BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= AAZ21934.1 pubi0 AAZ21934.1 GIB00256CH01 "SpoU rRNA Methylase
family"
         (247 letters)

Database: sws57.9x 
           510,076 sequences; 179,409,320 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TRMHL_STAAE RecName: Full=Putative trmH family tRNA/rRNA methylt...   115   5e-28
TRMHL_STAAC RecName: Full=Putative trmH family tRNA/rRNA methylt...   115   5e-28
YACO_BACSU RecName: Full=Putative trmH family tRNA/rRNA methyltr...   114   7e-28
TRMHL_STAAW RecName: Full=Putative trmH family tRNA/rRNA methylt...   112   3e-27
TRMHL_STAAS RecName: Full=Putative trmH family tRNA/rRNA methylt...   112   3e-27
TRMHL_STAAR RecName: Full=Putative trmH family tRNA/rRNA methylt...   112   3e-27
TRMHL_STAAN RecName: Full=Putative trmH family tRNA/rRNA methylt...   112   3e-27
TRMHL_STAAM RecName: Full=Putative trmH family tRNA/rRNA methylt...   112   3e-27
TRMHL_STAHJ RecName: Full=Putative trmH family tRNA/rRNA methylt...   108   5e-26
TRMHL_STAS1 RecName: Full=Putative trmH family tRNA/rRNA methylt...   106   2e-25
TRMHL_STAES RecName: Full=Putative trmH family tRNA/rRNA methylt...   104   9e-25
TRMHL_STAEQ RecName: Full=Putative trmH family tRNA/rRNA methylt...   104   9e-25
Y955_SYNY3 RecName: Full=Uncharacterized tRNA/rRNA methyltransfe...   101   8e-24
RLMB_PSEAE RecName: Full=23S rRNA (guanosine-2'-O-)-methyltransf...   100   1e-23
RLMB_COXBU RecName: Full=23S rRNA (guanosine-2'-O-)-methyltransf...    99   3e-23
RLMB_HAEIN RecName: Full=23S rRNA (guanosine-2'-O-)-methyltransf...    99   5e-23
RLMB_SHIFL RecName: Full=23S rRNA (guanosine-2'-O-)-methyltransf...    98   9e-23
RLMB_ECOLI RecName: Full=23S rRNA (guanosine-2'-O-)-methyltransf...    98   9e-23
RLMB_ECOL6 RecName: Full=23S rRNA (guanosine-2'-O-)-methyltransf...    98   9e-23
RLMB_ECO57 RecName: Full=23S rRNA (guanosine-2'-O-)-methyltransf...    98   9e-23
RLMB_SHEON RecName: Full=23S rRNA (guanosine-2'-O-)-methyltransf...    97   1e-22
RLMB_NEIMB RecName: Full=23S rRNA (guanosine-2'-O-)-methyltransf...    97   1e-22
RLMB_XYLFA RecName: Full=23S rRNA (guanosine-2'-O-)-methyltransf...    97   1e-22
RLMB_HAEDU RecName: Full=23S rRNA (guanosine-2'-O-)-methyltransf...    97   1e-22
RLMB_SALTY RecName: Full=23S rRNA (guanosine-2'-O-)-methyltransf...    96   3e-22
RLMB_NEIMA RecName: Full=23S rRNA (guanosine-2'-O-)-methyltransf...    96   3e-22
RLMB_SALTI RecName: Full=23S rRNA (guanosine-2'-O-)-methyltransf...    95   7e-22
RLMB_YERPE RecName: Full=23S rRNA (guanosine-2'-O-)-methyltransf...    94   1e-21
RLMB_PASMU RecName: Full=23S rRNA (guanosine-2'-O-)-methyltransf...    94   1e-21
RLMB_ERWCT RecName: Full=23S rRNA (guanosine-2'-O-)-methyltransf...    94   2e-21
RLMB_PHOLL RecName: Full=23S rRNA (guanosine-2'-O-)-methyltransf...    93   3e-21
RLMB_XYLFT RecName: Full=23S rRNA (guanosine-2'-O-)-methyltransf...    92   4e-21
RLMB_VIBPA RecName: Full=23S rRNA (guanosine-2'-O-)-methyltransf...    91   8e-21
RLMB_PHOPR RecName: Full=23S rRNA (guanosine-2'-O-)-methyltransf...    91   8e-21
RLMB_VIBCH RecName: Full=23S rRNA (guanosine-2'-O-)-methyltransf...    91   1e-20
RLMB_VIBVY RecName: Full=23S rRNA (guanosine-2'-O-)-methyltransf...    90   2e-20
RLMB_VIBVU RecName: Full=23S rRNA (guanosine-2'-O-)-methyltransf...    90   2e-20
RLMB_PSEPK RecName: Full=23S rRNA (guanosine-2'-O-)-methyltransf...    89   5e-20
RLMB_CHRVO RecName: Full=23S rRNA (guanosine-2'-O-)-methyltransf...    88   9e-20
RLMB_PSESM RecName: Full=23S rRNA (guanosine-2'-O-)-methyltransf...    87   2e-19
RLMB_XANAC RecName: Full=23S rRNA (guanosine-2'-O-)-methyltransf...    82   7e-18
RLMB_BLOFL RecName: Full=23S rRNA (guanosine-2'-O-)-methyltransf...    79   3e-17
Y479_MYCPA RecName: Full=Uncharacterized tRNA/rRNA methyltransfe...    79   4e-17
Y572_MYCA9 RecName: Full=Uncharacterized tRNA/rRNA methyltransfe...    79   6e-17
RLMB_BORPE RecName: Full=23S rRNA (guanosine-2'-O-)-methyltransf...    78   7e-17
RLMB_BORPA RecName: Full=23S rRNA (guanosine-2'-O-)-methyltransf...    78   7e-17
RLMB_BORBR RecName: Full=23S rRNA (guanosine-2'-O-)-methyltransf...    78   7e-17
RLMB_NITEU RecName: Full=23S rRNA (guanosine-2'-O-)-methyltransf...    78   9e-17
RLMB_RALSO RecName: Full=23S rRNA (guanosine-2'-O-)-methyltransf...    77   2e-16
Y6073_MYCS2 RecName: Full=Uncharacterized tRNA/rRNA methyltransf...    76   4e-16
Y252_MYCGE RecName: Full=Uncharacterized tRNA/rRNA methyltransfe...    76   4e-16
Y2399_ARCFU RecName: Full=Uncharacterized tRNA/rRNA methyltransf...    74   1e-15
Y1447_MYCGI RecName: Full=Uncharacterized tRNA/rRNA methyltransf...    74   1e-15
Y5337_MYCVP RecName: Full=Uncharacterized tRNA/rRNA methyltransf...    74   1e-15
MRM1_DICDI RecName: Full=Mitochondrial rRNA methyltransferase;  ...    73   3e-15
YSGA_BACSU RecName: Full=Uncharacterized tRNA/rRNA methyltransfe...    72   4e-15
Y516_BORBU RecName: Full=Uncharacterized tRNA/rRNA methyltransfe...    71   1e-14
Y355_MYCPN RecName: Full=Uncharacterized tRNA/rRNA methyltransfe...    67   1e-13
Y574_MYCA1 RecName: Full=Uncharacterized tRNA/rRNA methyltransfe...    67   2e-13
RLMB_XANCP RecName: Full=23S rRNA (guanosine-2'-O-)-methyltransf...    67   2e-13
Y5079_MYCMM RecName: Full=Uncharacterized tRNA/rRNA methyltransf...    64   2e-12
Y4155_MYCUA RecName: Full=Uncharacterized tRNA/rRNA methyltransf...    64   2e-12
MRM1_SCHPO RecName: Full=rRNA methyltransferase, mitochondrial; ...    62   7e-12
MRM1_HUMAN RecName: Full=rRNA methyltransferase 1, mitochondrial...    60   2e-11
Y5122_MYCSJ RecName: Full=Uncharacterized tRNA/rRNA methyltransf...    60   2e-11
Y4822_MYCSK RecName: Full=Uncharacterized tRNA/rRNA methyltransf...    60   2e-11
Y4736_MYCSS RecName: Full=Uncharacterized tRNA/rRNA methyltransf...    60   2e-11
MRM1_YEAST RecName: Full=rRNA methyltransferase, mitochondrial; ...    59   6e-11
RLMB_ACIAD RecName: Full=23S rRNA (guanosine-2'-O-)-methyltransf...    58   1e-10
Y324_MYCLE RecName: Full=Uncharacterized tRNA/rRNA methyltransfe...    57   2e-10
Y324_MYCLB RecName: Full=Uncharacterized tRNA/rRNA methyltransfe...    57   2e-10
YFIF_ECOLI RecName: Full=Uncharacterized tRNA/rRNA methyltransfe...    56   3e-10
YFIF_ECO57 RecName: Full=Uncharacterized tRNA/rRNA methyltransfe...    56   3e-10
Y3618_MYCTA RecName: Full=Uncharacterized tRNA/rRNA methyltransf...    52   4e-09
Y3579_MYCTU RecName: Full=Uncharacterized tRNA/rRNA methyltransf...    52   4e-09
Y3644_MYCBP RecName: Full=Uncharacterized tRNA/rRNA methyltransf...    52   6e-09
Y3610_MYCBO RecName: Full=Uncharacterized tRNA/rRNA methyltransf...    51   9e-09
Y905_MYCBO RecName: Full=Uncharacterized tRNA/rRNA methyltransfe...    50   3e-08
Y881_MYCTU RecName: Full=Uncharacterized tRNA/rRNA methyltransfe...    49   5e-08
RLMB_BURSP RecName: Full=23S rRNA (guanosine-2'-O-)-methyltransf...    48   8e-08
Y521_MYCPN RecName: Full=Uncharacterized tRNA/rRNA methyltransfe...    48   1e-07
TRMH_SHIFL RecName: Full=tRNA guanosine-2'-O-methyltransferase; ...    45   9e-07
TRMH_ECOLI RecName: Full=tRNA guanosine-2'-O-methyltransferase; ...    45   9e-07
TRMH_ECO57 RecName: Full=tRNA guanosine-2'-O-methyltransferase; ...    45   9e-07
Y346_MYCGE RecName: Full=Uncharacterized tRNA/rRNA methyltransfe...    44   1e-06
YGL3_BACST RecName: Full=Uncharacterized tRNA/rRNA methyltransfe...    44   2e-06
MRM1_MOUSE RecName: Full=rRNA methyltransferase 1, mitochondrial...    42   4e-06
Y1673_SYNY3 RecName: Full=Uncharacterized tRNA/rRNA methyltransf...    42   6e-06
TSNR_STRLU RecName: Full=rRNA (adenosine-2'-O-)-methyltransferas...    41   1e-05
Y424_HAEIN RecName: Full=Uncharacterized tRNA/rRNA methyltransfe...    40   2e-05
TARB1_HUMAN RecName: Full=Probable methyltransferase TARBP1;    ...    40   2e-05
Y052_BORBU RecName: Full=Putative tRNA/rRNA methyltransferase BB...    39   5e-05
TSNR_STRCN RecName: Full=rRNA (adenosine-2'-O-)-methyltransferas...    39   5e-05

>TRMHL_STAAE RecName: Full=Putative trmH family tRNA/rRNA
           methyltransferase;         EC=2.1.1.-;
          Length = 248

 Score =  115 bits (287), Expect = 5e-28
 Identities = 69/238 (28%), Positives = 128/238 (53%), Gaps = 8/238 (3%)

Query: 7   LIVGQHAVIEALRNPKRKVLKVFLTEESKKNIHRKNPKKNVLEDVKVYFKSKKELDKYTS 66
           +IVG+HAV EA+      + K+ + E  KK    +  K    + + V    K +LD   +
Sbjct: 5   VIVGRHAVREAIITG-HPINKILIQEGIKKQQINEILKNAKDQKIIVQTVPKSKLDFLAN 63

Query: 67  KDQIMHGGYIAEVEHIDQPDLKEFIKGKNE----LTFVCIDEVTDPRNIGSLIRSASSFH 122
                H G  A +   +  D  +F+K + E    LT + +D + DP N+GS++R+A +  
Sbjct: 64  AP---HQGVAALIAPYEYADFDQFLKQQKEKEGLLTVLILDGLEDPHNLGSILRTADATG 120

Query: 123 IDGLIVKERQFPSDSKLMYKAASGCMEHINIFEVSNINSTLKNLREKNFWVYGFDARGEK 182
           +DG+I+ +R+  + ++ + KA++G +EH+ +  V+N+  T+  L++  FWV G +A    
Sbjct: 121 VDGVIIPKRRSVTLTQTVAKASTGAIEHVPVIRVTNLAKTIDELKDNGFWVAGTEANNAT 180

Query: 183 DFTEIKWEGKNVLLFGSEGFGMREHTGKYTDFFVKIDINKDVESLNISNSAAIVFHHL 240
           D+  ++ +    ++ GSEG GM        DF++KI +   V SLN S +A+++ + +
Sbjct: 181 DYRNLEADMSLAIVIGSEGQGMSRLVSDKCDFYIKIPMVGHVNSLNASVAASLMMYEV 238


>TRMHL_STAAC RecName: Full=Putative trmH family tRNA/rRNA
           methyltransferase;         EC=2.1.1.-;
          Length = 248

 Score =  115 bits (287), Expect = 5e-28
 Identities = 69/238 (28%), Positives = 128/238 (53%), Gaps = 8/238 (3%)

Query: 7   LIVGQHAVIEALRNPKRKVLKVFLTEESKKNIHRKNPKKNVLEDVKVYFKSKKELDKYTS 66
           +IVG+HAV EA+      + K+ + E  KK    +  K    + + V    K +LD   +
Sbjct: 5   VIVGRHAVREAIITG-HPINKILIQEGIKKQQINEILKNAKDQKIIVQTVPKSKLDFLAN 63

Query: 67  KDQIMHGGYIAEVEHIDQPDLKEFIKGKNE----LTFVCIDEVTDPRNIGSLIRSASSFH 122
                H G  A +   +  D  +F+K + E    LT + +D + DP N+GS++R+A +  
Sbjct: 64  AP---HQGVAALIAPYEYADFDQFLKQQKEKEGLLTVLILDGLEDPHNLGSILRTADATG 120

Query: 123 IDGLIVKERQFPSDSKLMYKAASGCMEHINIFEVSNINSTLKNLREKNFWVYGFDARGEK 182
           +DG+I+ +R+  + ++ + KA++G +EH+ +  V+N+  T+  L++  FWV G +A    
Sbjct: 121 VDGVIIPKRRSVTLTQTVAKASTGAIEHVPVIRVTNLAKTIDELKDNGFWVAGTEANNAT 180

Query: 183 DFTEIKWEGKNVLLFGSEGFGMREHTGKYTDFFVKIDINKDVESLNISNSAAIVFHHL 240
           D+  ++ +    ++ GSEG GM        DF++KI +   V SLN S +A+++ + +
Sbjct: 181 DYRNLEADMSLAIVIGSEGQGMSRLVSDKCDFYIKIPMVGHVNSLNASVAASLMMYEV 238


>YACO_BACSU RecName: Full=Putative trmH family tRNA/rRNA
           methyltransferase yacO;         EC=2.1.1.-;
          Length = 249

 Score =  114 bits (286), Expect = 7e-28
 Identities = 70/247 (28%), Positives = 132/247 (53%), Gaps = 3/247 (1%)

Query: 1   MNKSSFLIVGQHAVIEALRNPKRKVLKVFLTEESKKNIHRKNPKKNVLEDVKVYFKSKKE 60
           M++    ++G++AVIE L++  RK+ K+++ E + K   ++  +    + + + +  +K+
Sbjct: 1   MSQQHDYVIGKNAVIETLKSD-RKLYKLWMAENTVKGQAQQVIELAKKQGITIQYVPRKK 59

Query: 61  LDKYTSKDQIMHGGYIAEVEHIDQPDLKEFIKGKNELTFVCI-DEVTDPRNIGSLIRSAS 119
           LD+  +                   DL +  + KNE  F  I DE+ DP N+GS++R+A 
Sbjct: 60  LDQMVTGQHQGXXXXXXXXXXXXLDDLYKAAEEKNEQPFFLILDELEDPHNLGSIMRTAD 119

Query: 120 SFHIDGLIVKERQFPSDSKLMYKAASGCMEHINIFEVSNINSTLKNLREKNFWVYGFDAR 179
           +    G+++ +R+    +  + KA++G +EHI +  V+N+  TL+ ++E+  WV G DA 
Sbjct: 120 AVGAHGIVIPKRRAVGLTTTVAKASTGAIEHIPVARVTNLARTLEEMKERGIWVVGTDAS 179

Query: 180 GEKDFTEIKWEGKNVLLFGSEGFGMREHTGKYTDFFVKIDINKDVESLNISNSAAIVFHH 239
             +DF  +       L+ GSEG GM     +  DF +K+ +   V SLN S +A ++ + 
Sbjct: 180 AREDFRNMDGNMPLALVIGSEGKGMGRLVKEKCDFLIKLPMAGKVTSLNASVAAGLLMYE 239

Query: 240 LSYLKKN 246
           + Y K+N
Sbjct: 240 V-YRKRN 245


>TRMHL_STAAW RecName: Full=Putative trmH family tRNA/rRNA
           methyltransferase;         EC=2.1.1.-;
          Length = 248

 Score =  112 bits (281), Expect = 3e-27
 Identities = 68/238 (28%), Positives = 127/238 (53%), Gaps = 8/238 (3%)

Query: 7   LIVGQHAVIEALRNPKRKVLKVFLTEESKKNIHRKNPKKNVLEDVKVYFKSKKELDKYTS 66
           +IVG+HAV EA+      + K+ + E  KK    +  K    + + V    K +LD   +
Sbjct: 5   VIVGRHAVREAIITG-HPINKILIQEGIKKQQINEILKNAKDQKIIVQTVPKSKLDFLAN 63

Query: 67  KDQIMHGGYIAEVEHIDQPDLKEFIKGKNEL----TFVCIDEVTDPRNIGSLIRSASSFH 122
                H G  A +   +  D  +F+K + E     T + +D + DP N+GS++R+A +  
Sbjct: 64  AP---HQGVAALIAPYEYADFDQFLKQQKEKEGLSTVLILDGLEDPHNLGSILRTADATG 120

Query: 123 IDGLIVKERQFPSDSKLMYKAASGCMEHINIFEVSNINSTLKNLREKNFWVYGFDARGEK 182
           +DG+I+ +R+  + ++ + KA++G +EH+ +  V+N+  T+  L++  FWV G +A    
Sbjct: 121 VDGVIIPKRRSVTLTQTVAKASTGAIEHVPVIRVTNLAKTIDELKDNGFWVAGTEANNAT 180

Query: 183 DFTEIKWEGKNVLLFGSEGFGMREHTGKYTDFFVKIDINKDVESLNISNSAAIVFHHL 240
           D+  ++ +    ++ GSEG GM        DF++KI +   V SLN S +A+++ + +
Sbjct: 181 DYRNLEADMSLAIVIGSEGQGMSRLVSDKCDFYIKIPMVGHVNSLNASVAASLMMYEV 238


>TRMHL_STAAS RecName: Full=Putative trmH family tRNA/rRNA
           methyltransferase;         EC=2.1.1.-;
          Length = 248

 Score =  112 bits (281), Expect = 3e-27
 Identities = 68/238 (28%), Positives = 127/238 (53%), Gaps = 8/238 (3%)

Query: 7   LIVGQHAVIEALRNPKRKVLKVFLTEESKKNIHRKNPKKNVLEDVKVYFKSKKELDKYTS 66
           +IVG+HAV EA+      + K+ + E  KK    +  K    + + V    K +LD   +
Sbjct: 5   VIVGRHAVREAIITG-HPINKILIQEGIKKQQINEILKNAKDQKIIVQTVPKSKLDFLAN 63

Query: 67  KDQIMHGGYIAEVEHIDQPDLKEFIKGKNEL----TFVCIDEVTDPRNIGSLIRSASSFH 122
                H G  A +   +  D  +F+K + E     T + +D + DP N+GS++R+A +  
Sbjct: 64  AP---HQGVAALIAPYEYADFDQFLKQQKEKEGLSTVLILDGLEDPHNLGSILRTADATG 120

Query: 123 IDGLIVKERQFPSDSKLMYKAASGCMEHINIFEVSNINSTLKNLREKNFWVYGFDARGEK 182
           +DG+I+ +R+  + ++ + KA++G +EH+ +  V+N+  T+  L++  FWV G +A    
Sbjct: 121 VDGVIIPKRRSVTLTQTVAKASTGAIEHVPVIRVTNLAKTIDELKDNGFWVAGTEANNAT 180

Query: 183 DFTEIKWEGKNVLLFGSEGFGMREHTGKYTDFFVKIDINKDVESLNISNSAAIVFHHL 240
           D+  ++ +    ++ GSEG GM        DF++KI +   V SLN S +A+++ + +
Sbjct: 181 DYRNLEADMSLAIVIGSEGQGMSRLVSDKCDFYIKIPMVGHVNSLNASVAASLMMYEV 238


>TRMHL_STAAR RecName: Full=Putative trmH family tRNA/rRNA
           methyltransferase;         EC=2.1.1.-;
          Length = 248

 Score =  112 bits (281), Expect = 3e-27
 Identities = 68/238 (28%), Positives = 127/238 (53%), Gaps = 8/238 (3%)

Query: 7   LIVGQHAVIEALRNPKRKVLKVFLTEESKKNIHRKNPKKNVLEDVKVYFKSKKELDKYTS 66
           +IVG+HAV EA+      + K+ + E  KK    +  K    + + V    K +LD   +
Sbjct: 5   VIVGRHAVREAIITG-HPINKILIQEGIKKQQINEILKNAKDQKIIVQTVPKSKLDFLAN 63

Query: 67  KDQIMHGGYIAEVEHIDQPDLKEFIKGKNEL----TFVCIDEVTDPRNIGSLIRSASSFH 122
                H G  A +   +  D  +F+K + E     T + +D + DP N+GS++R+A +  
Sbjct: 64  AP---HQGVAALIAPYEYADFDQFLKQQKEKEGLSTVLILDGLEDPHNLGSILRTADATG 120

Query: 123 IDGLIVKERQFPSDSKLMYKAASGCMEHINIFEVSNINSTLKNLREKNFWVYGFDARGEK 182
           +DG+I+ +R+  + ++ + KA++G +EH+ +  V+N+  T+  L++  FWV G +A    
Sbjct: 121 VDGVIIPKRRSVTLTQTVAKASTGAIEHVPVIRVTNLAKTIDELKDNGFWVAGTEANNAT 180

