits (369), Expect = 2e-37
 Identities = 101/345 (29%), Positives = 176/345 (51%), Gaps = 19/345 (5%)

Query: 36  LIISTTDSSAKNINFMAKYGRGLICLALDSVQAKRLNLSLMSPINQSRNKTAFTISIEAK 95
           +I +   ++ + + FM +Y  G IC  L +  A RL+L  M+  NQ    TA+T++++A 
Sbjct: 41  IIFAAELATPELVAFMVRYSSGYICAPLTAKDADRLDLPPMTAHNQDARGTAYTVTVDAN 100

Query: 96  KGITTGISAKDRXXXXXXXXXXXXXXXDIVSPGHVFPIIAKDGGVLVRAGHTEASVDISK 155
            G TTGISA DR               D   PGHV P+ A++GGVLVRAGHTEA+VD+++
Sbjct: 101 TG-TTGISATDRAHTLRLLADPEADRTDFTRPGHVVPLRAREGGVLVRAGHTEAAVDLAR 159

Query: 156 LAKKNNSAVICEIMNEDGT--MAKGQDLFDFANKHNLKIGKIEDLIAYRXXXXXXXXXXX 213
            A    + VICE+++E+    MA+  +L  F ++H+LK+  IE LI +R           
Sbjct: 160 AAGLRPAGVICEVVSEEDPTGMARVPELRRFCDEHDLKLISIEQLIEWRRKNEILVERQV 219

Query: 214 QSDIKVKNQKYKIRIYENLLDGSEHFALIKGNIKK--GIIPRVRVISSNVVQNYLINQQL 271
           ++ +      +K   Y +++DG+E  A++ G++    G    VRV S  +  +   +++ 
Sbjct: 220 ETVLPTDFGTFKAVGYRSIIDGTELVAIVAGDVASDGGENVLVRVHSECLTGDVFGSRRC 279

Query: 272 P--NSFDKTLNYFKKFNNCVLVFIKDTNLKSVTQTLKDYKNKNFYKKGNDKL-------- 321
                  ++L   ++    V+V+++    + +   L   +      +G D +        
Sbjct: 280 DCGQQLHESLRLIQEAGRGVVVYMRGHEGRGI-GLLAKLRAYQLQDEGADTVDANLALGL 338

Query: 322 ---IRNYGIGAQIIKDLKIKNMILITKSLKKVIGLEGYDIKITKQ 363
               R +G  AQI+ DL ++++ LI+ +  K +GLEG+ I I  +
Sbjct: 339 PADAREFGTSAQILYDLGVRSLNLISNNPAKKVGLEGHGISIASR 383


>RIBB_AERHH RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 217

 Score =  144 bits (363), Expect = 1e-36
 Identities = 86/177 (48%), Positives = 117/177 (66%)

Query: 26  DDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQAKRLNLSLMSPINQSRNK 85
           DDE RENEGDLI +    + + +  M +   G++CL L   + ++L L +M   N S  +
Sbjct: 33  DDEDRENEGDLIFAAESMTNEQMAMMIRECSGIVCLCLTDERVRQLELPMMVEANSSHYQ 92

Query: 86  TAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPGHVFPIIAKDGGVLVRAG 145
           TAFT++IEA +G+TTG+S                   D+  PGHVFP+ A+ GGVL R G
Sbjct: 93  TAFTVTIEAAQGVTTGVSXXXXXXXXXXXXXXXXXPSDLHRPGHVFPLRARTGGVLTRRG 152

Query: 146 HTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKHNLKIGKIEDLIAYR 202
           HTEA+VD+ +LA      V+CE+  EDG+MA+  DL  F  +H + +  IEDL+ YR
Sbjct: 153 HTEATVDLMQLAGLKPFGVLCELTKEDGSMARLPDLVAFGRQHQMPVLTIEDLVQYR 209


>RIBB_CHLT3 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 228

 Score =  143 bits (361), Expect = 2e-36
 Identities = 75/199 (37%), Positives = 112/199 (56%)

Query: 4   NNYASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLAL 63
           + +  +E+ +   + G   ++ D   RENE DLI S    +   +  + +   G++CL L
Sbjct: 11  DEFTRVENALTALRSGKGILVSDSPDRENEADLIFSAEFLTETQMAMLIRECSGIVCLCL 70

