BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= AAZ22091.1 pubi0 AAZ22091.1 GIB00256CH01 "iron-containing
alcohol dehydrogenase"
         (388 letters)

Database: sws57.9x 
           510,076 sequences; 179,409,320 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DHAT_KLEPN RecName: Full=1,3-propanediol dehydrogenase;         ...   204   8e-55
DHAT_CITFR RecName: Full=1,3-propanediol dehydrogenase;         ...   192   5e-51
GBSB_BACSU RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;   190   2e-50
ADH4_SCHPO RecName: Full=Alcohol dehydrogenase 4;         EC=1.1...   187   1e-49
ADH1_CLOSA RecName: Full=NADPH-dependent butanol dehydrogenase; ...   183   2e-48
ADH2_ZYMMO RecName: Full=Alcohol dehydrogenase 2;         EC=1.1...   178   6e-47
ADH2_ECOLI RecName: Full=Probable alcohol dehydrogenase;        ...   178   8e-47
MEDH_BACMT RecName: Full=NAD-dependent methanol dehydrogenase;  ...   177   1e-46
EUTG_ECOLI RecName: Full=Ethanolamine utilization protein eutG; ...   171   8e-45
FUCO_ECOLI RecName: Full=Lactaldehyde reductase;         EC=1.1....   167   1e-43
FUCO_ECO57 RecName: Full=Lactaldehyde reductase;         EC=1.1....   167   1e-43
EUTG_SALTY RecName: Full=Ethanolamine utilization protein eutG; ...   149   4e-38
ADH4_YEAS7 RecName: Full=Alcohol dehydrogenase 4;         EC=1.1...   149   5e-38
ADH4_YEAST RecName: Full=Alcohol dehydrogenase 4;         EC=1.1...   146   3e-37
ADHE_CLOAB RecName: Full=Aldehyde-alcohol dehydrogenase;Includes...   127   1e-31
HOT_AEDAE RecName: Full=Probable hydroxyacid-oxoacid transhydrog...   122   4e-30
MEDH_RHOER RecName: Full=NDMA-dependent methanol dehydrogenase; ...   122   7e-30
ADH2_ENTHI RecName: Full=Aldehyde-alcohol dehydrogenase 2;Includ...   117   2e-28
HOT_BOVIN RecName: Full=Hydroxyacid-oxoacid transhydrogenase, mi...   114   1e-27
ADHA_CLOAB RecName: Full=NADH-dependent butanol dehydrogenase A;...   112   4e-27
HOT_HUMAN RecName: Full=Hydroxyacid-oxoacid transhydrogenase, mi...   110   2e-26
HOT_PONAB RecName: Full=Hydroxyacid-oxoacid transhydrogenase, mi...   107   1e-25
HOT_RAT RecName: Full=Hydroxyacid-oxoacid transhydrogenase, mito...   105   5e-25
HOT_MOUSE RecName: Full=Hydroxyacid-oxoacid transhydrogenase, mi...   105   5e-25
HOT_DROPS RecName: Full=Probable hydroxyacid-oxoacid transhydrog...   104   1e-24
ADHB_CLOAB RecName: Full=NADH-dependent butanol dehydrogenase B;...   103   2e-24
HOT_ANOGA RecName: Full=Probable hydroxyacid-oxoacid transhydrog...   103   3e-24
HOT_XENTR RecName: Full=Hydroxyacid-oxoacid transhydrogenase, mi...   101   1e-23
HOT_XENLA RecName: Full=Hydroxyacid-oxoacid transhydrogenase, mi...   101   1e-23
ADHE_ECOLI RecName: Full=Aldehyde-alcohol dehydrogenase;Includes...   100   2e-23
ADHE_ECO57 RecName: Full=Aldehyde-alcohol dehydrogenase;Includes...   100   2e-23
HOT_DICDI RecName: Full=Probable hydroxyacid-oxoacid transhydrog...    99   5e-23
TFTE_BURCE RecName: Full=Maleylacetate reductase;         EC=1.3...    99   8e-23
HOT_DROME RecName: Full=Probable hydroxyacid-oxoacid transhydrog...    99   8e-23
HOT_CAEBR RecName: Full=Probable hydroxyacid-oxoacid transhydrog...    93   3e-21
HOT_CAEEL RecName: Full=Probable hydroxyacid-oxoacid transhydrog...    91   1e-20
4HDB_CLOK5 RecName: Full=NAD-dependent 4-hydroxybutyrate dehydro...    91   2e-20
YUGJ_BACSU RecName: Full=Probable NADH-dependent butanol dehydro...    89   8e-20
TFDF_DELAC RecName: Full=Maleylacetate reductase;         EC=1.3...    86   7e-19
TCBF_PSESQ RecName: Full=Maleylacetate reductase;         EC=1.3...    86   7e-19
YUGK_BACSU RecName: Full=Probable NADH-dependent butanol dehydro...    85   9e-19
CLCE_PSEAE RecName: Full=Maleylacetate reductase;         EC=1.3...    77   3e-16
YQHD_ECOLI RecName: Full=Alcohol dehydrogenase yqhD;         EC=...    77   3e-16
TFDF2_RALEJ RecName: Full=Maleylacetate reductase 2;         EC=...    77   3e-16
CLCE_PSESB RecName: Full=Maleylacetate reductase;         EC=1.3...    77   3e-16
TFDF1_RALEJ RecName: Full=Maleylacetate reductase 1;         EC=...    73   5e-15
ADH3_ENTHI RecName: Full=Alcohol dehydrogenase 3;         Short=...    62   6e-12
GLDA_ECOLI RecName: Full=Glycerol dehydrogenase;         Short=G...    52   7e-09
GLDA_ECOL6 RecName: Full=Glycerol dehydrogenase;         Short=G...    52   7e-09
MACA1_RHOOP RecName: Full=Maleylacetate reductase 1;         EC=...    49   1e-07
GLDA_THEMA RecName: Full=Glycerol dehydrogenase;         Short=G...    47   3e-07
GLDA_PSEPU RecName: Full=Glycerol dehydrogenase;         Short=G...    44   3e-06
G1PDH_PYRHO RecName: Full=Glycerol-1-phosphate dehydrogenase [NA...    42   1e-05
GLDA_CITFR RecName: Full=Glycerol dehydrogenase;         Short=G...    40   3e-05
G1PDH_PYRFU RecName: Full=Glycerol-1-phosphate dehydrogenase [NA...    39   1e-04
G1PDH_PICTO RecName: Full=Glycerol-1-phosphate dehydrogenase [NA...    39   1e-04
SCP47_ARATH RecName: Full=Serine carboxypeptidase-like 47;      ...    38   1e-04
G1PDH_METPE RecName: Full=Glycerol-1-phosphate dehydrogenase [NA...    37   3e-04
AROB_CHLCH RecName: Full=3-dehydroquinate synthase;         EC=4...    36   5e-04
G1PDH_METJA RecName: Full=Glycerol-1-phosphate dehydrogenase [NA...    36   6e-04