Query: 183 DFTEIKWEGKNVLLFGSEGFGMREHTGKYTDFFVKIDINKDVESLNISNSAAIVFHHL 240
           D+  ++ +    ++ GSEG GM        DF++KI +   V SLN S +A+++ + +
Sbjct: 181 DYRNLEADMSLAIVIGSEGQGMSRLVSDKCDFYIKIPMVGHVNSLNASVAASLMMYEV 238


>TRMHL_STAAN RecName: Full=Putative trmH family tRNA/rRNA
           methyltransferase;         EC=2.1.1.-;
          Length = 248

 Score =  112 bits (281), Expect = 3e-27
 Identities = 68/238 (28%), Positives = 127/238 (53%), Gaps = 8/238 (3%)

Query: 7   LIVGQHAVIEALRNPKRKVLKVFLTEESKKNIHRKNPKKNVLEDVKVYFKSKKELDKYTS 66
           +IVG+HAV EA+      + K+ + E  KK    +  K    + + V    K +LD   +
Sbjct: 5   VIVGRHAVREAIITG-HPINKILIQEGIKKQQINEILKNAKDQKIIVQTVPKSKLDFLAN 63

Query: 67  KDQIMHGGYIAEVEHIDQPDLKEFIKGKNEL----TFVCIDEVTDPRNIGSLIRSASSFH 122
                H G  A +   +  D  +F+K + E     T + +D + DP N+GS++R+A +  
Sbjct: 64  AP---HQGVAALIAPYEYADFDQFLKQQKEKEGLSTVLILDGLEDPHNLGSILRTADATG 120

Query: 123 IDGLIVKERQFPSDSKLMYKAASGCMEHINIFEVSNINSTLKNLREKNFWVYGFDARGEK 182
           +DG+I+ +R+  + ++ + KA++G +EH+ +  V+N+  T+  L++  FWV G +A    
Sbjct: 121 VDGVIIPKRRSVTLTQTVAKASTGAIEHVPVIRVTNLAKTIDELKDNGFWVAGTEANNAT 180

Query: 183 DFTEIKWEGKNVLLFGSEGFGMREHTGKYTDFFVKIDINKDVESLNISNSAAIVFHHL 240
           D+  ++ +    ++ GSEG GM        DF++KI +   V SLN S +A+++ + +
Sbjct: 181 DYRNLEADMSLAIVIGSEGQGMSRLVSDKCDFYIKIPMVGHVNSLNASVAASLMMYEV 238


>TRMHL_STAAM RecName: Full=Putative trmH family tRNA/rRNA
           methyltransferase;         EC=2.1.1.-;
          Length = 248

 Score =  112 bits (281), Expect = 3e-27
 Identities = 68/238 (28%), Positives = 127/238 (53%), Gaps = 8/238 (3%)

Query: 7   LIVGQHAVIEALRNPKRKVLKVFLTEESKKNIHRKNPKKNVLEDVKVYFKSKKELDKYTS 66
           +IVG+HAV EA+      + K+ + E  KK    +  K    + + V    K +LD   +
Sbjct: 5   VIVGRHAVREAIITG-HPINKILIQEGIKKQQINEILKNAKDQKIIVQTVPKSKLDFLAN 63

Query: 67  KDQIMHGGYIAEVEHIDQPDLKEFIKGKNEL----TFVCIDEVTDPRNIGSLIRSASSFH 122
                H G  A +   +  D  +F+K + E     T + +D + DP N+GS++R+A +  
Sbjct: 64  AP---HQGVAALIAPYEYADFDQFLKQQKEKEGLSTVLILDGLEDPHNLGSILRTADATG 120

Query: 123 IDGLIVKERQFPSDSKLMYKAASGCMEHINIFEVSNINSTLKNLREKNFWVYGFDARGEK 182
           +DG+I+ +R+  + ++ + KA++G +EH+ +  V+N+  T+  L++  FWV G +A    
Sbjct: 121 VDGVIIPKRRSVTLTQTVAKASTGAIEHVPVIRVTNLAKTIDELKDNGFWVAGTEANNAT 180

Query: 183 DFTEIKWEGKNVLLFGSEGFGMREHTGKYTDFFVKIDINKDVESLNISNSAAIVFHHL 240
           D+  ++ +    ++ GSEG GM        DF++KI +   V SLN S +A+++ + +
Sbjct: 181 DYRNLEADMSLAIVIGSEGQGMSRLVSDKCDFYIKIPMVGHVNSLNASVAASLMMYEV 238


>TRMHL_STAHJ RecName: Full=Putative trmH family tRNA/rRNA
           methyltransferase;         EC=2.1.1.-;
          Length = 249

 Score =  108 bits (270), Expect = 5e-26
 Identities = 70/249 (28%), Positives = 135/249 (54%), Gaps = 19/249 (7%)

Query: 7   LIVGQHAVIEALRNPKRKVLKVFLTEESKKNIHRKNPKKNVLEDVK-----VYFKSKKEL 61
           +IVG+HAV EA+ +    + K+++ E       RK    ++L++ K     V    K +L
Sbjct: 5   VIVGRHAVKEAIVSG-HTINKIWIQEGI-----RKQQINDILQNAKEQKLIVQTVPKSKL 58

Query: 62  DKYTSKDQIMHGGYIAEVEHIDQPDLKEFIKGKNEL----TFVCIDEVTDPRNIGSLIRS 117
           D   +     H G  A +   +  D  +FI+ + +     T V +D + DP N+GS++R+
Sbjct: 59  DNLANAP---HQGVAALIAPYEYADFDQFIQSQKDKEGLSTVVILDGLEDPHNLGSILRT 115

Query: 118 ASSFHIDGLIVKERQFPSDSKLMYKAASGCMEHINIFEVSNINSTLKNLREKNFWVYGFD 177
           A +  +DG+I+ +R+  + ++ + KA++G ++H+ +  V+N+  T+  L+E  +WV G +
Sbjct: 116 ADASGVDGVIIPKRRSVALTQTVAKASTGAIQHVPVMRVTNLAKTIDELKEHGYWVAGAE 175

Query: 178 ARGEKDFTEIKWEGKNVLLFGSEGFGMREHTGKYTDFFVKIDINKDVESLNISNSAAIVF 237
           A    D+ ++  +    ++ GSEG GM        DF++KI +   V SLN S +A+++ 
Sbjct: 176 ADNATDYRDMAADMPLAIVIGSEGQGMSRLVKDKCDFYIKIPMVGHVNSLNASVAASLMM 235

Query: 238 HHLSYLKKN 246
           + + Y K++
Sbjct: 236 YEV-YRKRH 243


>TRMHL_STAS1 RecName: Full=Putative trmH family tRNA/rRNA
           methyltransferase;         EC=2.1.1.-;
          Length = 249

 Score =  106 bits (265), Expect = 2e-25
 Identities = 67/241 (27%), Positives = 131/241 (54%), Gaps = 3/241 (1%)

Query: 7   LIVGQHAVIEALRNPKRKVLKVFLTEESKKNIHRKNPKKNVLEDVKVYFKSKKELDKYTS 66
           +IVG+HAV EA+ +    + K+ + +  KK    +  K      + V    K ++D  + 
Sbjct: 5   VIVGRHAVKEAIVSG-HTINKILIQDTIKKGQINEILKLANSNKIIVQSVPKSKIDGLSD 63

Query: 67  KDQIMHGGYIAEVEHIDQPDLKEFIKGKNELTFVCI-DEVTDPRNIGSLIRSASSFHIDG 125
                   YIA  E+ D        K +++L+ V I D + DP N+GS++R+A +  +DG
Sbjct: 64  SPHQGVAAYIAPYEYADFDAFVAQQKAQDKLSTVLILDGLEDPHNLGSILRTADASGVDG 123

Query: 126 LIVKERQFPSDSKLMYKAASGCMEHINIFEVSNINSTLKNLREKNFWVYGFDARGEKDFT 185
           +I+ +R+  + ++ + KA++G ++HI +  V+N+ +T++ L++  +W+ G +A    D+ 
Sbjct: 124 VIIPKRRSVALTQTVAKASTGAIQHIPVMRVTNLANTIETLKDNGYWIVGTEAENSTDYR 183

Query: 186 EIKWEGKNVLLFGSEGFGMREHTGKYTDFFVKIDINKDVESLNISNSAAIVFHHLSYLKK 245
           E+       ++ GSEG GM     +  DF++ I +   V SLN S +A+++ + + + K+
Sbjct: 184 EMDAGMPLGIVIGSEGQGMSRLVKEKCDFYINIPMVGHVNSLNASVAASLMMYEV-FRKR 242

Query: 246 N 246
           N
Sbjct: 243 N 243


>TRMHL_STAES RecName: Full=Putative trmH family tRNA/rRNA
           methyltransferase;         EC=2.1.1.-;
          Length = 249

 Score =  104 bits (259), Expect = 9e-25
 Identities = 65/244 (26%), Positives = 131/244 (53%), Gaps = 9/244 (3%)

Query: 7   LIVGQHAVIEALRNPKRKVLKVFLTEESKKNIHRKNPKKNVLEDVKVYFKSKKELDKYTS 66
           +IVG+HAV EA+ +    + K+ + +  KK       K    + + V    K +LD   +
Sbjct: 5   VIVGRHAVKEAIISG-HAINKILIQDGIKKQQINDILKNAKSQKLIVQTVPKSKLDFLAN 63

Query: 67  KDQIMHGGYIAEVEHIDQPDLKEFIKGKNEL----TFVCIDEVTDPRNIGSLIRSASSFH 122
                H G  A V   +  +  EF++ + +     T + +D + DP N+GS++R+A +  
Sbjct: 64  AP---HQGVAALVAPYEYANFDEFLQKQKKKARYSTVIILDGLEDPHNLGSILRTADASG 120

Query: 123 IDGLIVKERQFPSDSKLMYKAASGCMEHINIFEVSNINSTLKNLREKNFWVYGFDARGEK 182
           +D +I+ +R+  + ++ + KA++G ++H+ +  V+N++ T+  L++  FW+ G +A    
Sbjct: 121 VDAVIIPKRRSVALTQTVAKASTGAIQHVPVIRVTNLSKTIDELKDNGFWIAGTEANNAT 180

Query: 183 DFTEIKWEGKNVLLFGSEGFGMREHTGKYTDFFVKIDINKDVESLNISNSAAIVFHHLSY 242
           D+ +++ +    ++ GSEG GM        DF +KI +   V SLN S +A+++ + + Y
Sbjct: 181 DYRDLQADMSLGIVIGSEGQGMSRLVSDKCDFHIKIPMVGHVNSLNASVAASLMMYEV-Y 239

Query: 243 LKKN 246
            K++
Sbjct: 240 RKRH 243


>TRMHL_STAEQ RecName: Full=Putative trmH family tRNA/rRNA
           methyltransferase;         EC=2.1.1.-;
          Length = 249

 Score =  104 bits (259), Expect = 9e-25
 Identities = 65/244 (26%), Positives = 131/244 (53%), Gaps = 9/244 (3%)

Query: 7   LIVGQHAVIEALRNPKRKVLKVFLTEESKKNIHRKNPKKNVLEDVKVYFKSKKELDKYTS 66
           +IVG+HAV EA+ +    + K+ + +  KK       K    + + V    K +LD   +
Sbjct: 5   VIVGRHAVKEAIISG-HAINKILIQDGIKKQQINDILKNAKSQKLIVQTVPKSKLDFLAN 63

Query: 67  KDQIMHGGYIAEVEHIDQPDLKEFIKGKNEL----TFVCIDEVTDPRNIGSLIRSASSFH 122
                H G  A V   +  +  EF++ + +     T + +D + DP N+GS++R+A +  
Sbjct: 64  AP---HQGVAALVAPYEYANFDEFLQKQKKKARYSTVIILDGLEDPHNLGSILRTADASG 120

Query: 123 IDGLIVKERQFPSDSKLMYKAASGCMEHINIFEVSNINSTLKNLREKNFWVYGFDARGEK 182
           +D +I+ +R+  + ++ + KA++G ++H+ +  V+N++ T+  L++  FW+ G +A    
Sbjct: 121 VDAVIIPKRRSVALTQTVAKASTGAIQHVPVIRVTNLSKTIDELKDNGFWIAGTEANNAT 180

Query: 183 DFTEIKWEGKNVLLFGSEGFGMREHTGKYTDFFVKIDINKDVESLNISNSAAIVFHHLSY 242
           D+ +++ +    ++ GSEG GM        DF +KI +   V SLN S +A+++ + + Y
Sbjct: 181 DYRDLQADMSLGIVIGSEGQGMSRLVSDKCDFHIKIPMVGHVNSLNASVAASLMMYEV-Y 239

Query: 243 LKKN 246
            K++
Sbjct: 240 RKRH 243


>Y955_SYNY3 RecName: Full=Uncharacterized tRNA/rRNA
           methyltransferase slr0955;         EC=2.1.1.-;
          Length = 384

 Score =  101 bits (251), Expect = 8e-24
 Identities = 69/242 (28%), Positives = 123/242 (50%), Gaps = 14/242 (5%)

Query: 7   LIVGQHAVIEALRNPKRKVLKVFLTEESKKNIHRKNPKKNVLEDVKVYFKSKKELDKYTS 66
           L+ G HAV+ AL +  R++ ++++T   + +I  +      ++  K       E+D +  
Sbjct: 125 LLYGHHAVLAAL-DGDRQLNRIWITSHLRHDIRYRTK----IQTAKANGTVVDEVDNFRL 179

Query: 67  KDQIMHG----GYIAEVEHIDQPDLKEFI-KGKNELT---FVCIDEVTDPRNIGSLIRSA 118
            +QI H     G  A+V      +L + I K K++ T    + ID +TDP N+G++IR+A
Sbjct: 180 -NQITHNANHQGIAAQVAPYHYWELGDLIDKAKSQSTAPVLIIIDSITDPHNLGAIIRTA 238

Query: 119 SSFHIDGLIVKERQFPSDSKLMYKAASGCMEHINIFEVSNINSTLKNLREKNFWVYGFDA 178
            +F   G+++ +R+    +  + K A+G +EH  +  V N++  L+ L+E  FW+YG  A
Sbjct: 239 EAFGAQGMVLPQRRVAGITSTVMKVAAGALEHFPVARVVNLSRALETLKESGFWIYGTVA 298

Query: 179 RGEKDFTEIKWEGKNVLLFGSEGFGMREHTGKYTDFFVKIDINKDVESLNISNSAAIVFH 238
             +    +        L+ GSEG G+   T K+ D  + I +     SLN S +AAI  +
Sbjct: 299 GKQTALHQADLREPMGLVIGSEGEGLSLLTQKHCDHLITIPLAGKTPSLNASVAAAISLY 358

Query: 239 HL 240
            +
Sbjct: 359 EI 360


>RLMB_PSEAE RecName: Full=23S rRNA
           (guanosine-2'-O-)-methyltransferase rlmB;       
           EC=2.1.1.-;AltName: Full=23S rRNA Gm2251
           2'-O-methyltransferase;
          Length = 248

 Score =  100 bits (250), Expect = 1e-23
 Identities = 66/238 (27%), Positives = 124/238 (52%), Gaps = 19/238 (7%)

Query: 8   IVGQHAVIEALRNPKRKVLKVFLTEESKKNIHRKNPKKNVLEDVKVYFK------SKKEL 61
           + G HAV   LR+  ++V +++L E       R +P+  VL ++   F+       ++EL
Sbjct: 7   VYGVHAVEALLRHHPKRVKQLWLAEG------RHDPRVQVLTELAAGFRIPVGQRDRREL 60

Query: 62  DKYTSKDQIMHGGYIAEVEHID---QPDLKEFIKGKNELTFV-CIDEVTDPRNIGSLIRS 117
           D++      +H G +AEV       +  L+E ++    +  +  +D VTDP N+G+ +R+
Sbjct: 61  DEWAEG---VHQGVVAEVSPSQVWGENMLEELLERSEGVPLLLALDGVTDPHNLGACLRT 117

Query: 118 ASSFHIDGLIVKERQFPSDSKLMYKAASGCMEHINIFEVSNINSTLKNLREKNFWVYGFD 177
           A +  +  +IV + +  + +  + K A G  E I +  V+N+  TL+ L+++  WV G  
Sbjct: 118 ADAAGVQAVIVPKDKSATLNATVRKVACGAAEVIPLVAVTNLARTLEKLQQRGLWVVGTA 177

Query: 178 ARGEKDFTEIKWEGKNVLLFGSEGFGMREHTGKYTDFFVKIDINKDVESLNISNSAAI 235
              +K   ++  +G  VL+ G+EG GMR  T ++ DF  ++ +   V SLN+S +  +
Sbjct: 178 GEADKTLYQLDLKGPTVLVMGAEGKGMRRLTREHCDFLARLPMAGSVSSLNVSVATGV 235


>RLMB_COXBU RecName: Full=23S rRNA
           (guanosine-2'-O-)-methyltransferase rlmB;       
           EC=2.1.1.-;AltName: Full=23S rRNA Gm2251
           2'-O-methyltransferase;
          Length = 250

 Score = 99.4 bits (246), Expect = 3e-23
 Identities = 67/237 (28%), Positives = 118/237 (49%), Gaps = 7/237 (2%)

Query: 8   IVGQHAVIEALRNPKRKVLKVFLTEESKKNIHRKNPKKNVLEDVKVYFKSKKELDKYTSK 67
           I G HAV   L    ++++K+++ E       +   +K     VKV   S+ EL+  +++
Sbjct: 7   IYGIHAVSGVLDAAPQRIVKLYVQENRDDQRLQSLVEKAKALGVKVILLSRTELNTLSNE 66

Query: 68  DQIMHGGYIA---EVEHIDQPDLKEFIKGKNELTFVCI-DEVTDPRNIGSLIRSASSFHI 123
               H G +A   EVE++D+  L   +K +     + I D V DP N+G+ +RSA++F +
Sbjct: 67  K---HQGIVADCEEVENLDESALLSLLKKRETPALLLILDGVKDPHNLGACLRSANAFGV 123

Query: 124 DGLIVKERQFPSDSKLMYKAASGCMEHINIFEVSNINSTLKNLREKNFWVYGFDARGEKD 183
             +I  + +    + ++ K A G  E      V+N++ T+  L+++  W+ G     E  
Sbjct: 124 RAVIAPKDRAVGVTPVVRKVACGAAEMTPFIRVTNLSRTIDWLQKEGVWIVGTAVEAETL 183

Query: 184 FTEIKWEGKNVLLFGSEGFGMREHTGKYTDFFVKIDINKDVESLNISNSAAIVFHHL 240
             EI   G   ++ GSEG G+R  T +  DF  +I +   VESLN+S +  I  + +
Sbjct: 184 IQEIDLTGDIAIVLGSEGAGLRRLTKERCDFLAQIPLRGSVESLNVSVACGICLYEV 240


>RLMB_HAEIN RecName: Full=23S rRNA
           (guanosine-2'-O-)-methyltransferase rlmB;       
           EC=2.1.1.-;AltName: Full=23S rRNA Gm2251
           2'-O-methyltransferase;
          Length = 246

 Score = 98.6 bits (244), Expect = 5e-23
 Identities = 68/234 (29%), Positives = 118/234 (50%), Gaps = 10/234 (4%)

Query: 8   IVGQHAVIEALRNPKRKVLKVFLTEESKKNIHRKNPKKNVLED--VKVYFKSKKELDKYT 65
           I G HAV   L +   ++++VF+ +  +    R  P  N L    + V F +++ LDK  
Sbjct: 5   IYGIHAVNSILTHSPERLIEVFVLKGREDK--RLQPLLNELYSLGIGVQFVNRQTLDK-- 60

Query: 66  SKDQIMHGGYIAEVE---HIDQPDLKEFIKGKNELTFVCIDEVTDPRNIGSLIRSASSFH 122
             D  +H G IA V+    +++ DL E +  K     + +D VTDP N+G+ +R+A +  
Sbjct: 61  KADGEVHQGVIARVQAAKELNENDLDEILANKQNPLLLVLDGVTDPHNLGACLRTADAAG 120

Query: 123 IDGLIVKERQFPSDSKLMYKAASGCMEHINIFEVSNINSTLKNLREK-NFWVYGFDARGE 181
              +IV + +    + +  K A G  E + +  V+N++ TL++L++  N WV G      
Sbjct: 121 AVAVIVPKDKSAQLTSIARKVACGAAETVPLIRVTNLSRTLRDLQQNHNIWVVGTAGEAT 180

Query: 182 KDFTEIKWEGKNVLLFGSEGFGMREHTGKYTDFFVKIDINKDVESLNISNSAAI 235
           +   + K  G   L+ G+EG GMR  T ++ D  + I +   V SLN+S +  +
Sbjct: 181 ETIYQSKLTGPLALVMGAEGEGMRRLTREHCDQLISIPMAGSVSSLNVSVATGV 234


>RLMB_SHIFL RecName: Full=23S rRNA
           (guanosine-2'-O-)-methyltransferase rlmB;       
           EC=2.1.1.-;AltName: Full=23S rRNA Gm2251
           2'-O-methyltransferase;
          Length = 243

 Score = 97.8 bits (242), Expect = 9e-23
 Identities = 67/236 (28%), Positives = 116/236 (49%), Gaps = 9/236 (3%)

Query: 5   SFLIVGQHAVIEALRNPKRKVLKVFLTEESKKNIHRKNPKKNVLED--VKVYFKSKKELD 62
           S +I G HAV   L     +  +VF+ +  +    R  P  + LE   V +   +++ LD
Sbjct: 2   SEMIYGIHAVQALLERAPERFQEVFILKGREDK--RLLPLIHALESQGVVIQLANRQYLD 59

Query: 63  KYTSKDQIMHGGYIAEVE---HIDQPDLKEFIKGKNELTFVCIDEVTDPRNIGSLIRSAS 119
           +    D  +H G IA V+      + DL + I   ++   + +D VTDP N+G+ +RSA 
Sbjct: 60  E--KSDGAVHQGIIARVKPGRQYQENDLPDLIASLDQPFLLILDGVTDPHNLGACLRSAD 117