Query: 64  DSVQAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXD 123
            + + + L L +M   N S  +TAFT+SIEAK G+ TG+SA DR               +
Sbjct: 71  TTEKVQALALPMMVSENTSGFQTAFTVSIEAKTGVKTGVSAADRVRTVKTAIAADAKPEE 130

Query: 124 IVSPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFD 183
           +  PGHVFP+ A+ GGVL R GHTEA+VD+ +LA  +   V+CE+ N DGTMA   +   
Sbjct: 131 LARPGHVFPLRARTGGVLERPGHTEATVDLMRLAGLSPYGVLCELTNPDGTMANLDEAIA 190

Query: 184 FANKHNLKIGKIEDLIAYR 202
           FA KH+  +  +ED+I YR
Sbjct: 191 FAEKHDFPVLTVEDVINYR 209


>RIBB_BUCBP RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 211

 Score =  142 bits (358), Expect = 5e-36
 Identities = 73/193 (37%), Positives = 112/193 (58%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           +++ I+  + G   I++D+E RENEGDLI S    + + +    +YG G++CL +   + 
Sbjct: 16  VKNAISALRYGHGIIVLDNEDRENEGDLIFSGETMTTEQMALTIRYGSGIVCLCITESKR 75

Query: 69  KRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPG 128
           K+L L +M   N S+  T FT++IEA +GI+TG+SAKDR               D+  PG
Sbjct: 76  KQLKLPMMVQNNTSKFGTNFTVTIEAAEGISTGVSAKDRLTTIRAAINDNAKPSDLNRPG 135

Query: 129 HVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKH 188
           H+FP+ A   G+L R GHTEA+++   LA    + +ICE+ N +GTM+K  D+  F+   
Sbjct: 136 HIFPLQAHKNGILGRIGHTEAAIEFVTLAGFKPAGIICELTNRNGTMSKVPDIIKFSKLK 195

Query: 189 NLKIGKIEDLIAY 201
            + I  I DLI Y
Sbjct: 196 KMTIVTIRDLIQY 208


>RIBB_AERS4 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 217

 Score =  142 bits (357), Expect = 6e-36
 Identities = 83/177 (46%), Positives = 113/177 (63%)

Query: 26  DDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQAKRLNLSLMSPINQSRNK 85
           DDE RENEGDLI +    + + +  M +   G++CL L   + ++L L +M   N S  +
Sbjct: 33  DDEDRENEGDLIFAAQTMTNEQMAMMIRECSGIVCLCLTDERVRQLALPMMVEANSSHYQ 92

Query: 86  TAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPGHVFPIIAKDGGVLVRAG 145
           TAFT++IEA +G+TTG+S                   D+  PGHVFP+ A+ GGVL R G
Sbjct: 93  TAFTVTIEAAQGVTTGVSXXXXXXXXXXXXXXGAKPSDLHRPGHVFPLRARTGGVLTRRG 152

Query: 146 HTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKHNLKIGKIEDLIAYR 202
           HTEA+VD+ +LA      V+CE+  EDG+MA+  DL  F   H + +  IEDL+ YR
Sbjct: 153 HTEATVDLMQLAGLKPFGVLCELTKEDGSMARLPDLVAFGRLHQMPVLTIEDLVQYR 209


>RIBB_CHLL2 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 222

 Score =  141 bits (355), Expect = 1e-35
 Identities = 73/199 (36%), Positives = 112/199 (56%)

Query: 4   NNYASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLAL 63
           N    +E  +   + G   ++ DD  RENE DLI      +   +  + +   G++CL +
Sbjct: 11  NQLNLVEKALAALRNGQGVLVADDPGRENEADLIFPAESVTIPQMALLIRECSGIVCLCM 70

Query: 64  DSVQAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXD 123
              + + L L +M   N S  +TAFT+SIEA +G+TTG+SA DR               D
Sbjct: 71  TDGKIRSLELPMMVENNTSGFQTAFTVSIEAAEGVTTGVSAADRVKTVRTAVSENARPSD 130

Query: 124 IVSPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFD 183
           +  PGH+FP+ A+ GGVL R GHTEA+VD+ +LA  + + V+CE+ N DG+MA  ++ F 
Sbjct: 131 LRHPGHIFPLRARPGGVLERPGHTEATVDLMRLAGLSPAGVLCELTNPDGSMAGIEETFA 190

Query: 184 FANKHNLKIGKIEDLIAYR 202
           F+ +H   +  I D++AYR
Sbjct: 191 FSVQHGFPVLSIGDIVAYR 209


>RIBB_PSEPK RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 216

 Score =  139 bits (351), Expect = 3e-35
 Identities = 69/146 (47%), Positives = 97/146 (66%)