>DHAT_KLEPN RecName: Full=1,3-propanediol dehydrogenase;       
           EC=1.1.1.202;AltName: Full=3-hydroxypropionaldehyde
           reductase;AltName: Full=1,3-propanediol oxidoreductase;
          Length = 387

 Score =  204 bits (520), Expect = 8e-55
 Identities = 127/390 (32%), Positives = 208/390 (53%), Gaps = 21/390 (5%)

Query: 4   YNWNYPTTMWVGENRINDVASACKNLNIKKPLLVTDNGLA--QSVIVKNTLSILKEGGII 61
           +++  P   + G N I+ V   C+ L  KK LLVTD GL   +   V  TL  L+E GI 
Sbjct: 6   FDYLVPNVNFFGPNAISVVGERCQLLGGKKALLVTDKGLRAIKDGAVDKTLHYLREAGIE 65

Query: 62  AALYSXXXXXXXXXXXXEGADYYKKNNCDGVIAFGGGSGLDVGKAVAFMSGQNLPIWDFE 121
            A++             +G   +++  CD ++  GGGS  D GK +   +     ++ + 
Sbjct: 66  VAIFDGVEPNPKDTNVRDGLAVFRREQCDIIVTVGGGSPHDCGKGIGIAATHEGDLYQYA 125

Query: 122 DVGDNWTKANSDKIAPIIAVPTTAGTGSETGRASVILNEETGVKNIIFHPKFLPSIVILD 181
            +     +  ++ + PI+AV TTAGT SE  R  V+ N ET VK +I   + LPS+ I D
Sbjct: 126 GI-----ETLTNPLPPIVAVNTTAGTASEVTRHCVLTNTETKVKFVIVSWRNLPSVSIND 180

Query: 182 PILTVGLPAKMTAATGMDALAHNLEAYCAPGYHPMADGIALEGMRLIDKWLLEAVSNGSN 241
           P+L +G PA +TAATGMDAL H +EAY +   +P+ D  A++ +RLI + L +AV+ GSN
Sbjct: 181 PLLMIGKPAALTAATGMDALTHAVEAYISKDANPVTDAAAMQAIRLIARNLRQAVALGSN 240

Query: 242 IEARMNMLTAASMGSTAFQK-GLGAIHSLSHPVNALNNIHHGLSNAIFMPYVLTFNKDVI 300
           ++AR NM  A+ +   AF    LG +H+++H +  L ++ HG++NA+ +P+V  +N  +I
Sbjct: 241 LQARENMAYASLLAGMAFNNANLGYVHAMAHQLGGLYDMPHGVANAVLLPHVARYN--LI 298