Query: 120 SFHIDGLIVKERQFPSDSKLMYKAASGCMEHINIFEVSNINSTLKNLREKNFWVYGFDAR 179
           +  +  +IV + +    +    K A G  E + +  V+N+  T++ L+E+N W+ G    
Sbjct: 118 AAGVHAVIVPKDRSAQLNATAKKVACGAAESVPLIRVTNLARTMRMLQEENIWIVGTAGE 177

Query: 180 GEKDFTEIKWEGKNVLLFGSEGFGMREHTGKYTDFFVKIDINKDVESLNISNSAAI 235
            +    + K  G+  L+ G+EG GMR  T ++ D  + I +   V SLN+S +  I
Sbjct: 178 ADHTLYQSKMTGRLALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGI 233


>RLMB_ECOLI RecName: Full=23S rRNA
           (guanosine-2'-O-)-methyltransferase rlmB;       
           EC=2.1.1.-;AltName: Full=23S rRNA Gm2251
           2'-O-methyltransferase;
          Length = 243

 Score = 97.8 bits (242), Expect = 9e-23
 Identities = 67/236 (28%), Positives = 116/236 (49%), Gaps = 9/236 (3%)

Query: 5   SFLIVGQHAVIEALRNPKRKVLKVFLTEESKKNIHRKNPKKNVLED--VKVYFKSKKELD 62
           S +I G HAV   L     +  +VF+ +  +    R  P  + LE   V +   +++ LD
Sbjct: 2   SEMIYGIHAVQALLERAPERFQEVFILKGREDK--RLLPLIHALESQGVVIQLANRQYLD 59

Query: 63  KYTSKDQIMHGGYIAEVE---HIDQPDLKEFIKGKNELTFVCIDEVTDPRNIGSLIRSAS 119
           +    D  +H G IA V+      + DL + I   ++   + +D VTDP N+G+ +RSA 
Sbjct: 60  E--KSDGAVHQGIIARVKPGRQYQENDLPDLIASLDQPFLLILDGVTDPHNLGACLRSAD 117

Query: 120 SFHIDGLIVKERQFPSDSKLMYKAASGCMEHINIFEVSNINSTLKNLREKNFWVYGFDAR 179
           +  +  +IV + +    +    K A G  E + +  V+N+  T++ L+E+N W+ G    
Sbjct: 118 AAGVHAVIVPKDRSAQLNATAKKVACGAAESVPLIRVTNLARTMRMLQEENIWIVGTAGE 177

Query: 180 GEKDFTEIKWEGKNVLLFGSEGFGMREHTGKYTDFFVKIDINKDVESLNISNSAAI 235
            +    + K  G+  L+ G+EG GMR  T ++ D  + I +   V SLN+S +  I
Sbjct: 178 ADHTLYQSKMTGRLALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGI 233


>RLMB_ECOL6 RecName: Full=23S rRNA
           (guanosine-2'-O-)-methyltransferase rlmB;       
           EC=2.1.1.-;AltName: Full=23S rRNA Gm2251
           2'-O-methyltransferase;
          Length = 243

 Score = 97.8 bits (242), Expect = 9e-23
 Identities = 67/236 (28%), Positives = 116/236 (49%), Gaps = 9/236 (3%)

Query: 5   SFLIVGQHAVIEALRNPKRKVLKVFLTEESKKNIHRKNPKKNVLED--VKVYFKSKKELD 62
           S +I G HAV   L     +  +VF+ +  +    R  P  + LE   V +   +++ LD
Sbjct: 2   SEMIYGIHAVQALLERAPERFQEVFILKGREDK--RLLPLIHALESQGVVIQLANRQYLD 59

Query: 63  KYTSKDQIMHGGYIAEVE---HIDQPDLKEFIKGKNELTFVCIDEVTDPRNIGSLIRSAS 119
           +    D  +H G IA V+      + DL + I   ++   + +D VTDP N+G+ +RSA 
Sbjct: 60  E--KSDGAVHQGIIARVKPGRQYQENDLPDLIASLDQPFLLILDGVTDPHNLGACLRSAD 117

Query: 120 SFHIDGLIVKERQFPSDSKLMYKAASGCMEHINIFEVSNINSTLKNLREKNFWVYGFDAR 179
           +  +  +IV + +    +    K A G  E + +  V+N+  T++ L+E+N W+ G    
Sbjct: 118 AAGVHAVIVPKDRSAQLNATAKKVACGAAESVPLIRVTNLARTMRMLQEENIWIVGTAGE 177

Query: 180 GEKDFTEIKWEGKNVLLFGSEGFGMREHTGKYTDFFVKIDINKDVESLNISNSAAI 235
            +    + K  G+  L+ G+EG GMR  T ++ D  + I +   V SLN+S +  I
Sbjct: 178 ADHTLYQSKMTGRLALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGI 233


>RLMB_ECO57 RecName: Full=23S rRNA
           (guanosine-2'-O-)-methyltransferase rlmB;       
           EC=2.1.1.-;AltName: Full=23S rRNA Gm2251
           2'-O-methyltransferase;
          Length = 243

 Score = 97.8 bits (242), Expect = 9e-23
 Identities = 67/236 (28%), Positives = 116/236 (49%), Gaps = 9/236 (3%)

Query: 5   SFLIVGQHAVIEALRNPKRKVLKVFLTEESKKNIHRKNPKKNVLED--VKVYFKSKKELD 62
           S +I G HAV   L     +  +VF+ +  +    R  P  + LE   V +   +++ LD
Sbjct: 2   SEMIYGIHAVQALLERAPERFQEVFILKGREDK--RLLPLIHALESQGVVIQLANRQYLD 59

Query: 63  KYTSKDQIMHGGYIAEVE---HIDQPDLKEFIKGKNELTFVCIDEVTDPRNIGSLIRSAS 119
           +    D  +H G IA V+      + DL + I   ++   + +D VTDP N+G+ +RSA 
Sbjct: 60  E--KSDGAVHQGIIARVKPGRQYQENDLPDLIASLDQPFLLILDGVTDPHNLGACLRSAD 117

Query: 120 SFHIDGLIVKERQFPSDSKLMYKAASGCMEHINIFEVSNINSTLKNLREKNFWVYGFDAR 179
           +  +  +IV + +    +    K A G  E + +  V+N+  T++ L+E+N W+ G    
Sbjct: 118 AAGVHAVIVPKDRSAQLNATAKKVACGAAESVPLIRVTNLARTMRMLQEENIWIVGTAGE 177

Query: 180 GEKDFTEIKWEGKNVLLFGSEGFGMREHTGKYTDFFVKIDINKDVESLNISNSAAI 235
            +    + K  G+  L+ G+EG GMR  T ++ D  + I +   V SLN+S +  I
Sbjct: 178 ADHTLYQSKMTGRLALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGI 233


>RLMB_SHEON RecName: Full=23S rRNA
           (guanosine-2'-O-)-methyltransferase rlmB;       
           EC=2.1.1.-;AltName: Full=23S rRNA Gm2251
           2'-O-methyltransferase;
          Length = 246

 Score = 97.4 bits (241), Expect = 1e-22
 Identities = 64/237 (27%), Positives = 121/237 (51%), Gaps = 7/237 (2%)

Query: 3   KSSFLIVGQHAVIEALRNPKRKVLKVFLTEESKKNIHRKNPKKNVLEDVKVYFKSKKELD 62
           K   +I G HAV   L++   ++++++L +  +        ++       +   S+K LD
Sbjct: 2   KKQDIIFGIHAVEALLKHSPERIIELWLLQGREDERLTPLIRQAKAFGTSIQVTSRKVLD 61

Query: 63  KYTSKDQIMHGGYIAEVEH---IDQPDLKEFIKGKNELTFVCI-DEVTDPRNIGSLIRSA 118
           +     Q  H G +A V+    + + DL E +  K +L F+ I D VTDP N+G+ +R+A
Sbjct: 62  EKAESTQ--HQGIVARVKAAKILAEHDLDELL-AKTDLPFLLILDGVTDPHNLGACLRNA 118

Query: 119 SSFHIDGLIVKERQFPSDSKLMYKAASGCMEHINIFEVSNINSTLKNLREKNFWVYGFDA 178
            +  + G+IV +      + ++ K A G  E + +F+V+N+  T+++L+EK  W+ G   
Sbjct: 119 DAAGVQGIIVPKDNSVGLTAVVSKVACGAAETVPLFQVTNLARTMRHLQEKGVWIVGTAG 178

Query: 179 RGEKDFTEIKWEGKNVLLFGSEGFGMREHTGKYTDFFVKIDINKDVESLNISNSAAI 235
             + +  +   +G   +  G+EG G+R  + +  D  V I ++  V SLN+S +  I
Sbjct: 179 EADCELYQADLKGPLAIAMGAEGKGLRRLSRECCDTLVSIPMSGSVSSLNVSVATGI 235


>RLMB_NEIMB RecName: Full=23S rRNA
           (guanosine-2'-O-)-methyltransferase rlmB;       
           EC=2.1.1.-;AltName: Full=23S rRNA Gm2251
           2'-O-methyltransferase;
          Length = 250

 Score = 97.4 bits (241), Expect = 1e-22
 Identities = 64/231 (27%), Positives = 112/231 (48%), Gaps = 4/231 (1%)

Query: 8   IVGQHAVIEALRNPKRKVLKVFLTEESKKNIHRKNPKKNVLEDVKVYFKSKKELDKYT-- 65
           I G HAV   L    + ++++++ E       R+  +K   E+++VYF     L+  +  
Sbjct: 7   IYGFHAVNARLWQNPKSIVELYIQEGKSDARTREVLEKAANENIRVYFADADRLNAISKG 66

Query: 66  SKDQIMHGGYIAEVEHIDQPDLKEFIKGKNELTFVCIDEVTDPRNIGSLIRSASSFHIDG 125
           ++ Q + G   A   H+   D+ E +     L  + +D +TDP N+G+ +R+A +  +  
Sbjct: 67  ARHQGVVGFIDASKNHVHLEDVLENLSEPPLL--LILDGITDPHNLGACLRTADAMGVHA 124

Query: 126 LIVKERQFPSDSKLMYKAASGCMEHINIFEVSNINSTLKNLREKNFWVYGFDARGEKDFT 185
           +I  + +    +  + K A G  E +    V+N+  TL+ L+E   W+ G D  GE D  
Sbjct: 125 VIAPKDKSAGLNATVSKVACGAAETVPYITVTNLARTLRELKEYGIWIIGTDMSGESDLY 184

Query: 186 EIKWEGKNVLLFGSEGFGMREHTGKYTDFFVKIDINKDVESLNISNSAAIV 236
                     + G+EG GMR  T ++ D  V I +   VES+N+S SA +V
Sbjct: 185 HCNLPDSAAWVMGNEGDGMRRLTREHCDMLVSIPMFGTVESMNVSVSAGMV 235


>RLMB_XYLFA RecName: Full=23S rRNA
           (guanosine-2'-O-)-methyltransferase rlmB;       
           EC=2.1.1.-;AltName: Full=23S rRNA Gm2251
           2'-O-methyltransferase;
          Length = 249

 Score = 97.1 bits (240), Expect = 1e-22
 Identities = 63/240 (26%), Positives = 122/240 (50%), Gaps = 8/240 (3%)

Query: 1   MNKSSFLIVGQHAVIEALRNPKRKVLKVFLTEESKKNIHRKNPKKNVL-EDVKVYFKSKK 59
           MNK +  IVG +AV+ ++ N    V +V L E   KN    + ++N   + ++V   + +
Sbjct: 1   MNKKNQWIVGINAVVSSIENDAEHVCEV-LVEAGSKNSRLLDIEENARRKGIEVRRVTTQ 59

Query: 60  ELDKYTSKDQIMHGGYIAEVEHI---DQPDLKEFIKGKN-ELTFVCIDEVTDPRNIGSLI 115
            LD       + H G  A    +   ++ DLK+ +     +   + +D V DP N+G+ +
Sbjct: 60  ALDGVGGG--VRHQGVAARYAAVRLWEEHDLKDLVDAAGGQALLLVLDGVQDPHNLGACL 117

Query: 116 RSASSFHIDGLIVKERQFPSDSKLMYKAASGCMEHINIFEVSNINSTLKNLREKNFWVYG 175
           RSA++  +  +I+ + +    +  + K +SG  + + +  V N+  +L+ L++++ W+YG
Sbjct: 118 RSAAAAGVTAVIIPKDKSVGINATVRKTSSGAADRLPVIAVVNLARSLRELQKQDVWIYG 177

Query: 176 FDARGEKDFTEIKWEGKNVLLFGSEGFGMREHTGKYTDFFVKIDINKDVESLNISNSAAI 235
            +   E     +   GK  L+ G E  G+R  T ++ D   +I +  +VESLN+S +A +
Sbjct: 178 LEGEAETSLYALDLRGKVALVLGGEADGLRRLTREHCDVLARIPMPGEVESLNVSVAAGV 237


>RLMB_HAEDU RecName: Full=23S rRNA
           (guanosine-2'-O-)-methyltransferase rlmB;       
           EC=2.1.1.-;AltName: Full=23S rRNA Gm2251
           2'-O-methyltransferase;
          Length = 246

 Score = 97.1 bits (240), Expect = 1e-22
 Identities = 65/234 (27%), Positives = 121/234 (51%), Gaps = 10/234 (4%)

Query: 8   IVGQHAVIEALRNPKRKVLKVFLTEESKKNIHRKNPKKNVLE--DVKVYFKSKKELDKYT 65
           I G HAV   L N   ++++VF+ +  +    R NP  + L+   + V   +++ LD   
Sbjct: 5   IYGIHAVNAFLANAPERLIEVFVLKGREDK--RLNPLLDELQRLSISVQQVNRQTLDNKA 62

Query: 66  SKDQIMHGGYIAEV---EHIDQPDLKEFIKGKNELTFVCIDEVTDPRNIGSLIRSASSFH 122
             +  +H G IA +   + +++ DL E ++ K+    + +D VTDP N+G+ +R+A +  
Sbjct: 63  QGE--VHQGIIARIIPQKELNEYDLNELLQHKSNPLLLILDGVTDPHNLGACLRTADAAG 120

Query: 123 IDGLIVKERQFPSDSKLMYKAASGCMEHINIFEVSNINSTLKNLREKN-FWVYGFDARGE 181
           +D +IV + +  + + +  K A G  E + +  V+N+  T++ L++K+  W+ G      
Sbjct: 121 VDAVIVPKDKSATLTAIARKVACGAAEAMPLIRVTNLARTMRELQDKHQIWIVGTAGEAT 180

Query: 182 KDFTEIKWEGKNVLLFGSEGFGMREHTGKYTDFFVKIDINKDVESLNISNSAAI 235
            D    +  G   L+ G+EG GMR  T ++ D  V I +   V SLN+S +  +
Sbjct: 181 TDIYTSQLTGAIALVMGAEGDGMRRLTREHCDQLVSIPMAGSVSSLNVSVATGV 234


>RLMB_SALTY RecName: Full=23S rRNA
           (guanosine-2'-O-)-methyltransferase rlmB;       
           EC=2.1.1.-;AltName: Full=23S rRNA Gm2251
           2'-O-methyltransferase;
          Length = 243

 Score = 96.3 bits (238), Expect = 3e-22
 Identities = 67/236 (28%), Positives = 115/236 (48%), Gaps = 9/236 (3%)

Query: 5   SFLIVGQHAVIEALRNPKRKVLKVFLTEESKKNIHRKNPKKNVLED--VKVYFKSKKELD 62
           S +I G HAV   L     +  +VF+ +  +    R  P  + LE   V +   +++ LD
Sbjct: 2   SEMIYGIHAVQALLERAPERFQEVFILKGREDK--RLLPLIHALESQGVVIQLANRQYLD 59

Query: 63  KYTSKDQIMHGGYIAEVE---HIDQPDLKEFIKGKNELTFVCIDEVTDPRNIGSLIRSAS 119
           +    D  +H G IA V+      + DL + I   +    + +D VTDP N+G+ +RSA 
Sbjct: 60  E--KSDGAVHQGIIARVKPGRQYQENDLPDLIALHDRPFLLILDGVTDPHNLGACLRSAD 117

Query: 120 SFHIDGLIVKERQFPSDSKLMYKAASGCMEHINIFEVSNINSTLKNLREKNFWVYGFDAR 179
           +  +  +IV + +    +    K A G  E + +  V+N+  T++ L+E+N W+ G    
Sbjct: 118 AAGVHAVIVPKDRSAQLNATAKKVACGAAESVPLIRVTNLARTMRMLQEENIWIVGTAGE 177

Query: 180 GEKDFTEIKWEGKNVLLFGSEGFGMREHTGKYTDFFVKIDINKDVESLNISNSAAI 235
            +    + K  G+  L+ G+EG GMR  T ++ D  + I +   V SLN+S +  I
Sbjct: 178 ADHTLYQSKMPGRMALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGI 233


>RLMB_NEIMA RecName: Full=23S rRNA
           (guanosine-2'-O-)-methyltransferase rlmB;       
           EC=2.1.1.-;AltName: Full=23S rRNA Gm2251
           2'-O-methyltransferase;
          Length = 250

 Score = 96.3 bits (238), Expect = 3e-22
 Identities = 64/231 (27%), Positives = 112/231 (48%), Gaps = 4/231 (1%)

Query: 8   IVGQHAVIEALRNPKRKVLKVFLTEESKKNIHRKNPKKNVLEDVKVYFKSKKELDKYT-- 65
           I G HAV   L    + ++++++ E       R+  +K   E+++VYF     L+  +  
Sbjct: 7   IYGFHAVNARLWQNPKSIVELYIQEGKSDARTREVLEKAANENIRVYFADADRLNAISKG 66

Query: 66  SKDQIMHGGYIAEVEHIDQPDLKEFIKGKNELTFVCIDEVTDPRNIGSLIRSASSFHIDG 125
           ++ Q + G   A   H+   D+ E +     L  + +D +TDP N+G+ +R+A +  +  
Sbjct: 67  ARHQGVVGFIDASKNHVHLEDVLENLSEPPLL--LILDGITDPHNLGACLRTADAMGVHA 124

Query: 126 LIVKERQFPSDSKLMYKAASGCMEHINIFEVSNINSTLKNLREKNFWVYGFDARGEKDFT 185
           +I  + +    +  + K ASG  E +    V+N+  TL+ L+E   W+ G D  G  D  
Sbjct: 125 VIAPKDKSAGLNATVSKVASGAAETVPYITVTNLARTLRELKEYGIWIIGTDMGGNADLY 184

Query: 186 EIKWEGKNVLLFGSEGFGMREHTGKYTDFFVKIDINKDVESLNISNSAAIV 236
                     + G+EG GMR  T ++ D  V I +   VES+N+S SA +V
Sbjct: 185 HCDLPDSAAWVMGNEGDGMRRLTREHCDMLVSIPMFGTVESMNVSVSAGMV 235


>RLMB_SALTI RecName: Full=23S rRNA
           (guanosine-2'-O-)-methyltransferase rlmB;       
           EC=2.1.1.-;AltName: Full=23S rRNA Gm2251
           2'-O-methyltransferase;
          Length = 243

 Score = 94.7 bits (234), Expect = 7e-22
 Identities = 66/236 (27%), Positives = 114/236 (48%), Gaps = 9/236 (3%)

Query: 5   SFLIVGQHAVIEALRNPKRKVLKVFLTEESKKNIHRKNPKKNVLED--VKVYFKSKKELD 62
           S +I G HAV   L     +  + F+ +  +    R  P  + LE   V +   +++ LD
Sbjct: 2   SEMIYGIHAVQALLERAPERFQEAFILKGREDK--RLLPLIHALESQGVVIQLANRQYLD 59

Query: 63  KYTSKDQIMHGGYIAEVE---HIDQPDLKEFIKGKNELTFVCIDEVTDPRNIGSLIRSAS 119
           +    D  +H G IA V+      + DL + I   +    + +D VTDP N+G+ +RSA 
Sbjct: 60  E--KSDGAVHQGIIARVKPGRQYQENDLPDLIALHDRPFLLILDGVTDPHNLGACLRSAD 117

Query: 120 SFHIDGLIVKERQFPSDSKLMYKAASGCMEHINIFEVSNINSTLKNLREKNFWVYGFDAR 179
           +  +  +IV + +    +    K A G  E + +  V+N+  T++ L+E+N W+ G    
Sbjct: 118 AAGVHAVIVPKDRSAQLNATAKKVACGAAESVPLIRVTNLARTMRMLQEENIWIVGTAGE 177

Query: 180 GEKDFTEIKWEGKNVLLFGSEGFGMREHTGKYTDFFVKIDINKDVESLNISNSAAI 235
            +    + K  G+  L+ G+EG GMR  T ++ D  + I +   V SLN+S +  I
Sbjct: 178 ADHTLYQSKMPGRMALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGI 233


>RLMB_YERPE RecName: Full=23S rRNA
           (guanosine-2'-O-)-methyltransferase rlmB;       
           EC=2.1.1.-;AltName: Full=23S rRNA Gm2251
           2'-O-methyltransferase;
          Length = 246

 Score = 94.4 bits (233), Expect = 1e-21
 Identities = 66/236 (27%), Positives = 114/236 (48%), Gaps = 9/236 (3%)

Query: 5   SFLIVGQHAVIEALRNPKRKVLKVFLTEESKKNIHRKNPKKNVLE--DVKVYFKSKKELD 62
           S +I G HAV   L    ++ L+VF+ +   ++  R  P    LE   + +   S++ LD
Sbjct: 2   SEIIYGIHAVKALLERDPQRFLEVFILKG--RDDRRLQPLIAELEAAGLVIQVASRQWLD 59

Query: 63  KYTSKDQIMHGGYIAEVEH---IDQPDLKEFIKGKNELTFVCIDEVTDPRNIGSLIRSAS 119
                   +H G +A V       + DL   ++       + +D VTDP N+G+ +RSA 
Sbjct: 60  SQVEGG--VHQGIVARVREGRQYQENDLPALLESVETPFLLVLDGVTDPHNLGACLRSAD 117

Query: 120 SFHIDGLIVKERQFPSDSKLMYKAASGCMEHINIFEVSNINSTLKNLREKNFWVYGFDAR 179
           +  +  +IV   +    + +  K ASG  E++ + +V+N+  TL+ L+E N W+ G    
Sbjct: 118 AAGVHAVIVPRDRSAQLNAIAKKVASGAAENVPLIKVTNLARTLRVLQEHNVWIVGTAGE 177