Query: 57  GLICLALDSVQAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXX 116
           G++CL LD      L L+ M   NQ+R+ T FT++IEA +GITTG+SA+DR         
Sbjct: 60  GIVCLCLDEATVDELQLAPMVQNNQARHGTGFTVTIEAAEGITTGVSAQDRITTIDAALR 119

Query: 117 XXXXXXDIVSPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMA 176
                  IVSPGHVFP+ A++GGVL R GHTE SVD+++LA    +AV+CE+MN DG+MA
Sbjct: 120 SSAEQRHIVSPGHVFPLRARNGGVLTRRGHTEGSVDLARLAGLRPAAVLCELMNPDGSMA 179

Query: 177 KGQDLFDFANKHNLKIGKIEDLIAYR 202
           +G+ +  +A ++NL +  IE+L  YR
Sbjct: 180 RGEQVAVYARQYNLPVLTIEELARYR 205


>RIB3_SCHPO RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 204

 Score =  133 bits (335), Expect = 2e-33
 Identities = 73/197 (37%), Positives = 110/197 (55%), Gaps = 2/197 (1%)

Query: 7   ASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSV 66
           ASIE  +N  + G   I++DDE RENEGDLII+    + + + F+ ++  G +C+ +   
Sbjct: 3   ASIEEAVNDFRDGKFLIVLDDETRENEGDLIIAGCKVTTEQMAFLVRHSSGYVCVPMTGE 62

Query: 67  QAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDR-XXXXXXXXXXXXXXXDIV 125
           +   L + +M   N+ R +TA+ ++++   G TTGISA DR                +  
Sbjct: 63  RLDSLEIPMMVDNNEDRMRTAYAVTLDYANGTTTGISAHDRALTTRQLANPEVTSPREFN 122

Query: 126 SPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIM-NEDGTMAKGQDLFDF 184
            PGH+ P+ A+DGGVL R GHTEA+VD+ KLA       ICE++  EDG M++  D   F
Sbjct: 123 RPGHIVPLRARDGGVLERDGHTEAAVDLCKLAGLPPVGAICELVREEDGLMSRFDDCISF 182

Query: 185 ANKHNLKIGKIEDLIAY 201
             K  +K+  IE L +Y
Sbjct: 183 GKKWGIKVITIESLKSY 199


>RIBB_CHRVO RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 210

 Score =  131 bits (330), Expect = 8e-33
 Identities = 76/182 (41%), Positives = 113/182 (62%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           + + ++  ++G   I+ DD  RENE DLI++    +   +  M + G G++CL L   +A
Sbjct: 12  VHAALDALRRGLPVIVADDADRENEADLILAADTLTVPEMARMIRDGSGIVCLCLTPERA 71

Query: 69  KRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPG 128
           +RL L  M+  N SR  TAFT++IEA +G+TTG+S                   D+V PG
Sbjct: 72  ERLQLPPMAAENGSRYGTAFTVAIEAAQGVTTGVSXXXXXXXXXXXXHPDAKPGDLVRPG 131

Query: 129 HVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKH 188
           HV+PI            HTEASV++++LA  + + V+CE+MN DGTM +GQ + D+A +H
Sbjct: 132 HVYPIXXXXXXXXXXXXHTEASVELARLAGFSPAGVLCELMNPDGTMMRGQQVQDYAERH 191

Query: 189 NL 190
           +L
Sbjct: 192 DL 193


>RIBB_DESDA RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 223

 Score =  130 bits (327), Expect = 2e-32
 Identities = 70/194 (36%), Positives = 106/194 (54%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           ++  +   + GG  ++VDDE RENEGDLI      +   +  + ++  G++CL L     
Sbjct: 18  VQKALASLRAGGGVLVVDDEDRENEGDLIFPAQTITVPQMAMLIRHCSGIVCLCLTDEYT 77

Query: 69  KRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPG 128
           +RL+L +M+  N +  +TAFTISIE            DR               ++  PG
Sbjct: 78  RRLDLPMMTERNTNTQQTAFTISIEXXXXXXXXXXXXDRVATIQAAVAENASPENLRRPG 137

Query: 129 HVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKH 188
           HVFP+ AK GGVL R GHTEA+VD+ +LA      V+CE+  +DG+MA+   +  FA  H
Sbjct: 138 HVFPLRAKPGGVLERRGHTEATVDLMRLAGHAPCGVLCELTLDDGSMARLPQVAAFAVAH 197