Query: 301 ENKIIKICDYLELKDRSFDGF---------VNWVLDLRKKLDMPHKLSEVIDEKDFDIDR 351
            N   K  D  EL   +  G          +  +  L   + +P  L + +  K+ D   
Sbjct: 299 ANP-EKFADIAELMGENITGLSTLDAAEKAIAAITRLSMDIGIPQHLRD-LGVKEADFPY 356

Query: 352 LSKMALADPSTGGNPKKLTEDDMRIMYQNS 381
           +++MAL D +   NP+K  E ++  +++ +
Sbjct: 357 MAEMALKDGNAFSNPRKGNEQEIAAIFRQA 386


>DHAT_CITFR RecName: Full=1,3-propanediol dehydrogenase;       
           EC=1.1.1.202;AltName: Full=3-hydroxypropionaldehyde
           reductase;AltName: Full=1,3-propanediol oxidoreductase;
          Length = 387

 Score =  192 bits (487), Expect = 5e-51
 Identities = 122/390 (31%), Positives = 202/390 (51%), Gaps = 21/390 (5%)

Query: 4   YNWNYPTTMWVGENRINDVASACKNLNIKKPLLVTDNGLA--QSVIVKNTLSILKEGGII 61
           +++  P   + G N I+ V   CK L  KK LLVTD GL   +   V  TL+ L+E GI 
Sbjct: 6   FDYLVPNVNFFGPNAISVVGERCKLLGGKKALLVTDKGLRAIKDGAVDKTLTHLREAGID 65

Query: 62  AALYSXXXXXXXXXXXXEGADYYKKNNCDGVIAFGGGSGLDVGKAVAFMSGQNLPIWDFE 121
             ++             +G + ++K +CD ++  GGGS  D GK +   +     ++ + 
Sbjct: 66  VVVFDGVEPNPKDTNVRDGLEVFRKEHCDIIVTVGGGSPHDCGKGIGIAATHEGDLYSYA 125

Query: 122 DVGDNWTKANSDKIAPIIAVPTTAGTGSETGRASVILNEETGVKNIIFHPKFLPSIVILD 181
            +     +  ++ + PI+AV TTAGT SE  R  V+ N +T VK +I   + LPS+ I D
Sbjct: 126 GI-----ETLTNPLPPIVAVNTTAGTASEVTRHCVLTNTKTKVKFVIVSWRNLPSVSIND 180

Query: 182 PILTVGLPAKMTAATGMDALAHNLEAYCAPGYHPMADGIALEGMRLIDKWLLEAVSNGSN 241
           P+L +G PA +TAATGMDAL H +EAY +   +P+ D               +AV+ GSN
Sbjct: 181 PLLMLGKPAPLTAATGMDALTHAVEAYISKDANPVTDXXXXXXXXXXXXXXXQAVALGSN 240

Query: 242 IEARMNMLTAASMGSTAFQK-GLGAIHSLSHPVNALNNIHHGLSNAIFMPYVLTFNKDVI 300
           ++AR NM  A+ +   AF    LG +H+++H +  L ++ HG++NA+ +P+V  +N  +I
Sbjct: 241 LKARENMAYASLLAGMAFNNANLGYVHAMAHQLGGLYDMPHGVANAVLLPHVARYN--LI 298

Query: 301 ENKIIKICDYLELKDRSFDGF---------VNWVLDLRKKLDMPHKLSEVIDEKDFDIDR 351
            N   K  D  E    + DG          ++ +  L   + +P  L + +  K+ D   
Sbjct: 299 ANP-EKFADIAEFMGENTDGLSTMDAAELAIHAIARLSADIGIPQHLRD-LGVKEADFPY 356

Query: 352 LSKMALADPSTGGNPKKLTEDDMRIMYQNS 381
           +++MAL D +   NP+K  E ++  +++ +
Sbjct: 357 MAEMALKDGNAFSNPRKGNEKEIAEIFRQA 386


>GBSB_BACSU RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
          Length = 402

 Score =  190 bits (482), Expect = 2e-50
 Identities = 123/387 (31%), Positives = 191/387 (49%), Gaps = 12/387 (3%)

Query: 1   MQKYN-WNYPTTMWVGENRINDVASACKNLNIKKPLLVTDNGLAQSVIVKNTLSILKEGG 59
           MQK++ +  PT +  G   I         L + K LLVTD G+ ++ +    +  LKE G
Sbjct: 10  MQKFHTFEIPTVIKHGIGAIKHTGEEVAALGVSKALLVTDPGIYKAGVADPVIESLKEAG 69

Query: 60  IIAALYSXXXXXXXXXXXXEGADYYKKNNCDGVIAFGGGSGLDVGKAVAFMSGQNLPIWD 119
           I   L++            EG++ YKK NC+G++A GGGS +D  KA+   +     + D
Sbjct: 70  IEVVLFNKVEPNPPVRLVNEGSELYKKENCNGLVAVGGGSSMDTAKAIGVEATHEGSVLD 129