Query: 180 GEKDFTEIKWEGKNVLLFGSEGFGMREHTGKYTDFFVKIDINKDVESLNISNSAAI 235
            +    + K  G   L+ G+EG GMR  T ++ D  + I +   V SLN+S +  +
Sbjct: 178 ADHTLYQSKMTGPMALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGV 233


>RLMB_PASMU RecName: Full=23S rRNA
           (guanosine-2'-O-)-methyltransferase rlmB;       
           EC=2.1.1.-;AltName: Full=23S rRNA Gm2251
           2'-O-methyltransferase;
          Length = 245

 Score = 94.0 bits (232), Expect = 1e-21
 Identities = 63/234 (26%), Positives = 118/234 (50%), Gaps = 10/234 (4%)

Query: 8   IVGQHAVIEALRNPKRKVLKVFLTEESKKNIHRKNPKKNVLE--DVKVYFKSKKELDKYT 65
           I G HAV   L N   ++++V+  +   ++  R  P  N L    + + F +++ LDK  
Sbjct: 5   IYGIHAVSAFLNNAPERLIEVYALKG--RDDKRLQPLLNELHRLGITIQFVNRQTLDKKA 62

Query: 66  SKDQIMHGGYIAEVE---HIDQPDLKEFIKGKNELTFVCIDEVTDPRNIGSLIRSASSFH 122
             +  +H G +A V+    +++ DL   ++ ++    + +D VTDP N+G+ +R+A +  
Sbjct: 63  EGE--VHQGIMARVQPAKELNEADLDTLLQNQSNPLLLVLDGVTDPHNLGACLRTADAAG 120

Query: 123 IDGLIVKERQFPSDSKLMYKAASGCMEHINIFEVSNINSTLKNLREK-NFWVYGFDARGE 181
           +  +IV + +    + +  K A G  E + +  V+N+  TL+ L++K N WV G      
Sbjct: 121 VCAVIVPKDKSAQLTAIARKVACGAAEVVPLIRVTNLARTLRELQQKHNIWVVGTAGEAT 180

Query: 182 KDFTEIKWEGKNVLLFGSEGFGMREHTGKYTDFFVKIDINKDVESLNISNSAAI 235
               + +  G   L+ G+EG GMR  T ++ D  + I +   V SLN+S +  +
Sbjct: 181 NTLYQTQLTGGLALVMGAEGEGMRRLTREHCDQLISIPMAGSVSSLNVSVATGV 234


>RLMB_ERWCT RecName: Full=23S rRNA
           (guanosine-2'-O-)-methyltransferase rlmB;       
           EC=2.1.1.-;AltName: Full=23S rRNA Gm2251
           2'-O-methyltransferase;
          Length = 244

 Score = 93.6 bits (231), Expect = 2e-21
 Identities = 65/236 (27%), Positives = 114/236 (48%), Gaps = 9/236 (3%)

Query: 5   SFLIVGQHAVIEALRNPKRKVLKVFLTEESKKNIHRKNPKKNVLE--DVKVYFKSKKELD 62
           S +I G HAV   L    ++ L+VF+ +   ++  R  P    LE   + +   S++ LD
Sbjct: 2   SEIIYGIHAVKALLERDPQRFLEVFILKG--RDDRRLQPVIAELEAQGIVIQVASRQWLD 59

Query: 63  KYTSKDQIMHGGYIAEVEH---IDQPDLKEFIKGKNELTFVCIDEVTDPRNIGSLIRSAS 119
           K    +  +H G +A+V+      + DL   +        + +D VTDP N+G+ +R+A 
Sbjct: 60  KQA--EDAVHQGIVAKVKEGRKYQENDLPAMLDNLEMPFLLILDGVTDPHNLGACLRNAD 117

Query: 120 SFHIDGLIVKERQFPSDSKLMYKAASGCMEHINIFEVSNINSTLKNLREKNFWVYGFDAR 179
              +  +IV   +    +  + K A G  E I +  V+N+  T++ L+E+N W+ G    
Sbjct: 118 GAGVHAVIVPRDRSAQLNATVKKVACGAAETIPVISVTNLARTMRLLQERNIWIVGTAGE 177

Query: 180 GEKDFTEIKWEGKNVLLFGSEGFGMREHTGKYTDFFVKIDINKDVESLNISNSAAI 235
            +    + K  G   L+ G+EG GMR  T ++ D  + I +   V SLN+S +  +
Sbjct: 178 ADHTLYQSKLTGPLALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGV 233


>RLMB_PHOLL RecName: Full=23S rRNA
           (guanosine-2'-O-)-methyltransferase rlmB;       
           EC=2.1.1.-;AltName: Full=23S rRNA Gm2251
           2'-O-methyltransferase;
          Length = 244

 Score = 92.8 bits (229), Expect = 3e-21
 Identities = 64/236 (27%), Positives = 114/236 (48%), Gaps = 9/236 (3%)

Query: 5   SFLIVGQHAVIEALRNPKRKVLKVFLTEESKKNIHRKNPKKNVLEDV--KVYFKSKKELD 62
           S +I G HAV   L    ++ ++V++ +  +    R  P  + LE +   +   +++ LD
Sbjct: 2   SEIIYGIHAVKALLERDPQRFIEVYVLKGREDR--RLTPLIHALESIGMTIQLANRQWLD 59

Query: 63  KYTSKDQIMHGGYIAEVE---HIDQPDLKEFIKGKNELTFVCIDEVTDPRNIGSLIRSAS 119
             T  +  +H G IA+V+      + DL + +        + +D VTDP N+G+ +RSA 
Sbjct: 60  NQT--EGAVHQGIIAKVKPGRQYQENDLPDLLAQVETPFLLVLDGVTDPHNLGACLRSAD 117

Query: 120 SFHIDGLIVKERQFPSDSKLMYKAASGCMEHINIFEVSNINSTLKNLREKNFWVYGFDAR 179
           +  +  +I+   +    +    K A G  E + +  V+N+  TL+ L+E N WV G    
Sbjct: 118 AAGVHAVIIPRDRSAQLNATAKKVACGAAESVPLIRVTNLARTLRLLQEYNIWVVGTAGE 177

Query: 180 GEKDFTEIKWEGKNVLLFGSEGFGMREHTGKYTDFFVKIDINKDVESLNISNSAAI 235
            +    + K  G   L+ G+EG GMR  T ++ D  + I +   V SLN+S +  +
Sbjct: 178 ADHTLYQSKLTGPMALVMGAEGEGMRRLTREHCDELISIPMVGSVSSLNVSVATGV 233


>RLMB_XYLFT RecName: Full=23S rRNA
           (guanosine-2'-O-)-methyltransferase rlmB;       
           EC=2.1.1.-;AltName: Full=23S rRNA Gm2251
           2'-O-methyltransferase;
          Length = 249

 Score = 92.4 bits (228), Expect = 4e-21
 Identities = 62/240 (25%), Positives = 121/240 (50%), Gaps = 8/240 (3%)

Query: 1   MNKSSFLIVGQHAVIEALRNPKRKVLKVFLTEESKKNIHRKNPKKNVL-EDVKVYFKSKK 59
           MNK +  IVG +AV+ ++ N    V +V L E + KN    + ++N   + ++V   + +
Sbjct: 1   MNKKNQWIVGINAVVSSIENDAEHVREV-LVEAASKNSRLLDIEENARRKGIEVRRVTTQ 59

Query: 60  ELDKYTSKDQIMHGGYIAEVEHI---DQPDLKEFIKGKN-ELTFVCIDEVTDPRNIGSLI 115
            LD       + H G  A    +   ++ DLK+ +     +   + +D V DP N+G+ +
Sbjct: 60  ALDGVGGG--VRHQGVAARYAAVRLWEEHDLKDLVDAAGGQALLLVLDGVQDPHNLGACL 117

Query: 116 RSASSFHIDGLIVKERQFPSDSKLMYKAASGCMEHINIFEVSNINSTLKNLREKNFWVYG 175
           RSA++  +  +I+ + +    +  + K +SG  + + +  V N+  +L+ L++++ W+YG
Sbjct: 118 RSAAAAGVTAVIIPKDKSVGINATVRKTSSGAADRLPVIAVVNLARSLRELQKQDVWIYG 177

Query: 176 FDARGEKDFTEIKWEGKNVLLFGSEGFGMREHTGKYTDFFVKIDINKDVESLNISNSAAI 235
                E     +   G   L+ G E  G+R  T ++ D   +I +  +VESLN+S +A +
Sbjct: 178 LAGEVETSLYALDLRGNVALVLGGEADGLRRLTREHCDVLARIPMPGEVESLNVSVAAGV 237


>RLMB_VIBPA RecName: Full=23S rRNA
           (guanosine-2'-O-)-methyltransferase rlmB;       
           EC=2.1.1.-;AltName: Full=23S rRNA Gm2251
           2'-O-methyltransferase;
          Length = 247

 Score = 91.3 bits (225), Expect = 8e-21
 Identities = 65/239 (27%), Positives = 120/239 (50%), Gaps = 13/239 (5%)

Query: 4   SSFLIVGQHAVIEALRNPKRKVLKVFLTEESKKNIHRKNPKKNVLEDVKVYFKSKKELDK 63
           S+  I G HAV   L     + ++ ++ +  + +  R  P   +L D++V   S +++ +
Sbjct: 2   SNEFIYGIHAVKAVLEREPERFIEAYVLKGRQDD--RLMP---ILNDLQVCGVSIQQMTR 56

Query: 64  YTSKDQIM---HGGYIAEVE---HIDQPDLKEFIKGKNELTFVCIDEVTDPRNIGSLIRS 117
            T  D+     H G IA V+    +++ D+ + +        + +D VTDP N+G+ +R+
Sbjct: 57  KTLDDKAHGANHQGIIARVKVAKQLNENDIDDILAQHETPLLLVLDGVTDPHNLGACLRN 116

Query: 118 ASSFHIDGLIV-KERQFPSDSKLMYKAASGCMEHINIFEVSNINSTLKNLREKNFWVYGF 176
           A +  +  +IV K+R  P ++ +  K A G  E + +  V+N+  T++ L+E+  W  G 
Sbjct: 117 ADAAGVAAIIVPKDRSAPMNATVS-KVACGAAEVVPLIRVTNLARTMRTLQEQGIWFVGT 175

Query: 177 DARGEKDFTEIKWEGKNVLLFGSEGFGMREHTGKYTDFFVKIDINKDVESLNISNSAAI 235
                 D  + K  G   ++ G+EG GMR  T +  D  +KI +   V SLN+S ++ I
Sbjct: 176 AGEATHDIYQAKLTGPLAIVMGAEGDGMRRLTRETCDDLIKIPMAGSVSSLNVSVASGI 234


>RLMB_PHOPR RecName: Full=23S rRNA
           (guanosine-2'-O-)-methyltransferase rlmB;       
           EC=2.1.1.-;AltName: Full=23S rRNA Gm2251
           2'-O-methyltransferase;
          Length = 245

 Score = 91.3 bits (225), Expect = 8e-21
 Identities = 64/237 (27%), Positives = 114/237 (48%), Gaps = 9/237 (3%)

Query: 4   SSFLIVGQHAVIEALRNPKRKVLKVFLTEESKKNIHRKNPKKNVLED--VKVYFKSKKEL 61
           S+ +I G HAV   L     ++++VF+ ++ + +  R  P    L+D  + +    +K L
Sbjct: 2   SNDMIFGIHAVKAVLATDPVRLIEVFVLKDRQDD--RLMPLLTELKDLGITIQHAGRKAL 59

Query: 62  DKYTSKDQIMHGGYIAEVE---HIDQPDLKEFIKGKNELTFVCIDEVTDPRNIGSLIRSA 118
           D         H G IA V+    +++ DL   ++G      + +D VTDP N+G+ +R+A
Sbjct: 60  DDKAKGAS--HQGIIARVKPAKQLNEHDLDTILEGSENPLLLILDGVTDPHNLGACLRNA 117

Query: 119 SSFHIDGLIVKERQFPSDSKLMYKAASGCMEHINIFEVSNINSTLKNLREKNFWVYGFDA 178
            +     +I+ + +    +    K A G  E + +  V+N+  T++ L++K  W+ G   
Sbjct: 118 DAAGAVAVIIPKDRAAQLTATASKVACGAAEVMPLVRVTNLARTMRALQDKGVWIVGTAG 177

Query: 179 RGEKDFTEIKWEGKNVLLFGSEGFGMREHTGKYTDFFVKIDINKDVESLNISNSAAI 235
               D    K  G   ++ G+EG GMR  T +  D  +KI +   V SLN+S +  I
Sbjct: 178 EATHDIYHSKLTGPLAIVMGAEGEGMRRLTRETCDDLIKIPMAGSVSSLNVSVATGI 234


>RLMB_VIBCH RecName: Full=23S rRNA
           (guanosine-2'-O-)-methyltransferase rlmB;       
           EC=2.1.1.-;AltName: Full=23S rRNA Gm2251
           2'-O-methyltransferase;
          Length = 247

 Score = 90.5 bits (223), Expect = 1e-20
 Identities = 65/237 (27%), Positives = 115/237 (48%), Gaps = 9/237 (3%)

Query: 4   SSFLIVGQHAVIEALRNPKRKVLKVFLTEESKKNIHRKNPKKNVLE--DVKVYFKSKKEL 61
           S+ LI G HAV   L+    + ++ ++ +  + +  R  P  N L    V +   S+K L
Sbjct: 2   SNELIYGIHAVNAVLQRDPARFVEAYVLKGRQDD--RLLPVLNELMRLGVSIQEMSRKAL 59

Query: 62  DKYTSKDQIMHGGYIAEVE---HIDQPDLKEFIKGKNELTFVCIDEVTDPRNIGSLIRSA 118
           D     +   H G IA V+    +++ DL + +    +   + +D VTDP N+G+ +R+A
Sbjct: 60  DD--KAEGANHQGLIARVKPARQLNENDLDDILAQHEQPLLLVLDGVTDPHNLGACLRNA 117

Query: 119 SSFHIDGLIVKERQFPSDSKLMYKAASGCMEHINIFEVSNINSTLKNLREKNFWVYGFDA 178
            +  +  +IV + +    +  + K A G  E + +  V+N+  T++ L+EK  W  G   
Sbjct: 118 DAAGVAAVIVPKDKSAPLTATVSKVACGAAETVPLVRVTNLARTMRALQEKGVWFVGTAG 177

Query: 179 RGEKDFTEIKWEGKNVLLFGSEGFGMREHTGKYTDFFVKIDINKDVESLNISNSAAI 235
               D  + K  G   ++ G+EG GMR  T +  D  +KI +   V SLN+S +  +
Sbjct: 178 EATHDIYQSKLTGSLAIVMGAEGDGMRRLTRETCDDLIKIPMAGSVSSLNVSVACGV 234


>RLMB_VIBVY RecName: Full=23S rRNA
           (guanosine-2'-O-)-methyltransferase rlmB;       
           EC=2.1.1.-;AltName: Full=23S rRNA Gm2251
           2'-O-methyltransferase;
          Length = 247

 Score = 89.7 bits (221), Expect = 2e-20
 Identities = 64/238 (26%), Positives = 118/238 (49%), Gaps = 11/238 (4%)

Query: 4   SSFLIVGQHAVIEALRNPKRKVLKVFLTEESKKNIHRKNPKKNVLEDVKVYFKSKKELDK 63
           S+  I G HAV   L     + ++ ++ +  + +  R  P  N L+ V V   S +++ +
Sbjct: 2   SNEFIYGIHAVRAVLDKEPERFIEAYVLKGRQDD--RLMPILNELQMVGV---SLQQMTR 56

Query: 64  YTSKDQIM---HGGYIAEVE---HIDQPDLKEFIKGKNELTFVCIDEVTDPRNIGSLIRS 117
            T  D+     H G IA V+    +++ DL + +        + +D VTDP N+G+ +R+
Sbjct: 57  KTLDDKAHGANHQGIIARVKPAKQLNENDLDDILAKHASPLLLILDGVTDPHNLGACLRN 116

Query: 118 ASSFHIDGLIVKERQFPSDSKLMYKAASGCMEHINIFEVSNINSTLKNLREKNFWVYGFD 177
           A +  +  +IV + +    +  + K A G  E + +  V+N+  T+++L+E+  W+ G  
Sbjct: 117 ADAAGVAAVIVPKDKSAPMTATVSKVACGAAETVPLVRVTNLARTMRHLQEQGIWIVGTA 176

Query: 178 ARGEKDFTEIKWEGKNVLLFGSEGFGMREHTGKYTDFFVKIDINKDVESLNISNSAAI 235
                D  + K  G   ++ G+EG GMR  T +  D  +KI +   V SLN+S ++ I
Sbjct: 177 GEATHDIYQAKLTGSLAIVMGAEGDGMRRLTRETCDDLIKIPMAGAVSSLNVSVASGI 234


>RLMB_VIBVU RecName: Full=23S rRNA
           (guanosine-2'-O-)-methyltransferase rlmB;       
           EC=2.1.1.-;AltName: Full=23S rRNA Gm2251
           2'-O-methyltransferase;
          Length = 247

 Score = 89.7 bits (221), Expect = 2e-20
 Identities = 64/238 (26%), Positives = 118/238 (49%), Gaps = 11/238 (4%)

Query: 4   SSFLIVGQHAVIEALRNPKRKVLKVFLTEESKKNIHRKNPKKNVLEDVKVYFKSKKELDK 63
           S+  I G HAV   L     + ++ ++ +  + +  R  P  N L+ V V   S +++ +
Sbjct: 2   SNEFIYGIHAVRAVLDKEPERFIEAYVLKGRQDD--RLMPILNELQMVGV---SLQQMTR 56

Query: 64  YTSKDQIM---HGGYIAEVE---HIDQPDLKEFIKGKNELTFVCIDEVTDPRNIGSLIRS 117
            T  D+     H G IA V+    +++ DL + +        + +D VTDP N+G+ +R+
Sbjct: 57  KTLDDKAHGANHQGIIARVKPAKQLNENDLDDILAKHASPLLLILDGVTDPHNLGACLRN 116

Query: 118 ASSFHIDGLIVKERQFPSDSKLMYKAASGCMEHINIFEVSNINSTLKNLREKNFWVYGFD 177
           A +  +  +IV + +    +  + K A G  E + +  V+N+  T+++L+E+  W+ G  
Sbjct: 117 ADAAGVAAVIVPKDKSAPMTATVSKVACGAAETVPLVRVTNLARTMRHLQEQGIWIVGTA 176

Query: 178 ARGEKDFTEIKWEGKNVLLFGSEGFGMREHTGKYTDFFVKIDINKDVESLNISNSAAI 235
                D  + K  G   ++ G+EG GMR  T +  D  +KI +   V SLN+S ++ I
Sbjct: 177 GEATHDIYQAKLTGSLAIVMGAEGDGMRRLTRETCDDLIKIPMAGAVSSLNVSVASGI 234


>RLMB_PSEPK RecName: Full=23S rRNA
           (guanosine-2'-O-)-methyltransferase rlmB;       
           EC=2.1.1.-;AltName: Full=23S rRNA Gm2251
           2'-O-methyltransferase;
          Length = 248

 Score = 88.6 bits (218), Expect = 5e-20
 Identities = 64/238 (26%), Positives = 113/238 (47%), Gaps = 19/238 (7%)

Query: 8   IVGQHAVIEALRNPKRKVLKVFLTEESKKNIHRKNPKKNVL------EDVKVYFKSKKEL 61
           I G HAV   L++  ++V +++L+E       R  P+   L        V V    ++E+
Sbjct: 7   IYGVHAVQALLQHHPKRVKQIWLSEG------RSEPRLETLLALAAENRVPVGQAERREM 60

Query: 62  DKYTSKDQIMHGGYIAEVEHID----QPDLKEFIKGKNELTFVCIDEVTDPRNIGSLIRS 117
           D +      +H G +AEV                        + +D VTDP N+G+ +R+
Sbjct: 61  DAWVEG---VHQGVVAEVSPSQVWGXXXXXXXXXXXXXXXXILVLDGVTDPHNLGACLRT 117

Query: 118 ASSFHIDGLIVKERQFPSDSKLMYKAASGCMEHINIFEVSNINSTLKNLREKNFWVYGFD 177
           A +     +IV + +  + + ++ K A G  E I +  V+N+  TL+ L+++  WV G  
Sbjct: 118 ADAAGATAVIVPKDKSATLTPVVRKVACGAAEVIPLVAVTNLARTLEKLQQRGLWVVGTA 177

Query: 178 ARGEKDFTEIKWEGKNVLLFGSEGFGMREHTGKYTDFFVKIDINKDVESLNISNSAAI 235
              E++  +    G  V++ G+EG GMR  T ++ DF VK+ +   V SLN+S +  +
Sbjct: 178 GEAEQEIYQQDLTGPLVMIMGAEGKGMRRLTREHCDFLVKLPMAGSVSSLNVSVATGV 235


>RLMB_CHRVO RecName: Full=23S rRNA
           (guanosine-2'-O-)-methyltransferase rlmB;       
           EC=2.1.1.-;AltName: Full=23S rRNA Gm2251
           2'-O-methyltransferase;
          Length = 248

 Score = 87.8 bits (216), Expect = 9e-20
 Identities = 62/232 (26%), Positives = 113/232 (48%), Gaps = 4/232 (1%)

Query: 7   LIVGQHAVIEALRNPKRKVLKVFLTEESKKNIHRKNPKKNVLEDVKVYFKSKKELDKYTS 66
           LI G HA+   L    + +++++L         +    K   E+VK++   K+ LD  + 
Sbjct: 6   LIHGFHAINARLWQNPKSLIEIWLAGGRHDARAKAVLDKAGAENVKLHIVDKERLDSMSG 65

Query: 67  KDQIMHGGYIAEVE-HIDQPDLKEFIKGKNELTFVCI-DEVTDPRNIGSLIRSASSFHID 124
             +  H G +A ++  ++  DL + ++  +E   + I D VTDP N+G+ +R A +    
Sbjct: 66  NAR--HQGVVAMIDASMNYVDLDDVLENLSEPPLLLILDGVTDPHNLGACLRVADAMGAH 123

Query: 125 GLIVKERQFPSDSKLMYKAASGCMEHINIFEVSNINSTLKNLREKNFWVYGFDARGEKDF 184
            +I  + +  + +  + K A G  E +    V+N+  TL++L++   W+ G     + D 
Sbjct: 124 AVIAPKDRSATLNATVSKVACGAAEVVPYITVTNLARTLRDLKDAGVWIAGTTMEADTDL 183