Query: 189 NLKIGKIEDLIAYR 202
            + +  +EDL+A+R
Sbjct: 198 AIPLCSVEDLVAWR 211


>RIB3_YEAST RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 208

 Score =  128 bits (321), Expect = 9e-32
 Identities = 73/204 (35%), Positives = 111/204 (54%), Gaps = 8/204 (3%)

Query: 6   YASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDS 65
           +  I+  I   K+    I++DD  RENEGDLI +  + S + + F+ ++  G +C  + +
Sbjct: 2   FTPIDQAIEHFKQNKFVIVMDDAGRENEGDLICAAENVSTEQMAFLVRHSSGYVCAPMTN 61

Query: 66  VQAKRLNLSLM------SPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXX 119
             A +L+L L+         +  R+ TA+TI+++  +G TTGISA DR            
Sbjct: 62  AIADKLDLPLLRTGMKFESNDDDRHGTAYTITVDVAQGTTTGISAHDRSMTCRALADSSS 121

Query: 120 XXXDIVSPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNED--GTMAK 177
                + PGH+ P+ A DGGVL R GHTEA VD+ KL+  +  AVI E++N+D  GTM +
Sbjct: 122 TPKSFLKPGHICPLRAADGGVLQRRGHTEAGVDLCKLSGLSPVAVIGELVNDDEQGTMMR 181

Query: 178 GQDLFDFANKHNLKIGKIEDLIAY 201
             D   F  KH + +  IE+L  Y
Sbjct: 182 LNDCQAFGKKHGIPLISIEELAQY 205


>RIB3_CANAL RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 204

 Score =  121 bits (304), Expect = 8e-30
 Identities = 69/199 (34%), Positives = 101/199 (50%), Gaps = 1/199 (0%)

Query: 4   NNYASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLAL 63
           N +  IE  +   K G   I++DDE RENEGDLI++    + + + F+ +Y  G +C+ L
Sbjct: 3   NIFTPIEEALEAYKNGEFLIVMDDEDRENEGDLIMAAELITQEKMAFLVRYSSGYVCVPL 62

Query: 64  DSVQAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXD 123
              +A +L L  M      R+ TA+TI+ +  +G TTGISA DR               D
Sbjct: 63  SEERANQLELPPMLANRSDRHGTAYTITCDFAEGTTTGISAHDRALTTRSLANPNSKPQD 122

Query: 124 IVSPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIM-NEDGTMAKGQDLF 182
            + PGH+ P+ A  G +  R GHTEA+V +S LA    + VICE++ +EDG M +  D  
Sbjct: 123 FIKPGHILPLRAVPGLLKKRRGHTEAAVQLSTLAGLQPAGVICELVRDEDGLMMRLDDCI 182

Query: 183 DFANKHNLKIGKIEDLIAY 201
            F             L+ Y
Sbjct: 183 QFXXXXXXXXXXXXQLVEY 201


>RIB3_MAGGR RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 233

 Score =  112 bits (281), Expect = 4e-27
 Identities = 72/212 (33%), Positives = 104/212 (49%), Gaps = 14/212 (6%)

Query: 3   KNNYASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLA 62
           K+N+ +I  +I   K G   +++DD  RENE DLII+    + + + FM ++  GLIC  
Sbjct: 9   KSNFDAIPDVIQAFKNGEFVVVLDDPSRENEADLIIAAESVTTEQMAFMVRHSSGLICAP 68

Query: 63  LDSVQAKRLNLSLMSPINQSRNKTAFTISIEAK-KGITTGISAKDRXXXXXXXXXXXXXX 121
           L   +   L+L  M   N     TA+T+S++A+    TTGISA DR              
Sbjct: 69  LTPERTTALDLPQMVTHNADPRGTAYTVSVDAEHPSTTTGISAHDRALACRMLAAPDAQP 128

Query: 122 XDIVSPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGT------- 174
                PGHVFP+            HTEA V++ +LA K   AVI EI+ +DG        
Sbjct: 129 SHFRRPGHVFPLXXXXXXXXXXXXHTEAGVELCRLAGKRPVAVISEIV-DDGQEVEGRAV 187

Query: 175 -----MAKGQDLFDFANKHNLKIGKIEDLIAY 201
                M +G +   FA +  LK+  IED+IA+
Sbjct: 188 RAAPGMLRGDECVAFARRWGLKVCTIEDMIAH 219