Query: 120 FEDVGDNWTKANSDKIAPIIAVPTTAGTGSETGRASVILNEETGVKNIIFHPKFLPSIVI 179
           +E       K   ++I P+  +PTTAGTGSE  + +VI +EE   K     P     + I
Sbjct: 130 YEAADGK--KPLENRIPPLTTIPTTAGTGSEVTQWAVITDEEREFKFNTGGPLIAAHLTI 187

Query: 180 LDPILTVGLPAKMTAATGMDALAHNLEAYCAPGYHPMADGIALEGMRLIDKWLLEAVSNG 239
           +DP L V +P  +TA TG+DALAH +E Y      P+ D +AL  +     ++  A ++G
Sbjct: 188 IDPELHVSMPPHVTAMTGIDALAHAIECYTMKFAQPITDAVALMAIEYAAHYIKRAFADG 247

Query: 240 SNIEARMNMLTAASMGSTAF-QKGLGAIHSLSHPVNALNNIHHGLSNAIFMPYVLTFNKD 298
            ++EAR  M  AA +   ++  +  GA H++S  +  +  + HG   A  M  V+ +N  
Sbjct: 248 EDLEARYGMAQAAMLAGLSYGSESAGAAHAMSQTLGGIIPVAHGQCVAAMMGPVMEYNWK 307

Query: 299 VIENKIIKICDYLEL------KDRSFDGFVNWVLDLRKKLDMPHKLSEVIDEKDFDIDRL 352
               K  +I     +       + +    VNW+ DL + L++P  L E     D  I+RL
Sbjct: 308 GYPEKFARIAKAFGIDTSKMTTEEAAKASVNWMYDLVEDLEVP-TLEEQGVSPDM-IERL 365

Query: 353 SKMALADPSTGGNPKKLTEDDMRIMYQ 379
           SK A+ DP T GNP+ L E     +Y+
Sbjct: 366 SKEAMKDPQTFGNPRDLNEKAYNWIYK 392


>ADH4_SCHPO RecName: Full=Alcohol dehydrogenase 4;       
           EC=1.1.1.1;AltName: Full=Alcohol dehydrogenase IV;Flags:
           Precursor;
          Length = 422

 Score =  187 bits (475), Expect = 1e-49
 Identities = 118/378 (31%), Positives = 196/378 (51%), Gaps = 11/378 (2%)

Query: 9   PTTMWVGENRINDVASACKNLNIKKPLLVTDNGLAQSVIVKNTLSILKEGGIIAALYSXX 68
           P+    G+  + + A   K    K  L+VTD G+ +  +     ++L+E  I   LY   
Sbjct: 52  PSFNLFGKGCLAEAAKQIKMSGFKNTLIVTDPGIIKVGLYDKVKALLEEQSITVHLYDGV 111

Query: 69  XXXXXXXXXXEGADYYKKNNCDGVIAFGGGSGLDVGKAVAFMSGQNLPIWDFEDVGDNWT 128
                     +G +  KK NCD +++ GGGS  D  K +A ++     I D+E V  +  
Sbjct: 112 QPNPTVGNVNQGLEIVKKENCDSMVSIGGGSAHDCAKGIALLATNGGKIADYEGVDKS-- 169

Query: 129 KANSDKIAPIIAVPTTAGTGSETGRASVILNEETGVKNIIFHPKFLPSIVILDPILTVGL 188
              S    P+IA+ TTAGT SE  R ++I  E   +K  I     +P + + DP    GL
Sbjct: 170 ---SKPQLPLIAINTTAGTASEMTRFAIITEETRHIKMAIIDKHTMPILSVNDPETMYGL 226

Query: 189 PAKMTAATGMDALAHNLEAYCAPGYHPMADGIALEGMRLIDKWLLEAVSNGSNIEARMNM 248
           P  +TAATGMDAL H +EAY +   +P+ D  A++ + L++K+L  AV NG + EAR NM
Sbjct: 227 PPSLTAATGMDALTHAVEAYVSTAANPITDACAVKCIELVNKYLKRAVDNGKDEEARDNM 286

Query: 249 LTAASMGSTAFQK-GLGAIHSLSHPVNALNNIHHGLSNAIFMPYVLTFN-KDVIEN-KII 305
             A  +G  AF    LG +H+++H +     I HG+ NA+ + +V  FN +D   N ++ 
Sbjct: 287 AYAEFLGGMAFNNASLGYVHAMAHQLGGFYGIPHGVCNAVLLAHVQKFNSRDPRANARLG 346

Query: 306 KICDYLELKDRSFDGFVNWVLDLRKKLDM-PHKLSEVIDEKDFDIDRLSKMALADPSTGG 364
            I  +L  ++ + +  ++ +  L  ++ + PH +   + EKDFD+  L   A+ D     
Sbjct: 347 DIAFHLGCEEHTAEAALDRISQLVLEVKIRPHLVDLGVKEKDFDV--LVDHAMKDACGAT 404