Query: 185 TEIKWEGKNVLLFGSEGFGMREHTGKYTDFFVKIDINKDVESLNISNSAAIV 236
                 G    + G+EG GMR  T ++ D  V I +   VESLN+S S+ +V
Sbjct: 184 YHFDASGPLAWVMGAEGEGMRRLTREHCDVLVSIPMFGTVESLNVSVSSGMV 235


>RLMB_PSESM RecName: Full=23S rRNA
           (guanosine-2'-O-)-methyltransferase rlmB;       
           EC=2.1.1.-;AltName: Full=23S rRNA Gm2251
           2'-O-methyltransferase;
          Length = 250

 Score = 87.0 bits (214), Expect = 2e-19
 Identities = 62/238 (26%), Positives = 116/238 (48%), Gaps = 19/238 (7%)

Query: 8   IVGQHAVIEALRNPKRKVLKVFLTEESKKNIHRKNPKKNVL------EDVKVYFKSKKEL 61
           I G HAV   LR+  ++V  ++L E       R +P+   L        V +    ++E+
Sbjct: 7   IYGVHAVEALLRHHPKRVKHIWLAEG------RNDPRVQTLVALASENRVTIGQAERREM 60

Query: 62  DKYTSKDQIMHGGYIAEVEHID---QPDLKEFI-KGKNELTFVCIDEVTDPRNIGSLIRS 117
           D +      +H G +A+V       +  L E + + +     + +D VTDP N+G+ +R+
Sbjct: 61  DAWVEG---VHQGVVADVSPSQVWGEAMLDELLDRSEGPPLLLVLDGVTDPHNLGACLRT 117

Query: 118 ASSFHIDGLIVKERQFPSDSKLMYKAASGCMEHINIFEVSNINSTLKNLREKNFWVYGFD 177
           A +     +IV + +  + +  + K A G  E I +  V+N+  TL+ L+++  WV G  
Sbjct: 118 ADAAGALAVIVPKDKSATLTPAVRKVACGAAEVIPLVAVTNLARTLEKLQQRGLWVVGTA 177

Query: 178 ARGEKDFTEIKWEGKNVLLFGSEGFGMREHTGKYTDFFVKIDINKDVESLNISNSAAI 235
              E +  +    G  +++ G+EG GMR  T ++ D+ V++ +   V SLN+S +  +
Sbjct: 178 GEAEVELYQQDLTGPTIIIMGAEGKGMRRLTREHCDYLVRLPMAGSVSSLNVSVATGV 235


>RLMB_XANAC RecName: Full=23S rRNA
           (guanosine-2'-O-)-methyltransferase rlmB;       
           EC=2.1.1.-;AltName: Full=23S rRNA Gm2251
           2'-O-methyltransferase;
          Length = 249

 Score = 81.6 bits (200), Expect = 7e-18
 Identities = 59/247 (23%), Positives = 114/247 (46%), Gaps = 22/247 (8%)

Query: 1   MNKSSFLIVGQHAVIEALRNPKRKVLKVFLTEESKKNIHRKNPKKNVLEDVKVYFKSKKE 60
           M+K +  IVG +AV  ++ N    V +V +   SK      NP+   +E+       +K 
Sbjct: 1   MSKQNQWIVGVNAVASSVENDADNVREVLIEAGSK------NPRLTEIEEQA----RRKG 50

Query: 61  LDKYTSKDQIMHG-GYIAEVEHIDQPDLKEFIKGKNELT-----------FVCIDEVTDP 108
           +D      Q + G G     + +           +NEL             + +D V DP
Sbjct: 51  IDVRRVNTQALDGVGGQVRHQGVXXXXXXXXXXXENELEGLVEAAAGRALVLILDGVQDP 110

Query: 109 RNIGSLIRSASSFHIDGLIVKERQFPSDSKLMYKAASGCMEHINIFEVSNINSTLKNLRE 168
            N+G+ +RSA++  +  +++ + +  + +  + K ++G  + I +  V+N+   L++L++
Sbjct: 111 HNLGACLRSAAAAGVTAVVIPKDKSATVNATVRKTSAGAADRIPVVAVTNLARCLRDLQK 170

Query: 169 KNFWVYGFDARGEKDFTEIKWEGKNVLLFGSEGFGMREHTGKYTDFFVKIDINKDVESLN 228
           +  W+YG     E     +   G   L+ G E  G+R  T ++ D  VKI +  ++ESLN
Sbjct: 171 QGVWLYGLAGEAEASLYSVDLRGNVGLVLGGEADGLRRLTREHCDGLVKIPMPGEIESLN 230

Query: 229 ISNSAAI 235
           +S +  +
Sbjct: 231 VSVATGV 237


>RLMB_BLOFL RecName: Full=23S rRNA
           (guanosine-2'-O-)-methyltransferase rlmB;       
           EC=2.1.1.-;AltName: Full=23S rRNA Gm2251
           2'-O-methyltransferase;
          Length = 254

 Score = 79.3 bits (194), Expect = 3e-17
 Identities = 66/229 (28%), Positives = 105/229 (45%), Gaps = 24/229 (10%)

Query: 14  VIEALRNPKRKVLKVFLTEESKKNIHRKNPKKNVLEDVKVYFKSKKELDKYTSKDQIMHG 73
           ++  + NP+   LK  +    K NI+ +   + VL       KS K            H 
Sbjct: 24  IVYIVSNPRDLRLKSLIYRIRKMNINIQECTRRVLN-----IKSMKSA----------HQ 68

Query: 74  GYIAEVEHIDQPDLKE-----FIKGKNELT--FVCIDEVTDPRNIGSLIRSASSFHIDGL 126
           G IAEV  I  P L E     F+K KN +    + +D +TDP N+G+ IRSA +  +  +
Sbjct: 69  GIIAEV--IPMPALNEDYLLHFLKTKNNIIPLLLVLDGITDPHNLGACIRSADAAGVHMI 126

Query: 127 IVKERQFPSDSKLMYKAASGCMEHINIFEVSNINSTLKNLREKNFWVYGFDARGEKDFTE 186
           IV   +  + +  + K ASG  + +    V+N++ TLK L++ N ++ G   R  +    
Sbjct: 127 IVPRDRSANVNATVRKVASGSSDRVPFVRVTNLSRTLKLLKKYNIYIVGSVLRSNQILFN 186

Query: 187 IKWEGKNVLLFGSEGFGMREHTGKYTDFFVKIDINKDVESLNISNSAAI 235
            +      L+ GSE  G+R  T +  D  V I   +   SLN+S +  I
Sbjct: 187 TRLIDPIALVMGSESSGIRRLTRENCDKLVHIPTLQSTVSLNVSVATGI 235


>Y479_MYCPA RecName: Full=Uncharacterized tRNA/rRNA
           methyltransferase MAP_0479;         EC=2.1.1.-;
          Length = 309

 Score = 79.0 bits (193), Expect = 4e-17
 Identities = 57/238 (23%), Positives = 112/238 (47%), Gaps = 7/238 (2%)

Query: 8   IVGQHAVIEALR-NPKRKVLKVFLTEESKKNIHRKNPKKNVLEDVKVYFKSKKELDKYTS 66
           ++G++ V+E LR       L V L  E+ + +  ++  +     + +    + +LD+ T 
Sbjct: 70  VLGRNPVLECLRAGVPATALYVALGTEADERL-TESVSRAADSGISILEVPRADLDRMTG 128

Query: 67  KDQIMHGGYIAEVE---HIDQPDLKEFIKGKNELTFVCIDEVTDPRNIGSLIRSASSFHI 123
               +H G   +V    +    DL E   G      V +D ++DPRN+G+++RS ++F  
Sbjct: 129 NH--LHQGIALQVPPYIYAHPDDLLEAAAGSLPALLVALDNISDPRNLGAIVRSVAAFGG 186

Query: 124 DGLIVKERQFPSDSKLMYKAASGCMEHINIFEVSNINSTLKNLREKNFWVYGFDARGEKD 183
            G+++ +R+  S + + ++ +            +N+  TL++  ++   V G DA G+  
Sbjct: 187 HGVLIPQRRSASVTAVAWRTSXXXXXXXXXXXXTNLTRTLQDWADRGLRVIGLDAGGDTM 246

Query: 184 FTEIKWEGKNVLLFGSEGFGMREHTGKYTDFFVKIDINKDVESLNISNSAAIVFHHLS 241
             ++      V++ GSEG G+     +  D  V I +    ESLN S +A +V   +S
Sbjct: 247 LDDLDGSDPLVVVVGSEGKGLSRLVRQNCDEVVSIPMAGSAESLNASVAAGVVLAEIS 304


>Y572_MYCA9 RecName: Full=Uncharacterized tRNA/rRNA
           methyltransferase MAB_0572;         EC=2.1.1.-;
          Length = 315

 Score = 78.6 bits (192), Expect = 6e-17
 Identities = 40/142 (28%), Positives = 77/142 (54%)

Query: 100 VCIDEVTDPRNIGSLIRSASSFHIDGLIVKERQFPSDSKLMYKAASGCMEHINIFEVSNI 159
           V +D ++DPRN+G+++RS ++F   G+++ +R+  S + + ++ +            +N+
Sbjct: 170 VALDNISDPRNLGAIVRSVAAFGGHGVVIPQRRSASVTAVAWRTSXXXXXXXXXXXXTNL 229

Query: 160 NSTLKNLREKNFWVYGFDARGEKDFTEIKWEGKNVLLFGSEGFGMREHTGKYTDFFVKID 219
             TLK+ ++K   + G DA G+ +   +   G   ++ GSEG G+ +   K  D  V I 
Sbjct: 230 TRTLKDWQDKGITIVGLDAGGDTELDNLDGVGDIAVVVGSEGKGLSQLVRKTCDAVVSIP 289

Query: 220 INKDVESLNISNSAAIVFHHLS 241
           +   VESLN S +A +V   ++
Sbjct: 290 MAGPVESLNASVAAGVVLAEIA 311


>RLMB_BORPE RecName: Full=23S rRNA
           (guanosine-2'-O-)-methyltransferase rlmB;       
           EC=2.1.1.-;AltName: Full=23S rRNA Gm2251
           2'-O-methyltransferase;
          Length = 245

 Score = 78.2 bits (191), Expect = 7e-17
 Identities = 54/239 (22%), Positives = 116/239 (48%), Gaps = 8/239 (3%)

Query: 4   SSFLIVGQHAVIEALRNPKRKVLKVFLTEESKKNIHRKNPKKNVLEDVKVYFKSKKELDK 63
           S+ ++ G HAV+  LR+    + ++++    +    +   ++      +V+  + + LD 
Sbjct: 3   STQVLAGFHAVVARLRHAPESIKEIYVEASRRDKRMQTFLEQAERAGRRVHPVAAERLDG 62

Query: 64  YTSKDQIMHGGYIAEVEH----IDQPDLKEFIKGKNELTFVCIDEVTDPRNIGSLIRSAS 119
                +  H G +A  E     +   ++ + I+G   L  + +D VTDP N+G+ +R+A 
Sbjct: 63  LARGTR--HQGVVAVAEERSLAVGIDEVLDVIEGPALL--LILDGVTDPHNLGACLRTAD 118

Query: 120 SFHIDGLIVKERQFPSDSKLMYKAASGCMEHINIFEVSNINSTLKNLREKNFWVYGFDAR 179
           +  +  +I    +    +  + + A G  + +    V+N+  T++ L+E++ W+ G D +
Sbjct: 119 AAGVHAVIAPRDRAVGLNATVQRVACGAADTVPYLTVTNLARTMRELKERDVWLVGTDDQ 178

Query: 180 GEKDFTEIKWEGKNVLLFGSEGFGMREHTGKYTDFFVKIDINKDVESLNISNSAAIVFH 238
             +   ++        + G+EG GMR  T +  D  V+I +   VESLN+S ++A+  +
Sbjct: 179 AGESMHQVDARRSMAWVMGAEGEGMRRLTRETCDQLVRIPMLGSVESLNVSVASAVCLY 237


>RLMB_BORPA RecName: Full=23S rRNA
           (guanosine-2'-O-)-methyltransferase rlmB;       
           EC=2.1.1.-;AltName: Full=23S rRNA Gm2251
           2'-O-methyltransferase;
          Length = 245

 Score = 78.2 bits (191), Expect = 7e-17
 Identities = 54/239 (22%), Positives = 116/239 (48%), Gaps = 8/239 (3%)

Query: 4   SSFLIVGQHAVIEALRNPKRKVLKVFLTEESKKNIHRKNPKKNVLEDVKVYFKSKKELDK 63
           S+ ++ G HAV+  LR+    + ++++    +    +   ++      +V+  + + LD 
Sbjct: 3   STQVLAGFHAVVARLRHAPESIKEIYVEASRRDKRMQTFLEQAERAGRRVHPVAAERLDG 62

Query: 64  YTSKDQIMHGGYIAEVEH----IDQPDLKEFIKGKNELTFVCIDEVTDPRNIGSLIRSAS 119
                +  H G +A  E     +   ++ + I+G   L  + +D VTDP N+G+ +R+A 
Sbjct: 63  LARGTR--HQGVVAVAEERSLAVGIDEVLDVIEGPALL--LILDGVTDPHNLGACLRTAD 118

Query: 120 SFHIDGLIVKERQFPSDSKLMYKAASGCMEHINIFEVSNINSTLKNLREKNFWVYGFDAR 179
           +  +  +I    +    +  + + A G  + +    V+N+  T++ L+E++ W+ G D +
Sbjct: 119 AAGVHAVIAPRDRAVGLNATVQRVACGAADTVPYLTVTNLARTMRELKERDVWLVGTDDQ 178

Query: 180 GEKDFTEIKWEGKNVLLFGSEGFGMREHTGKYTDFFVKIDINKDVESLNISNSAAIVFH 238
             +   ++        + G+EG GMR  T +  D  V+I +   VESLN+S ++A+  +
Sbjct: 179 AGESMHQVDARRSMAWVMGAEGEGMRRLTRETCDQLVRIPMLGSVESLNVSVASAVCLY 237


>RLMB_BORBR RecName: Full=23S rRNA
           (guanosine-2'-O-)-methyltransferase rlmB;       
           EC=2.1.1.-;AltName: Full=23S rRNA Gm2251
           2'-O-methyltransferase;
          Length = 245

 Score = 78.2 bits (191), Expect = 7e-17
 Identities = 54/239 (22%), Positives = 116/239 (48%), Gaps = 8/239 (3%)

Query: 4   SSFLIVGQHAVIEALRNPKRKVLKVFLTEESKKNIHRKNPKKNVLEDVKVYFKSKKELDK 63
           S+ ++ G HAV+  LR+    + ++++    +    +   ++      +V+  + + LD 
Sbjct: 3   STQVLAGFHAVVARLRHAPESIKEIYVEASRRDKRMQTFLEQAERAGRRVHPVAAERLDG 62

Query: 64  YTSKDQIMHGGYIAEVEH----IDQPDLKEFIKGKNELTFVCIDEVTDPRNIGSLIRSAS 119
                +  H G +A  E     +   ++ + I+G   L  + +D VTDP N+G+ +R+A 
Sbjct: 63  LARGTR--HQGVVAVAEERSLAVGIDEVLDVIEGPALL--LILDGVTDPHNLGACLRTAD 118

Query: 120 SFHIDGLIVKERQFPSDSKLMYKAASGCMEHINIFEVSNINSTLKNLREKNFWVYGFDAR 179
           +  +  +I    +    +  + + A G  + +    V+N+  T++ L+E++ W+ G D +
Sbjct: 119 AAGVHAVIAPRDRAVGLNATVQRVACGAADTVPYLTVTNLARTMRELKERDVWLVGTDDQ 178

Query: 180 GEKDFTEIKWEGKNVLLFGSEGFGMREHTGKYTDFFVKIDINKDVESLNISNSAAIVFH 238
             +   ++        + G+EG GMR  T +  D  V+I +   VESLN+S ++A+  +
Sbjct: 179 AGESMHQVDARRSMAWVMGAEGEGMRRLTRETCDQLVRIPMLGSVESLNVSVASAVCLY 237


>RLMB_NITEU RecName: Full=23S rRNA
           (guanosine-2'-O-)-methyltransferase rlmB;       
           EC=2.1.1.-;AltName: Full=23S rRNA Gm2251
           2'-O-methyltransferase;
          Length = 260

 Score = 77.8 bits (190), Expect = 9e-17
 Identities = 59/232 (25%), Positives = 103/232 (44%), Gaps = 8/232 (3%)

Query: 8   IVGQHAVIEALRNPKRKVLKVFLTEESKKNIHRKNPKKNVLE--DVKVYFKSKKELDKYT 65
           I G HA+   LR     + +++L  ++ ++  R     ++ E    ++    +  L K T
Sbjct: 7   IFGFHAITSRLRQHPDSIKEIYL--DTNRHDQRARDLMSLAETTSTRLILCEQDRLCKMT 64

Query: 66  SKDQIMHGGYIAEVEHIDQPDLKE--FIKGKNELTFVCIDEVTDPRNIGSLIRSASSFHI 123
              +  H G  A V  + +    E               D V DP N+G+ +R A +F +
Sbjct: 65  GTTR--HQGVAAHVTKLRRYATLEDXXXXXXXXXXXXXXDGVKDPHNLGACLRVADAFGV 122

Query: 124 DGLIVKERQFPSDSKLMYKAASGCMEHINIFEVSNINSTLKNLREKNFWVYGFDARGEKD 183
             ++V + +    S  ++K ASG ++ +  F V+N+  TL+ L+E   W+ G  A     
Sbjct: 123 HAVVVPKDRAVGLSATVHKVASGAVDTVPFFAVTNLARTLRELKEMGLWIVGTAADAPDT 182

Query: 184 FTEIKWEGKNVLLFGSEGFGMREHTGKYTDFFVKIDINKDVESLNISNSAAI 235
              +        + G+E  GMR  T +  D  V I ++  +ESLN+S SA I
Sbjct: 183 LDSVTLTRPLAWVLGAEDGGMRRLTREACDLLVSIPMSGSIESLNVSVSAGI 234


>RLMB_RALSO RecName: Full=23S rRNA
           (guanosine-2'-O-)-methyltransferase rlmB;       
           EC=2.1.1.-;AltName: Full=23S rRNA Gm2251
           2'-O-methyltransferase;
          Length = 249

 Score = 77.0 bits (188), Expect = 2e-16
 Identities = 62/239 (25%), Positives = 106/239 (44%), Gaps = 9/239 (3%)

Query: 1   MNKSSFLIVGQHAVIEALRNPKRKVLKVFLTEESKKNIHRKNPKKNVLEDVKVYFKSKKE 60
           M+KS  L++G HAV   LR+  R + +++     +    +   K      V++     + 
Sbjct: 1   MSKSK-LLIGFHAVTARLRHDARSIDEIYFEANRRDRRMQDFLKAAEAAGVRMIPADNER 59

Query: 61  LDKYTSKDQIMHGGYIAEVEHIDQPDLKEF----IKGKNELTFVCIDEVTDPRNIGSLIR 116
           L      D+  H G +A+                I+G   L  + +D VTDP N+G+ +R
Sbjct: 60  LRGIAGTDR--HQGVVAKXXXXXXXXXXXXXXXGIEGPPLL--LVLDGVTDPHNLGACLR 115

Query: 117 SASSFHIDGLIVKERQFPSDSKLMYKAASGCMEHINIFEVSNINSTLKNLREKNFWVYGF 176
                        + +    +  + K ASG  E +    V+N+  TL+ L+++  WV G 
Sbjct: 116 VXXXXXXXXXXXPKDRSVGINTTVAKVASGAAETVPYITVTNLARTLRELQQRGVWVIGT 175

Query: 177 DARGEKDFTEIKWEGKNVLLFGSEGFGMREHTGKYTDFFVKIDINKDVESLNISNSAAI 235
               E+D     ++G   L+ G+EG GMR  T +  D  V I +   VESLN+S ++ +
Sbjct: 176 ADEAEQDLYRADFKGPIALVMGAEGEGMRRLTRETCDTLVSIPMAGSVESLNVSVASGV 234


>Y6073_MYCS2 RecName: Full=Uncharacterized tRNA/rRNA
           methyltransferase MSMEG_6073;         EC=2.1.1.-;
          Length = 314

 Score = 75.9 bits (185), Expect = 4e-16
 Identities = 38/142 (26%), Positives = 76/142 (53%)

Query: 105 VTDPRNIGSLIRSASSFHIDGLIVKERQFPSDSKLMYKAASGCMEHINIFEVSNINSTLK 164
           ++DPRN+G+++RS ++F   G+++ +R+  S + + ++ +            +N+N TLK
Sbjct: 173 ISDPRNLGAIVRSVAAFAGHGVVIPQRRSASVTAVAWRTSXXXXXXXXXXXXTNLNRTLK 232

Query: 165 NLREKNFWVYGFDARGEKDFTEIKWEGKNVLLFGSEGFGMREHTGKYTDFFVKIDINKDV 224
           +  +    + G DA G+    E+   G  V++ GSEG G+     ++ D  V I +    
Sbjct: 233 SFADAGLQIVGLDAGGDTTLDELDATGPTVVVVGSEGKGLSRLVREHCDAIVSIPMAGPT 292

Query: 225 ESLNISNSAAIVFHHLSYLKKN 246
           ESLN S +A +V   ++  +++
Sbjct: 293 ESLNASVAAGVVLAEIARQRRS 314


>Y252_MYCGE RecName: Full=Uncharacterized tRNA/rRNA
           methyltransferase MG252;         EC=2.1.1.-;
          Length = 242

 Score = 75.9 bits (185), Expect = 4e-16
 Identities = 56/218 (25%), Positives = 110/218 (50%), Gaps = 21/218 (9%)

Query: 23  RKVLKVFLTEESKKNIHRKNPKKNVLEDVKVYFKSKKELDKYTSKDQIMHGGYIAEVEHI 82
           +K++ +   ++    IH  N   N   D+     + +EL      +Q++          I
Sbjct: 36  KKLIPLIEAKKINFQIHSTNWFNNQYRDI-----NHQELVAVLDTNQLL----------I 80