>RIBBA_THEMA RecName: Full=Riboflavin biosynthesis protein
           ribBA;Includes:  RecName: Full=3,4-dihydroxy-2-butanone
           4-phosphate synthase;
          Length = 388

 Score = 97.4 bits (241), Expect = 2e-22
 Identities = 90/360 (25%), Positives = 157/360 (43%), Gaps = 35/360 (9%)

Query: 20  GMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQAKRLNLSLMSPI 79
           G  +++ D  RENE D +      +   ++F   YG+GL C+  D     +     +S  
Sbjct: 11  GKPVILIDRNRENEADFVFPAQLITEDVVSFFVTYGKGLFCVTADEEDLLKRGFVKLSS- 69

Query: 80  NQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPGHVFPIIAKDGG 139
           N   N       +    G  TGISA +R               +   PGHV  I    GG
Sbjct: 70  NYGAN-----YFVPVDWGTGTGISALERAETCRKLAEGRYFH-EFRYPGHVTVI----GG 119

Query: 140 VLV--RAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKHNLKIGKIED 197
           +    R GHTEAS++IS+LA  +  AVI EI++E G       +   + K +L + +++D
Sbjct: 120 IGFQRRKGHTEASLEISELAGFSRHAVIVEILDEKGNSHNLDYVLKLSEKFSLPVLEMDD 179

Query: 198 LIAYRXXXXXXXXXXXQSDIKVKNQKYKIRIYENLLDGSEHFALIKGNIKKGIIPRV--R 255
           +               ++ +      +K+  +EN LDG EHFA++K  ++  +  R+   
Sbjct: 180 VWREFVKRKLLMKKKAEATLPTDFGVFKVVSFENHLDGKEHFAIVKEPLEDPVAVRIHSE 239

Query: 256 VISSNVVQNYLIN--QQLPNSFDKTLNYFKKFNNCVLVFIKDTNLKSVTQTLKDYKNKNF 313
            ++ +V+ +   +   QL N     L Y       ++   ++     ++  +  Y   + 
Sbjct: 240 CVTGDVLSSLRCDCGSQLAN----FLRYMSAHGGILIYLRQEGRGIGLSNKIAAY---SL 292

Query: 314 YKKGNDKL-----------IRNYGIGAQIIKDLKIKNMILITKSLKKVIGLEGYDIKITK 362
             KG D +            R+Y   AQI+K L I+ ++L T + +K +GLE Y I++ +
Sbjct: 293 QDKGLDTVEANRVLGFSEDERDYAPAAQILKALGIERVLLFTNNQRKTVGLEKYGIEVVE 352


>RIBB_METJA RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 227

 Score = 84.0 bits (206), Expect = 2e-18
 Identities = 62/218 (28%), Positives = 100/218 (45%), Gaps = 25/218 (11%)

Query: 8   SIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQ 67
           ++E  I   KKG + ++ D ++RE E D+++++   + ++I  M K   GLIC AL    
Sbjct: 3   NVEKAIEALKKGEIILVYDSDEREGETDMVVASQFITPEHIRIMRKDAGGLICTALHPDI 62

Query: 68  AKRLNLSLMSPINQSRN------------------KTAFTISIEAKKGITTGISAKDRXX 109
             +L +  M  I +  +                  K++F+I+I  +K  T GI+  DR  
Sbjct: 63  CNKLGIPFMVDILEFASQKFKVLRELYPNDIPYDEKSSFSITINHRKTFT-GITDNDRAF 121

Query: 110 XXXXXXXXXXXXX------DIVSPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSA 163
                              +  SPGHV  + A +G V  R GHTE +V +++LA      
Sbjct: 122 TIKKLAELVKEGRFNDFGKEFRSPGHVTLLRAAEGLVKNRQGHTEMTVALAELANLVPIT 181

Query: 164 VICEIMNEDGTMAKGQDLFDFANKHNLKIGKIEDLIAY 201
            ICE+M +DG      +   +A KHNL     E++I Y
Sbjct: 182 TICEMMGDDGNAMSKNETKRYAEKHNLIYLSGEEIINY 219


>RIBA_ARCFU RecName: Full=GTP cyclohydrolase-2;       
           EC=3.5.4.25;AltName: Full=GTP cyclohydrolase II;
          Length = 378