Query: 365 NPKKLTEDDMRIMYQNSM 382
           NP + T D+++ +++++M
Sbjct: 405 NPIQPTHDEVKAIFKSAM 422


>ADH1_CLOSA RecName: Full=NADPH-dependent butanol dehydrogenase;    
               Short=BDH;         EC=1.1.1.-;
          Length = 388

 Score =  183 bits (465), Expect = 2e-48
 Identities = 120/380 (31%), Positives = 193/380 (50%), Gaps = 17/380 (4%)

Query: 9   PTTMWVGENRINDVASACKNLNIKKPLLVTDNG-LAQSVIVKNTLSILKEGGIIAALYSX 67
           P  ++ G+  +  +    KNL  KK +LV   G + +   V   L  LKE GI   L   
Sbjct: 7   PRDIYYGKGSLEQL----KNLKGKKAMLVLGGGSMKRFGFVDKVLGYLKEAGIEVKLIEG 62

Query: 68  XXXXXXXXXXXEGADYYKKNNCDGVIAFGGGSGLDVGKAVAFMSGQNLPIWDFEDVGDNW 127
                      +GA+  ++   D +IA GGGS +D  KA+        P   F+D+ D +
Sbjct: 63  VEPDPSVETVFKGAELMRQFEPDWIIAMGGGSPIDAAKAMWIFYEH--PEKTFDDIKDPF 120

Query: 128 TKANSDKIAPIIAVPTTAGTGSETGRASVILNEETGVKNIIFHPKFLPSIVILDPILTVG 187
           T       A  +A+P+T+GT +E    SVI + +T +K  +      P + ++D  L   
Sbjct: 121 TVPELRNKAKFLAIPSTSGTATEVTAFSVITDYKTEIKYPLADFNITPDVAVVDSELAET 180

Query: 188 LPAKMTAATGMDALAHNLEAYCAPGYHPMADGIALEGMRLIDKWLLEAVSNGSNIEARMN 247
           +P K+TA TGMDAL H +EAY A  + P  D +A++ + +I++ L ++       EAR  
Sbjct: 181 MPPKLTAHTGMDALTHAIEAYVATLHSPFTDPLAMQAIEMINEHLFKSYEGDK--EAREQ 238

Query: 248 MLTAASMGSTAFQKG-LGAIHSLSHPVNALNNIHHGLSNAIFMPYVLTFNKDVIENKIIK 306
           M  A  +   AF    LG  HS++H   A+ +I HG +NAI++PYV+ FN      +  K
Sbjct: 239 MHYAQCLAGMAFSNALLGICHSMAHKTGAVFHIPHGCANAIYLPYVIKFNSKTSLERYAK 298

Query: 307 ICDYLEL----KDRSFDGFVNWVLDLRKKLDMPHKLSEV-IDEKDF--DIDRLSKMALAD 359
           I   + L     +   D  +N V +L KK+ +P  L E  I E++F   +D +S+ A+ D
Sbjct: 299 IAKQISLAGNTNEELVDSLINLVKELNKKMQIPTTLKEYGIHEQEFKNKVDLISERAIGD 358

Query: 360 PSTGGNPKKLTEDDMRIMYQ 379
             TG NP++L +D+M+ +++
Sbjct: 359 ACTGSNPRQLNKDEMKKIFE 378


>ADH2_ZYMMO RecName: Full=Alcohol dehydrogenase 2;       
           EC=1.1.1.1;AltName: Full=Alcohol dehydrogenase II;      
             Short=ADH II;
          Length = 383

 Score =  178 bits (452), Expect = 6e-47
 Identities = 119/376 (31%), Positives = 189/376 (50%), Gaps = 16/376 (4%)

Query: 13  WVGENRINDVASACKNLN---IKKPLLVTDNGLAQSVIVKNTLSILKEGGIIAALYSXXX 69
           +V E     +  A K+LN    K  L+V+D  + +S +VK    +LK  GI +A+Y    
Sbjct: 10  FVNEMGEGSLEKAIKDLNGSGFKNALIVSDAFMNKSGVVKQVADLLKAQGINSAVYDGVM 69

Query: 70  XXXXXXXXXEGADYYKKNNCDGVIAFGGGSGLDVGKAVAFMSGQNLPIWDFEDVGDNWTK 129
                    EG    K NN D VI+ GGGS  D  KA+A ++     + D+E +  +   
Sbjct: 70  PNPTVTAVLEGLKILKDNNSDFVISLGGGSPHDCAKAIALVATNGGEVKDYEGIDKSKKP 129