Query: 83  DQPDLKEFIKGKNELTFVCIDEVTDPRNIGSLIRSASSFHIDGLIVKE-RQFPSDSKLMY 141
               L + ++ K   T V +DE+ DP N G+++R+  +  +DG+I K+  Q P ++ +M 
Sbjct: 81  PLDQLVKVVENKKCSTLVMLDEIQDPYNFGAILRTCLASEVDGIIFKKNNQVPINNTVM- 139

Query: 142 KAASGCMEHINIFEVSNINSTLKNLREKNFW--VYGFDARGEK-DFTEIKWEGKNVLLFG 198
           K + G + + N+ +V+N++ T+  L+E  FW  V   D   +  D+ ++ +  K +L+ G
Sbjct: 140 KTSMGSVFYQNLVQVANLSYTITKLKEIGFWTVVSTLDPIWKPIDYRKVDF-AKKILIVG 198

Query: 199 SEGFGMREHTGKYTDFFVKIDINKDVESLNISNSAAIV 236
           +E  G+ +   K  D  +KI +N  + SLN+S +  I+
Sbjct: 199 NEDRGVNQLITKNADCRIKIPMNNKINSLNVSVALGII 236


>Y2399_ARCFU RecName: Full=Uncharacterized tRNA/rRNA
           methyltransferase AF_2399;         EC=2.1.1.-;
          Length = 224

 Score = 74.3 bits (181), Expect = 1e-15
 Identities = 57/174 (32%), Positives = 84/174 (48%), Gaps = 7/174 (4%)

Query: 75  YIAEVEHIDQPDLKEFIK----GKNELTFVCIDEVTDPRNIGSLIRSASSFHIDGLIVKE 130
           + AEV  I   D +  +K    G + + F  +D V D RNIG+ IR+A  F   G+++ +
Sbjct: 53  FSAEVSPIKYADFEFIVKKALTGGSFILF--LDNVVDQRNIGACIRTAEFFGAAGVVLPK 110

Query: 131 RQFPSDSKLMYKAASGCMEHINIFEVSNINSTLKNLREKNFWVYGFDARGEKDFTEIKWE 190
           R+  S  +   KA++G + HI I  V N  S +K L++  F     D  GE D   +   
Sbjct: 111 RRVGSIQEGAVKASAGAVFHIPIARVENFASAIKKLKKLGFTTLAADLDGE-DLEAVSLL 169

Query: 191 GKNVLLFGSEGFGMREHTGKYTDFFVKIDINKDVESLNISNSAAIVFHHLSYLK 244
               ++ G E  G+     K  DF VKI     V SLN+S +A I  + LS  K
Sbjct: 170 LPAAVVIGGEDRGVSRPVKKQCDFVVKIPGVGKVNSLNLSVAAGIFLYTLSRQK 223


>Y1447_MYCGI RecName: Full=Uncharacterized tRNA/rRNA
           methyltransferase Mflv_1447;         EC=2.1.1.-;
          Length = 314

 Score = 74.3 bits (181), Expect = 1e-15
 Identities = 57/246 (23%), Positives = 114/246 (46%), Gaps = 8/246 (3%)

Query: 7   LIVGQHAVIEALR-NPKRKVLKVFLTEESKKNIHRKNPKKNVLEDVKVYFKSKKELDKYT 65
           +++G++ V+E LR       L V L  ++ + +  ++ +      + +    + +LD+  
Sbjct: 72  IVLGRNPVVECLRAGVPATALYVALGTDADERL-TESVQMAADRGISILEVQRHDLDRMA 130

Query: 66  SKDQIMHGGYIAEVEHID--QPD--LKEFIKGKNELTFVCIDEVTDPRNIGSLIRSASSF 121
           +    +H G   +V       PD  L++          V +D ++DPRN+G+++RS ++F
Sbjct: 131 ANG--LHQGIALQVPPYAYAHPDDLLRDAKSDAAPALLVALDNISDPRNLGAIVRSVAAF 188

Query: 122 HIDGLIVKERQFPSDSKLMYKAASGCMEHINIFEVSNINSTLKNLREKNFWVYGFDARGE 181
              G+++ +R+  S + + ++ +             N+N TLK   +    V G DA G+
Sbjct: 189 GGHGVVLPQRRSASVTAVAWRTSXXXXXXXXXXXXXNLNRTLKQYADAGLQVVGLDAGGD 248

Query: 182 KDFTEIKWEGKNVLLFGSEGFGMREHTGKYTDFFVKIDINKDVESLNISNSAAIVFHHLS 241
               EI      +++ GSEG G+     +  D  V I +    ESLN S +A +V   ++
Sbjct: 249 TTIDEIDGLTPTIVVVGSEGKGLSRLVRENCDRIVSIPMAGPTESLNASVAAGVVLAEIA 308

Query: 242 YLKKNS 247
             ++ S
Sbjct: 309 RQRRLS 314


>Y5337_MYCVP RecName: Full=Uncharacterized tRNA/rRNA
           methyltransferase Mvan_5337;         EC=2.1.1.-;
          Length = 314

 Score = 73.9 bits (180), Expect = 1e-15
 Identities = 58/246 (23%), Positives = 115/246 (46%), Gaps = 8/246 (3%)

Query: 7   LIVGQHAVIEALR-NPKRKVLKVFLTEESKKNIHRKNPKKNVLEDVKVYFKSKKELDKYT 65
           +++G++ V+E LR       L V L  +S + +  ++ +    + + +    + +LD+  
Sbjct: 72  IVLGRNPVLECLRAGVPATALYVALGADSDERL-TESVQIAADKGIAILEVPRHDLDRIA 130

Query: 66  SKDQIMHGGYIAEVEHID--QPD--LKEFIKGKNELTFVCIDEVTDPRNIGSLIRSASSF 121
           +    MH G   +V   +   PD  L E          V +D ++DPRN+G+++RS ++F
Sbjct: 131 ANG--MHQGIALQVPPYNYAHPDDLLAEAKSDAMPALLVALDNISDPRNLGAIVRSVAAF 188

Query: 122 HIDGLIVKERQFPSDSKLMYKAASGCMEHINIFEVSNINSTLKNLREKNFWVYGFDARGE 181
              G+++ +R+  S + + ++ +             N+   LK   +    V G DA G+
Sbjct: 189 GGHGVLIPQRRSASVTAVAWRTSXXXXXXXXXXXXXNLTRALKQWADAGLQVVGLDADGD 248

Query: 182 KDFTEIKWEGKNVLLFGSEGFGMREHTGKYTDFFVKIDINKDVESLNISNSAAIVFHHLS 241
               +I   G  V++ GSEG G+     +  D  V I +    ESLN S +A +V   ++
Sbjct: 249 TTVDQIDGAGPIVVVVGSEGKGLSRLVRENCDAVVSIPMAGPTESLNASVAAGVVLAEIA 308

Query: 242 YLKKNS 247
             ++++
Sbjct: 309 RQRRSA 314


>MRM1_DICDI RecName: Full=Mitochondrial rRNA methyltransferase;     
              EC=2.1.1.-;AltName: Full=Mitochondrial large
           ribosomal RNA ribose methylase;
          Length = 531

 Score = 72.8 bits (177), Expect = 3e-15
 Identities = 44/149 (29%), Positives = 81/149 (54%), Gaps = 7/149 (4%)

Query: 99  FVCIDEVTDPRNIGSLIRSASSFHIDGLIVKERQFPSDSKLMYKAASGCMEHINIFEVSN 158
           ++ +DE+ DP+N+G++IR+ S F+IDG+++  +     +    K++SG  E   I    +
Sbjct: 375 WLVLDELWDPQNVGAIIRNCSFFNIDGVVISNKNSSPITPAASKSSSGACESFVINRTES 434

Query: 159 INSTLKNLREKNFWVYG--FDARGEK----DFTEIKWEGKNVLLFGSEGFGMREHTGKYT 212
           I   LK+ +   + V G   D   E     D  +IK +   +L+ G+EGFG++    +  
Sbjct: 435 IEGFLKSSQRNGWNVVGTSLDDLNENQPCLDINQIKLDQPTILILGNEGFGLKPSVLEIC 494

Query: 213 DFFVKI-DINKDVESLNISNSAAIVFHHL 240
           +  +KI   N  ++SLN+S ++ I+ H L
Sbjct: 495 NKTIKIVGGNYKIDSLNVSVTSGILIHTL 523


>YSGA_BACSU RecName: Full=Uncharacterized tRNA/rRNA
           methyltransferase ysgA;         EC=2.1.1.-;
          Length = 248

 Score = 72.4 bits (176), Expect = 4e-15
 Identities = 60/237 (25%), Positives = 115/237 (48%), Gaps = 18/237 (7%)

Query: 4   SSFLIVGQHAVIEALRNPKRKVLKVFLTEESKKNIHRKNPKKNVLEDVKVYFKSKKELDK 63
           ++FLI G+H V EAL++P   ++K  L ++  +         ++   ++ Y  S+   D 
Sbjct: 28  NTFLIEGEHLVEEALKSPG--IVKEILVKDETRI------PSDLETGIQCYMLSE---DA 76

Query: 64  YTSKDQIMHGGYIAEVEHIDQPDLKEFIKGKNELTFVCIDEVTDPRNIGSLIRSASSFHI 123
           +++  +      IA V H+ +  L    K       + ID V DP N+G++IR+A +  +
Sbjct: 77  FSAVTETETPQQIAAVCHMPEEKLATARK------VLLIDAVQDPGNLGTMIRTADAAGL 130

Query: 124 DGLIVKERQFPSDSKLMYKAASGCMEHINIFEVSNINSTLKNLREKNFWVYGFDARGEKD 183
           D +++ +    + +    ++A G   HI +    N+ S +  L+ +   VYG   +    
Sbjct: 131 DAVVLGDGTADAFNGKTLRSAQGSHFHIPVVR-RNLPSYVDELKAEGVKVYGTALQNGAP 189

Query: 184 FTEIKWEGKNVLLFGSEGFGMREHTGKYTDFFVKIDINKDVESLNISNSAAIVFHHL 240
           + EI       L+ G+EG G+     + TD  + + +    ESLN++ +AAI+ +HL
Sbjct: 190 YQEIPQSESFALIVGNEGAGVDAALLEKTDLNLYVPLYGQAESLNVAVAAAILVYHL 246


>Y516_BORBU RecName: Full=Uncharacterized tRNA/rRNA
           methyltransferase BB_0516;         EC=2.1.1.-;
          Length = 228

 Score = 70.9 bits (172), Expect = 1e-14
 Identities = 48/217 (22%), Positives = 91/217 (41%), Gaps = 18/217 (8%)

Query: 40  RKNPKKNVLE------DVKVYFKSKKELDKYTSKDQIMHGGYIAE----------VEHID 83
           +K+PK   +E      ++K+   +  ELDK        H G+              +  D
Sbjct: 7   KKSPKTKEIEQLAKTQNIKIIRINTNELDKILKNKD--HRGFAXXXXXXXXXXXXTQTKD 64

Query: 84  QPDLKEFIKGKNELTFVCIDEVTDPRNIGSLIRSASSFHIDGLIVKERQFPSDSKLMYKA 143
             +L E  K K     + +DE+ DP+N G+++R+A  F ID +I  +++   D+  + + 
Sbjct: 65  FENLLETFKKKENAFILLLDEIEDPQNFGAILRTAEQFSIDLVITTQKRSAKDNSTVLRT 124

Query: 144 ASGCMEHINIFEVSNINSTLKNLREKNFWVYGFDARGEKDFTEIKWEGKNVLLFGSEGFG 203
           +SG  ++                    FW+Y                    L+ G+EG G
Sbjct: 125 SSGASQYXXXXXXXXXXXXXXXXXXYGFWIYTXXXXXXXXXXXXXXXXXXALILGNEGKG 184

Query: 204 MREHTGKYTDFFVKIDINKDVESLNISNSAAIVFHHL 240
           + +   + +DF ++I  +  ++SLN+S S  I+   +
Sbjct: 185 VHKLIKENSDFLIRIPTSGKIDSLNVSVSTGILIFEI 221


>Y355_MYCPN RecName: Full=Uncharacterized tRNA/rRNA
           methyltransferase MG252 homolog;         EC=2.1.1.-;
          Length = 242

 Score = 67.4 bits (163), Expect = 1e-13
 Identities = 39/153 (25%), Positives = 77/153 (50%), Gaps = 4/153 (2%)

Query: 87  LKEFIKGKNELTFVCIDEVTDPRNIGSLIRSASSFHIDGLIVKERQFPSDSKLMYKAASG 146
           L +    K+  T V + E+ DP N G+++R+  +  +DG+I K+      +  + + + G
Sbjct: 85  LIQITDSKSTSTLVMLHEIQDPHNFGAILRTCMAAEVDGIIFKKHNQAPINSTVIRTSMG 144

Query: 147 CMEHINIFEVSNINSTLKNLREKNFWVYG--FDAR-GEKDFTEIKWEGKNVLLFGSEGFG 203
            + + N+ +V+N++  +  L++  FW      D R   KD+ ++ ++ K +LL G+E   
Sbjct: 145 TVFYQNLVQVTNLSYAITTLQKHGFWTVATTLDERLKPKDYRQVDFD-KRILLVGNEXXX 203

Query: 204 MREHTGKYTDFFVKIDINKDVESLNISNSAAIV 236
                       VKI +N  + SLN+S +  I+
Sbjct: 204 XXXXXXXXXXXKVKIPMNPKLNSLNVSVAVGII 236


>Y574_MYCA1 RecName: Full=Uncharacterized tRNA/rRNA
           methyltransferase MAV_0574;         EC=2.1.1.-;
          Length = 309

 Score = 67.0 bits (162), Expect = 2e-13
 Identities = 53/238 (22%), Positives = 105/238 (44%), Gaps = 7/238 (2%)

Query: 8   IVGQHAVIEALR-NPKRKVLKVFLTEESKKNIHRKNPKKNVLEDVKVYFKSKKELDKYTS 66
           ++G++ V+E LR       L V L  E+ + +  ++  +     + +    + +LD+ T 
Sbjct: 70  VLGRNPVLECLRAGVPATALYVALGTEADERL-TESVSRAADSGISILEVPRADLDRMTG 128

Query: 67  KDQIMHGGYIAEVE---HIDQPDLKEFIKGKNELTFVCIDEVTDPRNIGSLIRSASSFHI 123
               +H G   +V    +    DL E   G      V +D ++DPRN+G+++RS ++F  
Sbjct: 129 NH--LHQGIALQVPPYIYAHPDDLLEAAAGSPPALLVALDNISDPRNLGAIVRSVAAFGG 186

Query: 124 DGLIVKERQFPSDSKLMYKAASGCMEHINIFEVSNINSTLKNLREKNFWVYGFDARGEKD 183
            G+++ +R+  S + + ++ +            +N+  TL++  ++   V          
Sbjct: 187 HGVLIPQRRSASVTAVAWRTSXXXXXXXXXXXXTNLTRTLQDWADRGLRVIXXXXXXXXX 246

Query: 184 FTEIKWEGKNVLLFGSEGFGMREHTGKYTDFFVKIDINKDVESLNISNSAAIVFHHLS 241
                     V++ GSEG G+     +  D  V I +    ESLN S +A +V   +S
Sbjct: 247 XXXXXXXXXXVVVVGSEGKGLSRLVRQNCDEVVSIPMAGSAESLNASVAAGVVLAEIS 304


>RLMB_XANCP RecName: Full=23S rRNA
           (guanosine-2'-O-)-methyltransferase rlmB;       
           EC=2.1.1.-;AltName: Full=23S rRNA Gm2251
           2'-O-methyltransferase;
          Length = 249

 Score = 66.6 bits (161), Expect = 2e-13
 Identities = 55/245 (22%), Positives = 107/245 (43%), Gaps = 18/245 (7%)

Query: 1   MNKSSFLIVGQHAVIEALRNPKRKVLKVFLTEESKKNIHRKNPKKNVLED------VKVY 54
           M+K +  IVG +AV  ++ N    V +V +   SK      NP+   +E+      + V 
Sbjct: 1   MSKQNQWIVGVNAVASSVENDADNVREVLIEAGSK------NPRLTEIEEQARRKGIDVR 54

Query: 55  FKSKKELDKYTSKDQIMHGGYIAEVEHID---QPDLKEFIKGKNELTFVCI-DEVTDPRN 110
             + + LD      Q+ H G            + +L+  ++       V I D V DP N
Sbjct: 55  RVNTQALDGVGG--QVRHQGVXXXXXXXXXXXENELEGLVEAAQGRALVLILDGVQDPHN 112

Query: 111 IGSLIRSASSFHIDGLIVKERQFPSDSKLMYKAASGCMEHINIFEVSNINSTLKNLREKN 170
           +G+ +RSA++  +  +++ + +  + +  + K ++G  + I +  V+N+   L++L+++ 
Sbjct: 113 LGACLRSAAAAGVTAVVIPKDKSATVNATVRKTSAGAADRIPVVAVTNLARCLRDLQKQG 172

Query: 171 FWVYGFDARGEKDFTEIKWEGKNVLLFGSEGFGMREHTGKYTDFFVKIDINKDVESLNIS 230
            W+YG     E                          T ++ D  VKI +  D+ESLN+S
Sbjct: 173 VWLYGLAGEAEASLYSXXXXXXXXXXXXXXXXXXXXXTREHCDGLVKIPMPGDIESLNVS 232

Query: 231 NSAAI 235
            +  +
Sbjct: 233 VATGV 237


>Y5079_MYCMM RecName: Full=Uncharacterized tRNA/rRNA
           methyltransferase MMAR_5079;         EC=2.1.1.-;
          Length = 310

 Score = 63.5 bits (153), Expect = 2e-12
 Identities = 34/137 (24%), Positives = 70/137 (51%)

Query: 105 VTDPRNIGSLIRSASSFHIDGLIVKERQFPSDSKLMYKAASGCMEHINIFEVSNINSTLK 164
           ++DPRN+G+++RS ++F   G+++ +R+  S + + ++ +            +N+   LK
Sbjct: 169 ISDPRNLGAIVRSVAAFGGHGVLIPQRRSASVTAVAWRTSXXXXXXXXXXXXTNLTRALK 228

Query: 165 NLREKNFWVYGFDARGEKDFTEIKWEGKNVLLFGSEGFGMREHTGKYTDFFVKIDINKDV 224
           +  ++   V G DA G+    ++      V++ GSEG G+     +  D  V + +    
Sbjct: 229 DWADRGVRVVGLDAGGDTAIDDLDGSDPIVVVVGSEGKGLSRLVRQTCDEVVSVPMAGPT 288

Query: 225 ESLNISNSAAIVFHHLS 241
           ESLN S +A +V   ++
Sbjct: 289 ESLNASVAAGVVLAEIA 305


>Y4155_MYCUA RecName: Full=Uncharacterized tRNA/rRNA
           methyltransferase MUL_4155;         EC=2.1.1.-;
          Length = 310

 Score = 63.5 bits (153), Expect = 2e-12
 Identities = 34/137 (24%), Positives = 70/137 (51%)

Query: 105 VTDPRNIGSLIRSASSFHIDGLIVKERQFPSDSKLMYKAASGCMEHINIFEVSNINSTLK 164
           ++DPRN+G+++RS ++F   G+++ +R+  S + + ++ +            +N+   LK
Sbjct: 169 ISDPRNLGAIVRSVAAFGGHGVLIPQRRSASVTAVAWRTSXXXXXXXXXXXXTNLTRALK 228

Query: 165 NLREKNFWVYGFDARGEKDFTEIKWEGKNVLLFGSEGFGMREHTGKYTDFFVKIDINKDV 224
           +  ++   V G DA G+    ++      V++ GSEG G+     +  D  V + +    
Sbjct: 229 DWADRGVRVVGLDAGGDTAIDDLDGSDPIVVVVGSEGKGLSRLVRQTCDEVVSVPMAGPT 288

Query: 225 ESLNISNSAAIVFHHLS 241
           ESLN S +A +V   ++
Sbjct: 289 ESLNASVAAGVVLAEIA 305


>MRM1_SCHPO RecName: Full=rRNA methyltransferase, mitochondrial;    
               EC=2.1.1.-;AltName: Full=Mitochondrial large
           ribosomal RNA ribose methylase;
          Length = 301

 Score = 61.6 bits (148), Expect = 7e-12
 Identities = 72/286 (25%), Positives = 129/286 (45%), Gaps = 59/286 (20%)

Query: 1   MNKSSFLIVGQHAVIEALRNPKRKVLKVFLT--------EESKKNIHRKNPKKNVLEDVK 52
           + + S  + G H+V  AL   KR+   +++         EE    +  K P K+V     
Sbjct: 27  IKEDSEFVFGTHSVKNALATRKRECRALYVQNADIHSEFEEFLNKLQYKIPIKSV----- 81

Query: 53  VYFKSKKELDKYTSKDQIMHGGYIAEVEHIDQPDLKEFI--------------------- 91
               +K+ L++ T+     H G + E   ++ P + + +                     
Sbjct: 82  ----NKEHLNQITACRP--HNGVVLEASSLNVPTISDLLFPAGEEYNNKNGQDSPHNDLN 135

Query: 92  KGKNELT------FVCIDEVTDPRNIGSLIRSASSFHIDGLIVKERQFPSDSKLMYKAAS 145
           +GK+  +      +V +D +TDP+N+G++IRSA      G+++ ++     S ++ KA++
Sbjct: 136 EGKSSSSDNYPPLYVYVDGITDPQNMGAVIRSAYILGAKGILLSKKHNTFLSPVVSKASA 195

Query: 146 GCMEHINIFEVSNINSTLKNLREKNFWVYGF-----DARGE-----KDFTEIKWEGKNVL 195
           G +E  NI  V N    L+N   K + V G      D + +     K  TE+  E K +L
Sbjct: 196 GALEVFNISHVKNPMVFLRNSVLKGWKVIGTKPALPDNKDQIYTPHKIKTELMNEPK-IL 254

Query: 196 LFGSEGFGMREHTGKYTDFFVKI-DINKDVESLNISNSAAIVFHHL 240
           + GSE  G+R +       +V I   +K V+SLN+S +A I+ + L
Sbjct: 255 VLGSEK-GLRTNILTQCSHYVSIPGGDKYVDSLNVSVAAGILLYSL 299


>MRM1_HUMAN RecName: Full=rRNA methyltransferase 1, mitochondrial;  
                 EC=2.1.1.-;AltName: Full=Mitochondrial large
           ribosomal RNA ribose methylase;
          Length = 353