 Score = 81.6 bits (200), Expect = 1e-17
 Identities = 96/373 (25%), Positives = 166/373 (44%), Gaps = 38/373 (10%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           +E + +  K G   +++D EK      + I     S + +NFM K     I LAL   Q 
Sbjct: 1   MEEVSSHVKSGKPVMILDSEKSA----ICIPAEVVSGEILNFMMK-NCDEIRLALTWKQI 55

Query: 69  KRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRXXXXXXXXXXXXXXXDIVSPG 128
             LNL L    N+ R +    I I+        ISA++R               DI  PG
Sbjct: 56  --LNLGL----NRFRFQNGNLIPIDPN---LEKISAEERAKFIRELVSGNAG--DIKYPG 104

Query: 129 HVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKH 188
            +F    K+ GVL R G  EA VD++++A    SAV   +M  +G +A       FA +H
Sbjct: 105 RIFVEETKEMGVLERPGIAEACVDLARMAGFAPSAVYAPLMTAEGGVAGEDYALKFAKEH 164

Query: 189 NLKIGKIEDLIAYRXXXXXXXXXXXQSDIKVK-NQKYKIRIYENLLDGSEHFALIKGNIK 247
           ++ + +I+D+I +R           ++ +  K    ++   Y+  L   E  AL+KG + 
Sbjct: 165 SMPVFRIKDMIEFRIKSEKIVERVIEATLPTKFYGTFRAVGYKTPL--GEIVALVKGRVD 222

Query: 248 KGIIPRVRVISSNVVQN--YLINQQLPNSFDKTLNYFKKFNNCVLVFIKDTNLKSV--TQ 303
           +G +  VR+ S  +  +  + +     +  +  L    +    V ++++    + +    
Sbjct: 223 EGDV-LVRIHSECLTGDVFHSLRCDCGDQLENALKMIDREGKGVAIYMRGHEGRGIGLIN 281

Query: 304 TLKDYKNKNFYKKGNDKL-----------IRNYGIGAQIIKDLKIKNMILITKSLKKVIG 352
            L  YK     ++G D +           +R+YGI AQI+ DLK+K++ L+T +  K+  
Sbjct: 282 KLMAYK---LQEEGKDTVDANIELGFPPDMRSYGIAAQILMDLKVKSIRLLTNNPLKIEE 338

Query: 353 LEGYDIKITKQEI 365
           L+ Y  KI ++ I
Sbjct: 339 LKKYGFKIVREPI 351


>RIBB_METTH RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 229

 Score = 75.5 bits (184), Expect = 7e-16
 Identities = 54/207 (26%), Positives = 94/207 (45%), Gaps = 26/207 (12%)

Query: 9   IESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQA 68
           I+  +   ++G + ++ D + RE E D+I++      ++I  M     GLIC+ +    +
Sbjct: 7   IQEALKALRRGEIVLVFDADNRERETDMIVAAEKIKPEHIRIMRNDAGGLICVPVSWENS 66

Query: 69  KRLNLSLMSPINQSRN------------------KTAFTISIEAKKGITTGISAKDRXXX 110
           ++L +  M+ I +  +                  K+AF+I++  +K  T GI+  DR   
Sbjct: 67  EKLGIPYMTDIMEEASGRYPVLGKLSPHDIPYDEKSAFSITVNHRKTFT-GITDNDRALT 125

Query: 111 XXXXXXXXXXXXD------IVSPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAV 164
                                SPGHV  + A DG VL R GHTE S+ + ++A     AV
Sbjct: 126 IGELAGICRDDRHESFGDLFRSPGHVTLLRAADGHVLRRGGHTEMSIALMEMAGLTGVAV 185

Query: 165 ICEIMNE-DGTMAKGQDLFDFANKHNL 190
            CE+M++  G     +D   +A +H+L
Sbjct: 186 CCEMMDDRTGNSLSTEDAMKYAREHDL 212


>RIBB_METAC RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 247

 Score = 66.6 bits (161), Expect = 3e-13
 Identities = 51/212 (24%), Positives = 93/212 (43%), Gaps = 29/212 (13%)

Query: 8   SIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQ 67
           +I   + + + G M  + D + RE E DL+I     + K++ +M K   GLIC+A+D V 
Sbjct: 16  NINRALEVLRAGKMIQIYDSDSREGETDLVIPAKAVTYKDVKWMRKDAGGLICVAVDPVA 75