Query: 130 ANSDKIAPIIAVPTTAGTGSETGRASVILNEETGVKNIIFHPKFLPSIVILDPILTVGLP 189
           A      P++++ TTAGT SE  R  +I +E   VK  I      P + + DP+L VG+P
Sbjct: 130 A-----LPLMSINTTAGTASEMTRFCIITDEVRHVKMAIVDRHVTPMVSVNDPLLMVGMP 184

Query: 190 AKMTAATGMDALAHNLEAYCAPGYHPMADGIALEGMRLIDKWLLEAVSNGSNIEARMNML 249
             +TAATGMDAL H  EAY +    P+ D  AL+   +I K L  A  NG ++ AR  M 
Sbjct: 185 KGLTAATGMDALTHAFEAYSSTAATPITDACALKAASMIAKNLKTACDNGKDMPAREAMA 244

Query: 250 TAASMGSTAFQK-GLGAIHSLSHPVNALNNIHHGLSNAIFMPYVLTFNKDVIENKIIKI- 307
            A  +   AF    LG +H+++H +    N+ HG+ NA+ +P+VL +N  V+  ++  + 
Sbjct: 245 YAQFLAGMAFNNASLGYVHAMAHQLGGYYNLPHGVCNAVLLPHVLAYNASVVAGRLKDVG 304

Query: 308 ----CDYLELKDR-SFDGFVNWVLDLRKKLDMPHKLSEVIDEKDFDIDRLSKMALADPST 362
                D   L D+   +  +  V DL   + +P  L+E+  +K+ D+  L+  AL D   
Sbjct: 305 VAMGLDIANLGDKEGAEATIQAVRDLAASIGIPANLTELGAKKE-DVPLLADHALKDACA 363

Query: 363 GGNPKKLTEDDMRIMY 378
             NP++  + ++  ++
Sbjct: 364 LTNPRQGDQKEVEELF 379


>ADH2_ECOLI RecName: Full=Probable alcohol dehydrogenase;       
           EC=1.1.1.1;
          Length = 383

 Score =  178 bits (451), Expect = 8e-47
 Identities = 117/382 (30%), Positives = 188/382 (49%), Gaps = 15/382 (3%)

Query: 9   PTTMWVGENRINDVASACKNLNIKKPLLVTDNGLAQSVIVKNTLSILKEGGIIAALYSXX 68
           P+   +G + + D  +   +    + L+VTDN L +  +  +    L+E  I + +Y   
Sbjct: 9   PSVNVIGADSLTDAMNMMADYGFTRTLIVTDNMLTKLGMAGDVQKALEERNIFSVIYDGT 68

Query: 69  XXXXXXXXXXEGADYYKKNNCDGVIAFGGGSGLDVGKAVAFMSGQNLPIWDFEDVGDNWT 128
                      G    K+NNCD VI+ GGGS  D  K +A ++     I D+E V D   
Sbjct: 69  QPNPTTENVAAGLKLLKENNCDSVISLGGGSPHDCAKGIALVAANGGDIRDYEGV-DRSA 127

Query: 129 KANSDKIAPIIAVPTTAGTGSETGRASVILNEETGVKNIIFHPKFLPSIVILDPILTVGL 188
           K       P+IA+ TTAGT SE  R  +I +E   +K  I      P + + D  L +G+
Sbjct: 128 KPQ----LPMIAINTTAGTASEMTRFCIITDEARHIKMAIVDKHVTPLLSVNDSSLMIGM 183

Query: 189 PAKMTAATGMDALAHNLEAYCAPGYHPMADGIALEGMRLIDKWLLEAVSNGSNIEARMNM 248
           P  +TAATGMDAL H +EAY +    P+ D  AL+ + +I + L  AV +GSN +AR  M
Sbjct: 184 PKSLTAATGMDALTHAIEAYVSIAATPITDACALKAVTMIAENLPLAVEDGSNAKAREAM 243

Query: 249 LTAASMGSTAFQK-GLGAIHSLSHPVNALNNIHHGLSNAIFMPYVLTFNKDVIENKIIKI 307
             A  +   AF    LG +H+++H +    N+ HG+ NA+ +P+V  FN  V        
Sbjct: 244 AYAQFLAGMAFNNASLGYVHAMAHQLGGFYNLPHGVCNAVLLPHVQVFNSKVXXXXXXXX 303

Query: 308 CDYLELK------DRSFDGFVNWVLDLRKKLDMPHKLSEV-IDEKDFDIDRLSKMALADP 360
              + +           +  +N + +L KK+D+P  L ++ + E+DF +  L+  AL D 
Sbjct: 304 XXXMGVNVTGKNDAEGAEACINAIRELAKKVDIPAGLRDLNVKEEDFAV--LATNALKDA 361

Query: 361 STGGNPKKLTEDDMRIMYQNSM 382
               NP + T +++  +Y+ +M
Sbjct: 362 CGFTNPIQATHEEIVAIYRAAM 383


>MEDH_BACMT RecName: Full=NAD-dependent methanol dehydrogenase;     
              Short=MEDH;         EC=1.1.1.244;
          Length = 381