 Score = 60.5 bits (145), Expect = 2e-11
 Identities = 39/162 (24%), Positives = 78/162 (48%), Gaps = 15/162 (9%)

Query: 99  FVCIDEVTDPRNIGSLIRSASSFHIDGLIVKERQFPSDSKLMYKAASGCMEHINIFEVSN 158
           ++ +D + DPRN G+++RSA    +D +I   R     + ++ K+++G ME +++F   +
Sbjct: 147 WLVLDGIQDPRNFGAVLRSAHFLGVDKVITSRRNSCPLTPVVSKSSAGAMEVMDVFSTDD 206

Query: 159 INSTLKNLREKNFWVYGF-------DARGEK----DFTEIKWEGKNVLLFGSEGFGMREH 207
           +   L+   ++ + V G        D +  +       E  WE   +L+ G+EG G+ + 
Sbjct: 207 LTGFLQTKAQQGWLVAGTVGCPSTEDPQSSEIPIMSCLEFLWERPTLLVLGNEGSGLSQE 266

Query: 208 TGKYTDFFVKI----DINKDVESLNISNSAAIVFHHLSYLKK 245
                   + I     +   +ESLN+S +A I+ H +   +K
Sbjct: 267 VQASCQLLLTILPRRQLPPGLESLNVSVAAGILLHSICSQRK 308


>Y5122_MYCSJ RecName: Full=Uncharacterized tRNA/rRNA
           methyltransferase Mjls_5122;         EC=2.1.1.-;
          Length = 314

 Score = 60.1 bits (144), Expect = 2e-11
 Identities = 54/246 (21%), Positives = 101/246 (41%), Gaps = 10/246 (4%)

Query: 7   LIVGQHAVIEALRN--PKRKVLKVFLTEESKKNIHRKNPKKNVLEDVKVYFKSKKELDKY 64
           L++G++ V+E LR   P   +     TE  +    R      +  D  +        D  
Sbjct: 73  LVLGRNPVVECLRAEVPATALYVAMGTEADE----RVTEAVQIAADSGISILEVPRSDLD 128

Query: 65  TSKDQIMHGGYIAEVEHIDQP---DLKEFIKGKNE-LTFVCIDEVTDPRNIGSLIRSASS 120
              +  +H G   +V   D     DL    K        V +D ++DPRN+G+++RS ++
Sbjct: 129 RMSNNALHQGLGLQVPPYDYAHPDDLLATAKADGAPALLVALDNISDPRNLGAIVRSVAA 188

Query: 121 FHIDGLIVKERQFPSDSKLMYKAASGCMEHINIFEVSNINSTLKNLREKNFWVYGFDARG 180
           F   G+++ +R+  S + + ++ +            +N+N TLK+  +    V       
Sbjct: 189 FGGHGVLIPQRRSASVTAVAWRTSXXXXXXXXXXXXTNLNRTLKSWADGGLQVVXXXXXX 248

Query: 181 EKDFTEIKWEGKNVLLFGSEGFGMREHTGKYTDFFVKIDINKDVESLNISNSAAIVFHHL 240
                        V++ GSEG G+     +  D  V I +    ESLN S +A +V   +
Sbjct: 249 XXXXXXXXXXXPVVVVVGSEGKGLSRLVRENCDAVVSIPMAGPTESLNASVAAGVVLAEI 308

Query: 241 SYLKKN 246
           +  +++
Sbjct: 309 ARQRRS 314


>Y4822_MYCSK RecName: Full=Uncharacterized tRNA/rRNA
           methyltransferase Mkms_4822;         EC=2.1.1.-;
          Length = 314

 Score = 60.1 bits (144), Expect = 2e-11
 Identities = 55/248 (22%), Positives = 107/248 (43%), Gaps = 14/248 (5%)

Query: 7   LIVGQHAVIEALRN--PKRKVLKVFLTEESKKNIHRKNPKKNVLED--VKVYFKSKKELD 62
           L++G++ V+E LR   P   +     TE  +    R      +  D  + +    + +LD
Sbjct: 73  LVLGRNPVVECLRAEVPATALYVAMGTEADE----RVTEAVQIAADNGISILEVPRSDLD 128

Query: 63  KYTSKDQIMHGGYIAEVEHIDQP---DLKEFIKGKNE-LTFVCIDEVTDPRNIGSLIRSA 118
           + ++    +H G   +V   D     DL    K        V +D ++DPRN+G+++RS 
Sbjct: 129 RMSNN--ALHQGLGLQVPPYDYAHPDDLLATAKADGAPALLVALDNISDPRNLGAIVRSV 186

Query: 119 SSFHIDGLIVKERQFPSDSKLMYKAASGCMEHINIFEVSNINSTLKNLREKNFWVYGFDA 178
           ++F   G+++ +R+  S + + ++ +            +N+N TLK+  +    V     
Sbjct: 187 AAFGGHGVLIPQRRSASVTAVAWRTSXXXXXXXXXXXXTNLNRTLKSWADGGLQVVXXXX 246

Query: 179 RGEKDFTEIKWEGKNVLLFGSEGFGMREHTGKYTDFFVKIDINKDVESLNISNSAAIVFH 238
                          V++ GSEG G+     +  D  V I +    ESLN S +A +V  
Sbjct: 247 XXXXXXXXXXXXXPVVVVVGSEGKGLSRLVRENCDAVVSIPMAGPTESLNASVAAGVVLA 306

Query: 239 HLSYLKKN 246
            ++  +++
Sbjct: 307 EIARQRRS 314


>Y4736_MYCSS RecName: Full=Uncharacterized tRNA/rRNA
           methyltransferase Mmcs_4736;         EC=2.1.1.-;
          Length = 314

 Score = 60.1 bits (144), Expect = 2e-11
 Identities = 55/248 (22%), Positives = 107/248 (43%), Gaps = 14/248 (5%)

Query: 7   LIVGQHAVIEALRN--PKRKVLKVFLTEESKKNIHRKNPKKNVLED--VKVYFKSKKELD 62
           L++G++ V+E LR   P   +     TE  +    R      +  D  + +    + +LD
Sbjct: 73  LVLGRNPVVECLRAEVPATALYVAMGTEADE----RVTEAVQIAADNGISILEVPRSDLD 128

Query: 63  KYTSKDQIMHGGYIAEVEHIDQP---DLKEFIKGKNE-LTFVCIDEVTDPRNIGSLIRSA 118
           + ++    +H G   +V   D     DL    K        V +D ++DPRN+G+++RS 
Sbjct: 129 RMSNN--ALHQGLGLQVPPYDYAHPDDLLATAKADGAPALLVALDNISDPRNLGAIVRSV 186

Query: 119 SSFHIDGLIVKERQFPSDSKLMYKAASGCMEHINIFEVSNINSTLKNLREKNFWVYGFDA 178
           ++F   G+++ +R+  S + + ++ +            +N+N TLK+  +    V     
Sbjct: 187 AAFGGHGVLIPQRRSASVTAVAWRTSXXXXXXXXXXXXTNLNRTLKSWADGGLQVVXXXX 246

Query: 179 RGEKDFTEIKWEGKNVLLFGSEGFGMREHTGKYTDFFVKIDINKDVESLNISNSAAIVFH 238
                          V++ GSEG G+     +  D  V I +    ESLN S +A +V  
Sbjct: 247 XXXXXXXXXXXXXPVVVVVGSEGKGLSRLVRENCDAVVSIPMAGPTESLNASVAAGVVLA 306

Query: 239 HLSYLKKN 246
            ++  +++
Sbjct: 307 EIARQRRS 314


>MRM1_YEAST RecName: Full=rRNA methyltransferase, mitochondrial;    
               EC=2.1.1.-;AltName: Full=Mitochondrial large
           ribosomal RNA ribose methylase;
          Length = 412

 Score = 58.5 bits (140), Expect = 6e-11
 Identities = 52/187 (27%), Positives = 88/187 (47%), Gaps = 30/187 (16%)

Query: 78  EVEHIDQPDLKEFIKGKNELTFVCIDEVTDPRNIGSLIRSASSFHIDGLIVKERQFPSDS 137
           E+ +  + D K+F  G      + +DE+TDP NIG++IRSA    +D +++  R     +
Sbjct: 228 ELPYGTKTDAKKFPLG------LYLDEITDPHNIGAIIRSAYFLGVDFIVMSRRNCSPLT 281

Query: 138 KLMYKAASGCMEHINIFEVSNINSTLKNLREKNFWVY----GFDARGEK----------D 183
            ++ K +SG +E + IF V          +E   W +      +A  EK          D
Sbjct: 282 PVVSKTSSGALELLPIFYVDKPLEFFTKSQEMGGWTFITSHLANATSEKYTVGKTISMHD 341

Query: 184 FTEIKWEGKNVLLFGSEGFGMREHTGKYTDFFVKI---DINKD-------VESLNISNSA 233
              +  E   VL+ G+E  G+R +    +DFFV+I    I K        V+SLN+S + 
Sbjct: 342 LNGLCNELPVVLVVGNESQGVRTNLKMRSDFFVEIPFGGIEKGNRAPEPIVDSLNVSVAT 401

Query: 234 AIVFHHL 240
           A++  ++
Sbjct: 402 ALLIDNI 408


>RLMB_ACIAD RecName: Full=23S rRNA
           (guanosine-2'-O-)-methyltransferase rlmB;       
           EC=2.1.1.-;AltName: Full=23S rRNA Gm2251
           2'-O-methyltransferase;
          Length = 248

 Score = 57.8 bits (138), Expect = 1e-10
 Identities = 39/136 (28%), Positives = 70/136 (51%), Gaps = 2/136 (1%)

Query: 105 VTDPRNIGSLIRSASSFHIDGLIVKERQFPSDSKLMYKAASGCMEHINIFEVSNINSTLK 164
           VTDP N+G+ IR+A++  I  +IV   +  S +    K A+G  E +   +V+N+  TL 
Sbjct: 105 VTDPHNLGACIRTAAAMGIAAVIVPRDRSASLTPTARKVAAGGAEKVKFIQVTNLARTLA 164

Query: 165 NLREKNFWVYGFDARGEKDFTEIKWE--GKNVLLFGSEGFGMREHTGKYTDFFVKIDINK 222
           +++   F         EK     K++  G   ++ G+E  G+R  T    D  V I ++ 
Sbjct: 165 HIKAHFFVKVVGTMLDEKALPIQKYDFSGNVAIVMGAEDTGLRPITQSQCDQTVYIPMSG 224

Query: 223 DVESLNISNSAAIVFH 238
           +++SLN+S +A +  +
Sbjct: 225 NLQSLNVSVAAGMALY 240


>Y324_MYCLE RecName: Full=Uncharacterized tRNA/rRNA
           methyltransferase ML0324;         EC=2.1.1.-;
          Length = 309

 Score = 56.6 bits (135), Expect = 2e-10
 Identities = 51/239 (21%), Positives = 98/239 (41%), Gaps = 9/239 (3%)

Query: 8   IVGQHAVIEALRN--PKRKVLKVFLTEESKKNIHRKNPKKNVLEDVKVYFKSKKELDKYT 65
           ++G++ V+E LR   P   +     TE  K+         +V   V +    +  LD+ T
Sbjct: 70  VLGRNPVLECLRAGVPATALYVALGTEVDKRLTESVMRAADV--GVAILEVPRTYLDRIT 127

Query: 66  SKDQIMHGGYIAEV---EHIDQPDLKEFIKGKNELTFVCIDEVTDPRNIGSLIRSASSFH 122
           +    +H G   +V    ++   DL            V +D ++DPRN+G+++RS ++F 
Sbjct: 128 NNH--LHQGIALQVPPYHYVHSDDLLAAATDSPPALLVALDNISDPRNLGAIVRSVAAFS 185

Query: 123 IDGLIVKERQFPSDSKLMYKAASGCMEHINIFEVSNINSTLKNLREKNFWVYGFDARGEK 182
             G+++ +R+  S + + ++ +            +N+   LK   ++   V         
Sbjct: 186 GHGILIPQRRSASVTAVAWRTSXXXXXXXXXXXXTNLTRALKVWADQGLRVIXXXXXXXX 245

Query: 183 DFTEIKWEGKNVLLFGSEGFGMREHTGKYTDFFVKIDINKDVESLNISNSAAIVFHHLS 241
                       ++ GSEG G+        D  V I +   VESLN S +  +V   ++
Sbjct: 246 XXXXXXXXXPLAVVVGSEGKGLSRLVRHSCDEVVSIPMAGQVESLNASVAVGVVLAEIA 304


>Y324_MYCLB RecName: Full=Uncharacterized tRNA/rRNA
           methyltransferase MLBr00324;         EC=2.1.1.-;
          Length = 309

 Score = 56.6 bits (135), Expect = 2e-10
 Identities = 51/239 (21%), Positives = 98/239 (41%), Gaps = 9/239 (3%)

Query: 8   IVGQHAVIEALRN--PKRKVLKVFLTEESKKNIHRKNPKKNVLEDVKVYFKSKKELDKYT 65
           ++G++ V+E LR   P   +     TE  K+         +V   V +    +  LD+ T
Sbjct: 70  VLGRNPVLECLRAGVPATALYVALGTEVDKRLTESVMRAADV--GVAILEVPRTYLDRIT 127

Query: 66  SKDQIMHGGYIAEV---EHIDQPDLKEFIKGKNELTFVCIDEVTDPRNIGSLIRSASSFH 122
           +    +H G   +V    ++   DL            V +D ++DPRN+G+++RS ++F 
Sbjct: 128 NNH--LHQGIALQVPPYHYVHSDDLLAAATDSPPALLVALDNISDPRNLGAIVRSVAAFS 185

Query: 123 IDGLIVKERQFPSDSKLMYKAASGCMEHINIFEVSNINSTLKNLREKNFWVYGFDARGEK 182
             G+++ +R+  S + + ++ +            +N+   LK   ++   V         
Sbjct: 186 GHGILIPQRRSASVTAVAWRTSXXXXXXXXXXXXTNLTRALKVWADQGLRVIXXXXXXXX 245

Query: 183 DFTEIKWEGKNVLLFGSEGFGMREHTGKYTDFFVKIDINKDVESLNISNSAAIVFHHLS 241
                       ++ GSEG G+        D  V I +   VESLN S +  +V   ++
Sbjct: 246 XXXXXXXXXPLAVVVGSEGKGLSRLVRHSCDEVVSIPMAGQVESLNASVAVGVVLAEIA 304


>YFIF_ECOLI RecName: Full=Uncharacterized tRNA/rRNA
           methyltransferase yfiF;         EC=2.1.1.-;
          Length = 345

 Score = 56.2 bits (134), Expect = 3e-10
 Identities = 35/137 (25%), Positives = 65/137 (47%), Gaps = 1/137 (0%)

Query: 100 VCIDEVTDPRNIGSLIRSASSFHIDGLIVKERQFPSDSKLMYKAASGCMEHINIFEVSNI 159
           + ++  ++P N+G ++RS + F + G++V++     +S    + A G  EH+      NI
Sbjct: 200 LALENESNPHNLGGMMRSCAHFGVKGVVVQDAAL-LESGAAIRTAEGGAEHVQPITGDNI 258

Query: 160 NSTLKNLREKNFWVYGFDARGEKDFTEIKWEGKNVLLFGSEGFGMREHTGKYTDFFVKID 219
            + L + R+  + V    +   K   +     K VL+ G E  G+ +      D  VKID
Sbjct: 259 VNVLDDFRQAGYTVVTTSSEQGKPLFKTSLPAKMVLVLGQEYEGLPDAARDPNDLRVKID 318

Query: 220 INKDVESLNISNSAAIV 236
              +V  LNIS +  ++
Sbjct: 319 GTGNVAGLNISVATGVL 335


>YFIF_ECO57 RecName: Full=Uncharacterized tRNA/rRNA
           methyltransferase yfiF;         EC=2.1.1.-;
          Length = 345

 Score = 56.2 bits (134), Expect = 3e-10
 Identities = 35/137 (25%), Positives = 65/137 (47%), Gaps = 1/137 (0%)

Query: 100 VCIDEVTDPRNIGSLIRSASSFHIDGLIVKERQFPSDSKLMYKAASGCMEHINIFEVSNI 159
           + ++  ++P N+G ++RS + F + G++V++     +S    + A G  EH+      NI
Sbjct: 200 LALENESNPHNLGGMMRSCAHFGVKGVVVQDAAL-LESGAAIRTAEGGAEHVQPITGDNI 258

Query: 160 NSTLKNLREKNFWVYGFDARGEKDFTEIKWEGKNVLLFGSEGFGMREHTGKYTDFFVKID 219
            + L + R+  + V    +   K   +     K VL+ G E  G+ +      D  VKID
Sbjct: 259 VNVLDDFRQAGYTVVTTSSEQGKPLFKTSLPAKMVLVLGQEYEGLPDAARDPNDLRVKID 318

Query: 220 INKDVESLNISNSAAIV 236
              +V  LNIS +  ++
Sbjct: 319 GTGNVAGLNISVATGVL 335


>Y3618_MYCTA RecName: Full=Uncharacterized tRNA/rRNA
           methyltransferase MRA_3618;         EC=2.1.1.-;
          Length = 322

 Score = 52.4 bits (124), Expect = 4e-09
 Identities = 32/137 (23%), Positives = 63/137 (45%)

Query: 105 VTDPRNIGSLIRSASSFHIDGLIVKERQFPSDSKLMYKAASGCMEHINIFEVSNINSTLK 164
           ++DPRN+G+++RS ++F   G+++ +R+  S + + ++ +            +N+  TLK
Sbjct: 168 LSDPRNLGAIVRSVAAFGGHGVLIPQRRSASVTAVAWRTSXXXXXXXXXXXXTNLTRTLK 227

Query: 165 NLREKNFWVYGFDARGEKDFTEIKWEGKNVLLFGSEGFGMREHTGKYTDFFVKIDINKDV 224
              ++   V                    V++ GSEG G+     +  D  V I +    
Sbjct: 228 GWADRGVRVIXXXXXXXXXXXXXXXXXSLVVVVGSEGKGLSRLVRQNCDEVVSIPMAAQA 287

Query: 225 ESLNISNSAAIVFHHLS 241
           ESLN S +A +V   ++
Sbjct: 288 ESLNASVAAGVVLAEIA 304


>Y3579_MYCTU RecName: Full=Uncharacterized tRNA/rRNA
           methyltransferase Rv3579c/MT3685;         EC=2.1.1.-;
          Length = 322

 Score = 52.4 bits (124), Expect = 4e-09
 Identities = 32/137 (23%), Positives = 63/137 (45%)

Query: 105 VTDPRNIGSLIRSASSFHIDGLIVKERQFPSDSKLMYKAASGCMEHINIFEVSNINSTLK 164
           ++DPRN+G+++RS ++F   G+++ +R+  S + + ++ +            +N+  TLK
Sbjct: 168 LSDPRNLGAIVRSVAAFGGHGVLIPQRRSASVTAVAWRTSXXXXXXXXXXXXTNLTRTLK 227

Query: 165 NLREKNFWVYGFDARGEKDFTEIKWEGKNVLLFGSEGFGMREHTGKYTDFFVKIDINKDV 224
              ++   V                    V++ GSEG G+     +  D  V I +    
Sbjct: 228 GWADRGVRVIXXXXXXXXXXXXXXXXXSLVVVVGSEGKGLSRLVRQNCDEVVSIPMAAQA 287

Query: 225 ESLNISNSAAIVFHHLS 241
           ESLN S +A +V   ++
Sbjct: 288 ESLNASVAAGVVLAEIA 304


>Y3644_MYCBP RecName: Full=Uncharacterized tRNA/rRNA
           methyltransferase BCG_3644c;         EC=2.1.1.-;
          Length = 322

 Score = 52.0 bits (123), Expect = 6e-09
 Identities = 32/132 (24%), Positives = 61/132 (46%)

Query: 105 VTDPRNIGSLIRSASSFHIDGLIVKERQFPSDSKLMYKAASGCMEHINIFEVSNINSTLK 164
           ++DPRN+G+++RS ++F   G+++ +R+  S + + ++ +            +N+  TLK
Sbjct: 168 LSDPRNLGAIVRSVAAFGGHGVLIPQRRSASVTAVAWRTSXXXXXXXXXXXXTNLTRTLK 227

Query: 165 NLREKNFWVYGFDARGEKDFTEIKWEGKNVLLFGSEGFGMREHTGKYTDFFVKIDINKDV 224
              ++   V                    V++ GSEG G+     +  D  V I +    
Sbjct: 228 GWADRGVRVIXXXXXXXXXXXXXXXXXSLVVVVGSEGKGLSRLVRQNCDEVVSIPMAAQA 287

Query: 225 ESLNISNSAAIV 236
           ESLN S +A +V
Sbjct: 288 ESLNASVAAGVV 299


>Y3610_MYCBO RecName: Full=Uncharacterized tRNA/rRNA
           methyltransferase Mb3610c;         EC=2.1.1.-;
          Length = 402

 Score = 51.2 bits (121), Expect = 9e-09
 Identities = 32/132 (24%), Positives = 61/132 (46%)

Query: 105 VTDPRNIGSLIRSASSFHIDGLIVKERQFPSDSKLMYKAASGCMEHINIFEVSNINSTLK 164
           ++DPRN+G+++RS ++F   G+++ +R+  S + + ++ +            +N+  TLK
Sbjct: 168 LSDPRNLGAIMRSVAAFGGHGVLIPQRRSASVTAVAWRTSXXXXXXXXXXXXTNLTRTLK 227

Query: 165 NLREKNFWVYGFDARGEKDFTEIKWEGKNVLLFGSEGFGMREHTGKYTDFFVKIDINKDV 224
              ++   V                    V++ GSEG G+     +  D  V I +    
Sbjct: 228 GWADRGVRVIXXXXXXXXXXXXXXXXXSLVVVVGSEGKGLSRLVRQNCDEVVSIPMAAQA 287

Query: 225 ESLNISNSAAIV 236
           ESLN S +A +V
Sbjct: 288 ESLNASVAAGVV 299


>Y905_MYCBO RecName: Full=Uncharacterized tRNA/rRNA
           methyltransferase Mb0905;         EC=2.1.1.-;
          Length = 288

 Score = 49.7 bits (117), Expect = 3e-08
 Identities = 35/173 (20%), Positives = 78/173 (45%), Gaps = 8/173 (4%)