Query: 68  AKRLNLSLMSPINQSRNKTAFTISIEAKK-------------------GITTGISAKDR- 107
           +K+L L  M+ + +  ++T+ ++    +K                      TGI   +R 
Sbjct: 76  SKQLKLPFMADLVREASRTSESLGEVVEKDGDLKYDSHSSFSIWVNHRDTRTGIPDLERA 135

Query: 108 --------XXXXXXXXXXXXXXXDIVSPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKK 159
                                  +  +PGHV  + A +G +  R G TE SV ++++A  
Sbjct: 136 LTIRKIGEITEKSLSGNGIRFGNEFRTPGHVALLRAAEGLLDERMGQTELSVALARMAGI 195

Query: 160 NNSAVICEIM-NEDGTMAKGQDLFDFANKHNL 190
             + V+CE++ +E G     ++  D+   H L
Sbjct: 196 TPAMVVCEMLDDESGRALSKENSKDYGKDHGL 227


>RIBB_METMA RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 247

 Score = 63.9 bits (154), Expect = 2e-12
 Identities = 51/217 (23%), Positives = 95/217 (43%), Gaps = 29/217 (13%)

Query: 3   KNNYASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLA 62
           K +  +I   +   + G M  + D + RE E DL+I     +  ++ +M K   GLIC+A
Sbjct: 11  KYSNENINRALEALRAGKMIQIYDSDSREGETDLVIPAKAVTYTDVKWMRKDAGGLICVA 70

Query: 63  LDSVQAKRLNLSLMSPINQSRNKTAFTISIEAKK-------------------GITTGIS 103
           +D V +K+L L  M+ + +  +KT+ ++    +K                      TGI 
Sbjct: 71  VDPVASKQLKLPFMADLVREASKTSDSLGEVVEKDGDLKYDAHSSFSLWVNHRDTRTGIP 130

Query: 104 AKDR---------XXXXXXXXXXXXXXXDIVSPGHVFPIIAKDGGVLVRAGHTEASVDIS 154
             +R                        +  +PGHV  + A +G +  R G TE SV ++
Sbjct: 131 DIERALTIRKIGEITEESLSGNGVRFGNEFRTPGHVALLRAAEGLLDERMGQTELSVALA 190

Query: 155 KLAKKNNSAVICEIMNEDGTMAKGQDLF-DFANKHNL 190
           ++A    + V+CE++++D   A  ++   ++  +H L
Sbjct: 191 RMAGITPAMVVCEMLDDDSGKALSKEKSKEYGKEHGL 227


>RIBB_ARCFU RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
           synthase;         Short=DHBP synthase;       
           EC=4.1.99.12;
          Length = 238

 Score = 51.2 bits (121), Expect = 1e-08
 Identities = 49/209 (23%), Positives = 83/209 (39%), Gaps = 28/209 (13%)

Query: 10  ESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQAK 69
           E  +   +KG   ++ D E RE E D+ I         +  M   G GLIC+A+  V A+
Sbjct: 6   EESLRAFRKGSPVLIYDFEDREGETDIAIPAIHVGKDEVAMMRIDGGGLICVAIHPVAAE 65

Query: 70  RLNLSLMSPINQSRNK---------TAFTISIEAKKGIT---------TGISAKDR---- 107
           +L L  M  + +  ++          A  I  +++   +         TGI+  DR    
Sbjct: 66  KLGLPFMHDVLRIASEKLPEIRKVADADDIKYDSRSSFSLWVNHRDTFTGITDVDRALTI 125

Query: 108 -----XXXXXXXXXXXXXXXDIVSPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNS 162
                               +  SPGHV  + A D     R G TE SV ++++A    +
Sbjct: 126 RRIGEVVDEVMMGKKVDFGREFRSPGHVALLRAADKLTYERVGQTELSVALAEMAGIAPA 185

Query: 163 AVICEIMN-EDGTMAKGQDLFDFANKHNL 190
             ICE+++ E G     +   ++A +  +
Sbjct: 186 VAICEMLDAETGKALTKEKAMEYAEEKGI 214


>RSE1_CANAL RecName: Full=Pre-mRNA-splicing factor RSE1;
          Length = 1219

 Score = 42.7 bits (99), Expect = 5e-06
 Identities = 43/140 (30%), Positives = 67/140 (47%), Gaps = 9/140 (6%)

Query: 215 SDIKVKNQKYKIRIYENLLDGSEHFALIKG-NIKKGIIPRVRVISSNVVQNYLINQQ-LP 272
           S I+V + K    I    LDG+E    +   +  K   P V   +S++V     NQ  LP
Sbjct: 864 SCIQVVDSKSNQVIQSLQLDGNESIVSMSAVSFNKTSTPSVP--ASHLVVGVCTNQTILP 921