 Score =  177 bits (449), Expect = 1e-46
 Identities = 115/388 (29%), Positives = 183/388 (47%), Gaps = 19/388 (4%)

Query: 5   NWNYPTTMWVGENRINDVASACKNLNIKKPLLVTDNGLAQSVIVKNTLSILKEGGIIAAL 64
           N+  P    +G   + +V +  K +  KK L+VTD  L  + + +     ++E G+  A+
Sbjct: 3   NFFIPPASVIGRGAVKEVGTRLKQIGAKKALIVTDAFLHSTGLSEEVAKNIREAGLDVAI 62

Query: 65  YSXXXXXXXXXXXXEGADYYKKNNCDGVIAFGGGSGLDVGKAVAFMSGQNLPIWDFEDVG 124
           +             EG D +K+ NCD +++ GGGS  D  KA+  ++     I D++ V 
Sbjct: 63  FPKAQPDPADTQVHEGVDVFKQENCDALVSIGGGSSHDTAKAIGLVAANGGRINDYQGVN 122

Query: 125 DNWTKANSDKIAPIIAVPTTAGTGSETGRASVILNEETGVKNIIFHPKFLPSIVILDPIL 184
                +                        +VI +    VK  +   K  P++ I+DP L
Sbjct: 123 -----SVEKXXXXXXXXXXXXXXXXXXXXLAVITDSARKVKMPVIDEKITPTVAIVDPEL 177

Query: 185 TVGLPAKMTAATGMDALAHNLEAYCAPGYHPMADGIALEGMRLIDKWLLEAVSNGSNIEA 244
            V  PA +T ATGMDAL+H +EAY A G  P+ D  A++ M+LI+++L +AV+NG +IEA
Sbjct: 178 MVKKPAGLTIATGMDALSHAIEAYVAKGATPVTDAFAIQAMKLINEYLPKAVANGEDIEA 237

Query: 245 RMNMLTAASMGSTAFQK-GLGAIHSLSHPVNALNNIHHGLSNAIFMPYVLTFNKDVIENK 303
           R  M  A  M   AF   GLG +HS+SH V  +  + HG+ N++ MP+V  FN   +  K
Sbjct: 238 REAMAYAQYMAGVAFNNGGLGLVHSISHQVGGVYKLQHGICNSVNMPHVCAFN---LIAK 294

Query: 304 IIKICDYLELKDRSFDGFVNWVLD---------LRKKLDMPHKLSEVIDEKDFDIDRLSK 354
             +     EL   +  G                  K   +P   +E +  K+ DI+ L+K
Sbjct: 295 TERFAHIAELLGENVSGLSTXXXXXXXXXXLERYNKNFGIPSGYAE-MGVKEEDIELLAK 353

Query: 355 MALADPSTGGNPKKLTEDDMRIMYQNSM 382
            A  D  T  NP+  T  D+  + +N++
Sbjct: 354 NAFEDVCTQSNPRVATVQDIAQIIKNAL 381


>EUTG_ECOLI RecName: Full=Ethanolamine utilization protein eutG;    
               EC=1.1.-.-;
          Length = 395

 Score =  171 bits (434), Expect = 8e-45
 Identities = 108/337 (32%), Positives = 171/337 (50%), Gaps = 6/337 (1%)

Query: 6   WNYPTTMWVGENRINDVASACKNLNIKKPLLVTDNGLAQSVIVKNTLSILKEGGIIAALY 65
           ++ P     G   ++      +   +K   ++ D+ L Q+ +       L   GI   L+
Sbjct: 24  FSVPPVTLCGPGSVSSCGQQAQTRGLKHLFVMADSFLHQAGMTAGLTRSLTVKGIAMTLW 83

Query: 66  SXXXXXXXXXXXXEGADYYKKNNCDGVIAFGGGSGLDVGKAVAFMSGQNLPIWDFEDVGD 125
                              +++ CDGVIAFGGGS LD  KAV  +     P     ++ +
Sbjct: 84  PCPVGEPCITDVCAAVAQLRESGCDGVIAFGGGSVLDAAKAVTLLVTN--PDSTLAEMSE 141

Query: 126 NWTKANSDKIAPIIAVPTTAGTGSETGRASVILNEETGVKNIIFHPKFLPSIVILDPILT 185
             T     ++ P+IA+PTTAGTGSET   +VI++  +G K ++ H   +P + ILD  LT
Sbjct: 142 --TSVLQPRL-PLIAIPTTAGTGSETTNVTVIIDAVSGRKQVLAHASLMPDVAILDAALT 198