Query: 71  MHGGYIAEVEHIDQPDLKEFIKGKNELTFVCIDEVTDPRNIGSLIRSASSFHIDGLIVKE 130
           ++ G +A    + +P + + + G    T   ++ V D  N+GS+ R+A+   +D ++   
Sbjct: 106 LNRGVLAAARRVPEPSVAQVVAGAR--TVAVLEGVNDHENLGSIFRNAAGLSVDAVVFGT 163

Query: 131 RQFPSDSKLMYKAASGCMEHINIFEVSNINSTLKNLREKNFWVYGFDARGE-----KDFT 185
                  +   + + G    +     ++  + L  L+E  F +      G      +   
Sbjct: 164 GCADPLYRRAVRVSMGHALLVPYARAADWPTELMTLKESGFRLLAMTPHGNACKLPEAIA 223

Query: 186 EIKWEGKNVLLFGSEGFGMREHTGKYTDFFVKIDINKDVESLNISNSAAIVFH 238
            +  E +  LL G+EG G+     + +D  V+I +++  +SLN++ +AA+ F+
Sbjct: 224 AVSHE-RIALLVGAEGPGLTAAALRISDVRVRIPMSRGTDSLNVATAAALAFY 275


>Y881_MYCTU RecName: Full=Uncharacterized tRNA/rRNA
           methyltransferase Rv0881/MT0904;         EC=2.1.1.-;
          Length = 288

 Score = 48.9 bits (115), Expect = 5e-08
 Identities = 35/173 (20%), Positives = 78/173 (45%), Gaps = 8/173 (4%)

Query: 71  MHGGYIAEVEHIDQPDLKEFIKGKNELTFVCIDEVTDPRNIGSLIRSASSFHIDGLIVKE 130
           ++ G +A    + +P + + + G    T   ++ V D  N+GS+ R+A+   +D ++   
Sbjct: 106 LNRGVLAAAGRVPEPSVAQVVAGAR--TVAVLEGVNDHENLGSIFRNAAGLSVDAVVFGT 163

Query: 131 RQFPSDSKLMYKAASGCMEHINIFEVSNINSTLKNLREKNFWVYGFDARGE-----KDFT 185
                  +   + + G    +     ++  + L  L+E  F +      G      +   
Sbjct: 164 GCADPLYRRAVRVSMGHALLVPYARAADWPTELMTLKESGFRLLAMTPHGNACKLPEAIA 223

Query: 186 EIKWEGKNVLLFGSEGFGMREHTGKYTDFFVKIDINKDVESLNISNSAAIVFH 238
            +  E +  LL G+EG G+     + +D  V+I +++  +SLN++ +AA+ F+
Sbjct: 224 AVSHE-RIALLVGAEGPGLTAAALRISDVRVRIPMSRGTDSLNVATAAALAFY 275


>RLMB_BURSP RecName: Full=23S rRNA
           (guanosine-2'-O-)-methyltransferase rlmB;       
           EC=2.1.1.-;AltName: Full=23S rRNA Gm2251
           2'-O-methyltransferase;
          Length = 247

 Score = 48.1 bits (113), Expect = 8e-08
 Identities = 42/168 (25%), Positives = 67/168 (39%), Gaps = 6/168 (3%)

Query: 72  HGGYIAEVEHIDQPD----LKEFIKGKNELTFVCIDEVTDPRNIGSLIRSASSFHIDGLI 127
           H G +A V    +      L + I+G+  L  + +D VTDP N+G+ +R A       +I
Sbjct: 69  HQGVVARVTEATRAHSLETLLDTIEGQPLL--LALDGVTDPHNLGACLRVADGAGAHAVI 126

Query: 128 VKERQFPSDSKLMYKAASGCMEHINIFEVSNINSTLKNLREKNFWVYGFDARGEKDFTEI 187
                                E +    V N        +     V G          +I
Sbjct: 127 XXXXXXXXXXXXXXXXXXXXXETVPYLTVINXXXXXXXXKNAGIQVIGTADDATTSLFDI 186

Query: 188 KWEGKNVLLFGSEGFGMREHTGKYTDFFVKIDINKDVESLNISNSAAI 235
           + +G   L+ G+EG GMR  T +  D  V+I +   V+SLN+S ++ I
Sbjct: 187 QLDGALALVMGAEGAGMRRLTREACDEVVRIPLAGHVQSLNVSVASGI 234


>Y521_MYCPN RecName: Full=Uncharacterized tRNA/rRNA
           methyltransferase MG346 homolog;         EC=2.1.1.-;
          Length = 166

 Score = 47.8 bits (112), Expect = 1e-07
 Identities = 39/146 (26%), Positives = 70/146 (47%), Gaps = 12/146 (8%)

Query: 108 PRNIGSLIRSASSFHIDGLIVKERQFPSDSKLMYKAASGCMEHINIFEVSN----INSTL 163
           P N G+++RS ++F  +  ++K   F  + K M +A   C + + +FE  +    I +T 
Sbjct: 16  PNNTGNIVRSCTAFKANLHLIKPYGFFLNDKRMVRAGLNCWDKVQMFEHKSWEHFIETTP 75

Query: 164 KNLREKNFWVYGFDARGEKDFTEIKWEGKNVL--LFGSEGFGMREH-TGKYTDFFVKIDI 220
            N   K  W+         D   ++ + +  L  +FG E  G+ +    +Y+   V+I I
Sbjct: 76  PN---KAIWLLTKSGTTTPDQINMQTDNREQLYFVFGQETKGLPQTLMEQYSQNQVRIPI 132

Query: 221 NKDVESLNISNSAAIVFHHLSYLKKN 246
              V S+N+SN+ A V +   Y K+N
Sbjct: 133 WNPVRSINLSNTVACVLY--EYAKQN 156


>TRMH_SHIFL RecName: Full=tRNA guanosine-2'-O-methyltransferase;    
               EC=2.1.1.34;AltName: Full=tRNA [Gm18]
           methyltransferase;
          Length = 229

 Score = 44.7 bits (104), Expect = 9e-07
 Identities = 34/150 (22%), Positives = 69/150 (46%), Gaps = 5/150 (3%)

Query: 100 VCIDEVTDPRNIGSLIRSASSFHIDGLIVKERQFP-SDSKLMYKAASGCMEHINIFEVSN 158
           VC+++V  P N+ ++IR+A +    G+      +P S  + M  AA+G    + +     
Sbjct: 22  VCMEQVHKPHNVSAIIRTADAV---GVHEVHAVWPGSRMRTMASAAAGSNSWVQVKTHRT 78

Query: 159 INSTLKNLREKNFWVYGFDARGEK-DFTEIKWEGKNVLLFGSEGFGMREHTGKYTDFFVK 217
           I   + +L+ +   +          DF EI +     +L G E  G+ +      D  + 
Sbjct: 79  IGDAVAHLKGQGMQILATHLSDNAVDFREIDYTRPTCILMGQEKTGITQEALALADQDII 138

Query: 218 IDINKDVESLNISNSAAIVFHHLSYLKKNS 247
           I +   V+SLN+S ++A++ +     ++N+
Sbjct: 139 IPMIGMVQSLNVSVASALILYEAQRQRQNA 168


>TRMH_ECOLI RecName: Full=tRNA guanosine-2'-O-methyltransferase;    
               EC=2.1.1.34;AltName: Full=tRNA [Gm18]
           methyltransferase;
          Length = 229

 Score = 44.7 bits (104), Expect = 9e-07
 Identities = 34/150 (22%), Positives = 69/150 (46%), Gaps = 5/150 (3%)

Query: 100 VCIDEVTDPRNIGSLIRSASSFHIDGLIVKERQFP-SDSKLMYKAASGCMEHINIFEVSN 158
           VC+++V  P N+ ++IR+A +    G+      +P S  + M  AA+G    + +     
Sbjct: 22  VCMEQVHKPHNVSAIIRTADAV---GVHEVHAVWPGSRMRTMASAAAGSNSWVQVKTHRT 78

Query: 159 INSTLKNLREKNFWVYGFDARGEK-DFTEIKWEGKNVLLFGSEGFGMREHTGKYTDFFVK 217
           I   + +L+ +   +          DF EI +     +L G E  G+ +      D  + 
Sbjct: 79  IGDAVAHLKGQGMQILATHLSDNAVDFREIDYTRPTCILMGQEKTGITQEALALADQDII 138

Query: 218 IDINKDVESLNISNSAAIVFHHLSYLKKNS 247
           I +   V+SLN+S ++A++ +     ++N+
Sbjct: 139 IPMIGMVQSLNVSVASALILYEAQRQRQNA 168


>TRMH_ECO57 RecName: Full=tRNA guanosine-2'-O-methyltransferase;    
               EC=2.1.1.34;AltName: Full=tRNA [Gm18]
           methyltransferase;
          Length = 229

 Score = 44.7 bits (104), Expect = 9e-07
 Identities = 34/150 (22%), Positives = 69/150 (46%), Gaps = 5/150 (3%)

Query: 100 VCIDEVTDPRNIGSLIRSASSFHIDGLIVKERQFP-SDSKLMYKAASGCMEHINIFEVSN 158
           VC+++V  P N+ ++IR+A +    G+      +P S  + M  AA+G    + +     
Sbjct: 22  VCMEQVHKPHNVSAIIRTADAV---GVHEVHAVWPGSRMRTMASAAAGSNSWVQVKTHRT 78

Query: 159 INSTLKNLREKNFWVYGFDARGEK-DFTEIKWEGKNVLLFGSEGFGMREHTGKYTDFFVK 217
           I   + +L+ +   +          DF EI +     +L G E  G+ +      D  + 
Sbjct: 79  IGDAVAHLKGQGMQILATHLSDNAVDFREIDYTRPTCILMGQEKTGITQEALALADQDII 138

Query: 218 IDINKDVESLNISNSAAIVFHHLSYLKKNS 247
           I +   V+SLN+S ++A++ +     ++N+
Sbjct: 139 IPMIGMVQSLNVSVASALILYEAQRQRQNA 168


>Y346_MYCGE RecName: Full=Uncharacterized tRNA/rRNA
           methyltransferase MG346;         EC=2.1.1.-;
          Length = 166

 Score = 44.3 bits (103), Expect = 1e-06
 Identities = 36/145 (24%), Positives = 67/145 (46%), Gaps = 10/145 (6%)

Query: 108 PRNIGSLIRSASSFHIDGLIVKERQFPSDSKLMYKAASGCMEHINIFEVSNINSTLKNLR 167
           P N G+++RS ++F  +  ++K   F  + K M +A   C + I +FE  +    L+   
Sbjct: 16  PNNTGNIVRSCTAFKANLHLIKPYGFFLNDKRMVRAGLNCWDKIQLFEHKSWEHFLQATT 75

Query: 168 E-KNFWVYGFDARGEKDFTEI----KWEGKNVLLFGSEGFGM-REHTGKYTDFFVKIDIN 221
           E K  W+      G+K   +I    K   +   +FG E  G+ +     +    ++I I 
Sbjct: 76  ENKTIWL--LTKSGDKTPDQICMTNKLPNELYFVFGQETKGLPKTIMDNFKQNQIRIPIW 133

Query: 222 KDVESLNISNSAAIVFHHLSYLKKN 246
             V S+N++N+   + +   Y K+N
Sbjct: 134 NSVRSINLANAVVCILY--EYSKQN 156


>YGL3_BACST RecName: Full=Uncharacterized tRNA/rRNA
           methyltransferase in gldA 3'region;       
           EC=2.1.1.-;AltName: Full=ORF3;
          Length = 157

 Score = 43.5 bits (101), Expect = 2e-06
 Identities = 30/135 (22%), Positives = 69/135 (51%), Gaps = 6/135 (4%)

Query: 108 PRNIGSLIRSASSFHIDGLIVKERQFPSDSKLMYKAASGCMEHINIFEVSNINSTLKNLR 167
           P N G++ R+ ++ +    +++   F +D K++ +A     E +NI    +++   +  +
Sbjct: 13  PANTGNIARTCAATNTALHLIRPLGFSTDDKMLRRAGLDYWEFVNIHYYDSLDHFFQQNQ 72

Query: 168 EKNFWVYGFDARGEKDFTEIKWEGKN---VLLFGSEGFGM-REHTGKYTDFFVKIDINKD 223
             +F  Y     G++ +T   +   +     +FG E  G+ +E   +  D  ++I + ++
Sbjct: 73  NGDF--YYITKFGKRYYTSYDFSDPSKEIFFIFGRETTGLPKELLAENEDRCLRIPMTEN 130

Query: 224 VESLNISNSAAIVFH 238
           V +LN+SN+AAI+ +
Sbjct: 131 VRALNLSNTAAILVY 145


>MRM1_MOUSE RecName: Full=rRNA methyltransferase 1, mitochondrial;  
                 EC=2.1.1.-;AltName: Full=Mitochondrial large
           ribosomal RNA ribose methylase;
          Length = 320

 Score = 42.4 bits (98), Expect = 4e-06
 Identities = 20/77 (25%), Positives = 46/77 (59%)

Query: 99  FVCIDEVTDPRNIGSLIRSASSFHIDGLIVKERQFPSDSKLMYKAASGCMEHINIFEVSN 158
           ++ ++ + DPRN+G+++RSA    +D +I  +R     + ++ KA++G ME +++F   +
Sbjct: 145 WLVLEGLQDPRNLGAVMRSAHFLGVDRVITSQRNSCPLTPVVSKASAGAMEVMDVFATPD 204

Query: 159 INSTLKNLREKNFWVYG 175
           +   L+   ++ + V G
Sbjct: 205 LPGFLQAKAQQGWLVVG 221


>Y1673_SYNY3 RecName: Full=Uncharacterized tRNA/rRNA
           methyltransferase slr1673;         EC=2.1.1.-;
          Length = 274

 Score = 42.0 bits (97), Expect = 6e-06
 Identities = 25/137 (18%), Positives = 62/137 (45%)

Query: 102 IDEVTDPRNIGSLIRSASSFHIDGLIVKERQFPSDSKLMYKAASGCMEHINIFEVSNINS 161
           ++ + DP N+G+++R+A++  ++G+ +        S  + ++++G               
Sbjct: 125 LERLQDPGNLGTILRTAAATGVEGIWLTADCVDPTSPKVLRSSAGXXXXXXXXXXXXXXX 184

Query: 162 TLKNLREKNFWVYGFDARGEKDFTEIKWEGKNVLLFGSEGFGMREHTGKYTDFFVKIDIN 221
             +    +   +     +  +   EI ++   +++FGSEG G+     + T   V I   
Sbjct: 185 XXEKFHTQGLQLIATVPQATQTLWEIDFQRPTIVIFGSEGQGLSAPVLELTTHQVAIPQA 244

Query: 222 KDVESLNISNSAAIVFH 238
             VESLN++ +  ++ +
Sbjct: 245 PQVESLNVAIAVGVMLY 261


>TSNR_STRLU RecName: Full=rRNA (adenosine-2'-O-)-methyltransferase; 
                  EC=2.1.1.66;AltName: Full=23S rRNA [AM1067]
           2'-O-methyltransferase;
          Length = 270

 Score = 41.2 bits (95), Expect = 1e-05
 Identities = 37/141 (26%), Positives = 67/141 (47%), Gaps = 3/141 (2%)

Query: 100 VCIDEVTDPRNIGSLIRSASSFHIDGLIVKERQFPSDS-KLMYKAASGCMEHINIFEVSN 158
           V +D V    NIG+++R+ S+    G+++ +    + + + + +A+ G +  + I  ++ 
Sbjct: 119 VLLDGVKIVGNIGAIVRTRSALGAAGIVLVDSGLGTIADRRLIRASRGYVFSLPIV-LAT 177

Query: 159 INSTLKNLREKNFWVYGFDARGEKDFTEIKW-EGKNVLLFGSEGFGMREHTGKYTDFFVK 217
            +  L   R+       F+A G+    E+   + + VL+FGSE  G            V 
Sbjct: 178 RDEALAFFRDGGMRPVVFEADGKLSIGELDGIDERLVLVFGSEKTGPSGEFAGVATESVS 237

Query: 218 IDINKDVESLNISNSAAIVFH 238
           I +N   ESLN+S SA I  H
Sbjct: 238 IPMNPAAESLNVSVSAGIALH 258


>Y424_HAEIN RecName: Full=Uncharacterized tRNA/rRNA
           methyltransferase HI0424;         EC=2.1.1.-;
          Length = 351

 Score = 40.4 bits (93), Expect = 2e-05
 Identities = 35/168 (20%), Positives = 75/168 (44%), Gaps = 7/168 (4%)

Query: 8   IVGQHAVIEALRNPKRKVLKVFLTEESKKNIHRKNPKKNVLEDVKVYFK-SKKELDKYTS 66
           + G++A +         +++++ T +    I        + E+ K Y     +EL + + 
Sbjct: 120 VYGENACLALFAERPESIVRLWATVQMSHKIGEV--LSYLAENKKAYHVVDSEELARVSG 177

Query: 67  KDQIMHGGYIAEVEHIDQPDLKEFIK-GKNELTFVCIDEVTDPRNIGSLIRSASSFHIDG 125
            +   HGG    V+      L+ ++   +NE   V +D V + +NIG ++R+ + F +  
Sbjct: 178 TEH--HGGICLLVKKPRAFTLQGYLDIPRNEDCLVLLDNVNNAQNIGGVLRTCAYFGVKN 235

Query: 126 LIVKERQFPSDSKLMYKAASGCMEHINIFEVSNINSTLKNLREKNFWV 173
           ++    +    +  M + A G  E+I + E   I+S L  LR+  + +
Sbjct: 236 IVADNVENLYSAASM-RVAEGGAEYIRVLEADYIDSALMQLRKSGYQI 282


>TARB1_HUMAN RecName: Full=Probable methyltransferase TARBP1;       
            EC=2.1.1.-;AltName: Full=TAR RNA-binding protein
            1;AltName: Full=TAR RNA-binding protein of 185 kDa;
          Length = 1621

 Score = 40.4 bits (93), Expect = 2e-05
 Identities = 35/148 (23%), Positives = 69/148 (46%), Gaps = 5/148 (3%)

Query: 93   GKNELTFVCIDEVTD-PRNIGSLIRSASSFHIDGLIVKERQFPSDSKLMYKAASGCMEHI 151
            GK+    + +  + D P N+G L R+   F    L+V   Q  SD +  + + S   + +
Sbjct: 1458 GKSISRLIVVASLIDKPTNLGGLCRTCEVFGASVLVVGSLQCISDKQFQHLSVSA-EQWL 1516

Query: 152  NIFEVS--NINSTLKNLREKNFWVYGFDARGEK-DFTEIKWEGKNVLLFGSEGFGMREHT 208
             + EV    +   L+  + + + + G +   +  D T+  +  K++LL G+E  G+  + 
Sbjct: 1517 PLVEVKPPQLIDYLQQKKTEGYTIIGVEQTAKSLDLTQYCFPEKSLLLLGNEREGIPANL 1576

Query: 209  GKYTDFFVKIDINKDVESLNISNSAAIV 236
             +  D  V+I     + SLN+  S A++
Sbjct: 1577 IQQLDVCVEIPQQGIIRSLNVHVSGALL 1604


>Y052_BORBU RecName: Full=Putative tRNA/rRNA methyltransferase
           BB_0052;         EC=2.1.1.-;
          Length = 218

 Score = 38.9 bits (89), Expect = 5e-05
 Identities = 36/155 (23%), Positives = 68/155 (43%), Gaps = 5/155 (3%)

Query: 95  NELTFVCIDEVTDPRNIGSLIRSASSFHIDGLIVKERQFPSDSKLMYKAASGCMEHINIF 154
           N LTFV ++++   +N  + IR+     +  + V E++  +   L      G  + IN+ 
Sbjct: 33  NYLTFV-LEDIFQSQNASATIRTGEILGLSDVHVIEKK--NKHTLNPDVTLGSSQWINLN 89

Query: 155 EVSNINSTLKNLREKNFWVYGFDARGEK-DFTEIKWEGKNVLLFGSEGFGMREHTGKYTD 213
           +  N    +  L+   + +       +  +   +    K  + FG+E  G+        D
Sbjct: 90  KYKNAKFAIDRLKSDGYSIVATSLNPKSINLENLTINNKMAIFFGTELTGLSAEVLGAAD 149

Query: 214 FFVKIDINKDVESLNISNSAAIVFHH-LSYLKKNS 247
            +VKI +    +S NIS + AIV +  L  L+K+S
Sbjct: 150 LYVKIPMYGFTQSYNISVAVAIVMYSLLMRLRKSS 184


>TSNR_STRCN RecName: Full=rRNA (adenosine-2'-O-)-methyltransferase; 
                  EC=2.1.1.66;AltName: Full=23S rRNA [AM1067]
           2'-O-methyltransferase;
          Length = 269

 Score = 38.9 bits (89), Expect = 5e-05
 Identities = 36/144 (25%), Positives = 66/144 (45%), Gaps = 9/144 (6%)

Query: 100 VCIDEVTDPRNIGSLIRSASSFHIDGLIVKERQFPSDS-KLMYKAASGCMEHINIFEVSN 158
           V +D V    NIG+++R++ +    G+I+ +    S + + + +A+ G +  + +  +S 
Sbjct: 119 VVLDGVKIVGNIGAIVRTSLALGASGIILVDSDITSIADRRLQRASRGYVFSLPVV-LSG 177

Query: 159 INSTLKNLREKNFWVYGFDARGEKDFTEIKWEGKN----VLLFGSEGFGMREHTGKYTDF 214
               +  +R+    +    A G+    E+   G N     LLFGSE  G  +   + +  
Sbjct: 178 REEAIAFIRDSGMQLMTLKADGDISVKEL---GDNPDRLALLFGSEKGGPSDLFEEASSA 234

Query: 215 FVKIDINKDVESLNISNSAAIVFH 238
            V I +    ESLN+S S  I  H
Sbjct: 235 SVSIPMMSQTESLNVSVSLGIALH 258


  Database: sws57.9x
    Posted date:  Nov 5, 2009 10:46 AM
  Number of letters in database: 179,409,320
  Number of sequences in database:  510,076
  
Lambda     K      H
   0.318    0.136    0.412 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 510076
Number of Hits to DB: 8,058,819,358
Number of extensions: 331296294
Number of successful extensions: 922967
Number of sequences better than 1.0e-03: 42394
Number of HSP's gapped: 864800
Number of HSP's successfully gapped: 52114
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (20.8 bits)