Query: 273 NSFDKTLNYFKKFNNCVLVFIKDTNLKSVTQTLKDYKNKNFYKKGNDKLIRNYGIG-AQI 331
           NS+DK+  Y  K     L  +  T L  + Q L+++++K     GN   IR Y IG  Q+
Sbjct: 922 NSYDKSYLYTFKIGKKHLQLVHKTELDHIPQVLENFQDKLLVASGNH--IRLYDIGQKQL 979

Query: 332 IKDLKIKNMILITKSLKKVI 351
           +K  K   +I  + ++ K+I
Sbjct: 980 LK--KSTTIIDFSTNINKII 997


>RIBA_PHOPO RecName: Full=GTP cyclohydrolase-2;       
           EC=3.5.4.25;AltName: Full=GTP cyclohydrolase II;AltName:
           Full=RIBIV;
          Length = 200

 Score = 38.1 bits (87), Expect = 1e-04
 Identities = 36/155 (23%), Positives = 66/155 (42%), Gaps = 15/155 (9%)

Query: 221 NQKYKIRIYENLLDGSEHFALIKGNIKKGIIPRVRVISSNVVQNYLINQQLP--NSFDKT 278
           N   ++  +  L  G EH ALI  +  K  +P VR+ S  +  +   + +       D+T
Sbjct: 17  NAPAELLSFNGLESGKEHIALIFKDAYKAFVPLVRMHSECLTGDGFHSTRCDCGEQLDET 76

Query: 279 LNYFKKFNNCVL-----------VFIKDTNLKSVTQTLKDYKNKNFYKKGNDKLIRNYGI 327
           +    +    +L           ++ K    K  +Q +  Y+  N    G D  +R +  
Sbjct: 77  IEIMAELGGIILYLRQEGRWGLGLYNKIDAYKLQSQGMDTYEANNHL--GFDDDLREFSE 134

Query: 328 GAQIIKDLKIKNMILITKSLKKVIGLEGYDIKITK 362
            AQ++  L IK++ L+T + KK+  L+   I I +
Sbjct: 135 AAQMLTALGIKDIRLVTNNPKKIKDLQQNGINIVE 169


>RIBA_HELAH RecName: Full=GTP cyclohydrolase-2;       
           EC=3.5.4.25;AltName: Full=GTP cyclohydrolase II;
          Length = 192

 Score = 36.2 bits (82), Expect = 5e-04
 Identities = 17/44 (38%), Positives = 30/44 (68%), Gaps = 1/44 (2%)

Query: 323 RNYGIGAQIIKDLKIKNMILITKSLKKVIGLEGYDIKITKQEII 366
           R+YGI  +I++  +IK M L+T + KK+  LE Y  ++T++ +I
Sbjct: 128 RDYGIAGEILEYYRIKKMRLLTNNPKKIAALEKY-AEVTRESLI 170


>ISPH_CLOPE RecName: Full=4-hydroxy-3-methylbut-2-enyl diphosphate
           reductase;         EC=1.17.1.2;
          Length = 282

 Score = 35.8 bits (81), Expect = 6e-04
 Identities = 22/79 (27%), Positives = 42/79 (53%), Gaps = 17/79 (21%)

Query: 276 DKTLNYFKKF------------NNCVLVFIKDTNLKSVTQTLKDYKNKNFYKKGNDKLIR 323
           D+ + Y K+F            NN V+ +++D N+ ++     +  + +  KKG+  LIR
Sbjct: 22  DEAIKYQKEFGKKIYTLGPLIHNNDVVNYLEDNNIFAI-----ELSDADSLKKGDVVLIR 76

Query: 324 NYGIGAQIIKDLKIKNMIL 342
           ++G+   +IKDL  K +I+
Sbjct: 77  SHGVKESVIKDLTDKGLIV 95


  Database: sws57.9x
    Posted date:  Nov 5, 2009 10:46 AM
  Number of letters in database: 179,409,320
  Number of sequences in database:  510,076
  
Lambda     K      H
   0.325    0.142    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 510076
Number of Hits to DB: 8,272,085,158
Number of extensions: 328600918
Number of successful extensions: 874981
Number of sequences better than 1.0e-03: 25799
Number of HSP's gapped: 847504
Number of HSP's successfully gapped: 28169
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)