Query: 186 VGLPAKMTAATGMDALAHNLEAYCAPGYHPMADGIALEGMRLIDKWLLEAVSNGSNIEAR 245
            G+P+ +TA TG+DAL H +EAY A    P  D +A+  + +I K L +AV  G ++ AR
Sbjct: 199 EGVPSHVTAMTGIDALTHAIEAYSALNATPFTDSLAIGAIAMIGKSLPKAVGYGHDLAAR 258

Query: 246 MNMLTAASMGSTAFQK-GLGAIHSLSHPVNALNNIHHGLSNAIFMPYVLTFNKDVIENKI 304
            +ML A+ M   AF   GLG  H+++H   A  +I HGL+NA+ +P V+ FN+ V   + 
Sbjct: 259 ESMLLASCMAGMAFSSAGLGLCHAMAHQPGAALHIPHGLANAMLLPTVMEFNRMVCRERF 318

Query: 305 IKICDYLELKDRSFDGFVNWVLDLRKKLDMPHKLSEV 341
            +I   L  K       +N V +L  ++ +  +L +V
Sbjct: 319 SQIGRALRTKKSDDRDAINAVSELIAEVGIGKRLGDV 355


>FUCO_ECOLI RecName: Full=Lactaldehyde reductase;       
           EC=1.1.1.77;AltName: Full=Propanediol oxidoreductase;
          Length = 383

 Score =  167 bits (423), Expect = 1e-43
 Identities = 114/380 (30%), Positives = 184/380 (48%), Gaps = 17/380 (4%)

Query: 11  TMWVGENRINDVASACKNLNIKKPLLVTDNGLAQSVIVKNTLSILKEGGIIAALYSXXXX 70
           T W G   +  +    K    +K L+VTD  L Q  +V      +   G+  A+Y     
Sbjct: 11  TAWFGRGAVGALTDEVKRRGYQKALIVTDKTLVQCGVVAKVTDKMDAAGLAWAIYDGVVP 70

Query: 71  XXXXXXXXEGADYYKKNNCDGVIAFGGGSGLDVGKAVAFMSGQNLPIWDFEDVG--DNWT 128
                   EG   ++ +  D +IA GGGS  D  KA+  +S  N P  +F DV   +  +
Sbjct: 71  NPTITVVKEGLGVFQNSGADYLIAIGGGSPQDTCKAIGIIS--NNP--EFADVRSLEGLS 126

Query: 129 KANSDKIAPIIAVPTTAGTGSETGRASVILNEETGVKNIIFHPKFLPSIVILDPILTVGL 188
             N   + PI+A+PTTAGT +E     VI +EE   K +   P  +P +  +D  +  G+
Sbjct: 127 PTNKPSV-PILAIPTTAGTAAEVTINYVITDEEKRRKFVCVDPHDIPQVAFIDADMMDGM 185

Query: 189 PAKMTAATGMDALAHNLEAYCAPGYHPMADGIALEGMRLIDKWLLEAVSNGSNIEARMNM 248
           P  + AATG+DAL H +E Y   G   + D + ++ + +I   L  +V+   +    M +
Sbjct: 186 PPALKAATGVDALTHAIEGYITRGAWALTDALHIKAIEIIAGALRGSVAGDKDAGEEMAL 245

Query: 249 -LTAASMGSTAFQKGLGAIHSLSHPVNALNNIHHGLSNAIFMPYVLTFNKDVIENKIIKI 307
               A MG +    GLG +H ++HP+ A  N  HG++NAI +P+V+ +N D    K   I
Sbjct: 246 GQYVAGMGFS--NVGLGLVHGMAHPLGAFYNTPHGVANAILLPHVMRYNADFTGEKYRDI 303

Query: 308 CDYLELK------DRSFDGFVNWVLDLRKKLDMPHKLSEVIDEKDFDIDRLSKMALADPS 361
              + +K      + + +  V  V  L + + +P  L +V   K+ DI  L++ AL D  
Sbjct: 304 ARVMGVKVEGMSLEEARNAAVEAVFALNRDVGIPPHLRDVGVRKE-DIPALAQAALDDVC 362

Query: 362 TGGNPKKLTEDDMRIMYQNS 381
           TGGNP++ T +D+  +Y  +
Sbjct: 363 TGGNPREATLEDIVELYHTA 382


>FUCO_ECO57 RecName: Full=Lactaldehyde reductase;       
           EC=1.1.1.77;AltName: Full=Propanediol oxidoreductase;
          Length = 383

 Score =  167 bits (423), Expect = 1e-43
 Identities = 114/380 (30%), Positives = 184/380 (48%), Gaps = 17/380 (4%)

Query: 11  TMWVGENRINDVASACKNLNIKKPLLVTDNGLAQSVIVKNTLSILKEGGIIAALYSXXXX 70
           T W G   +  +    K    +K L+VTD  L Q  +V      +   G+  A+Y     
Sbjct: 11  TAWFGRGAVGALTDEVKRRGYQKALIVTDKTLVQCGVVAKVTDKMDAAGLAWAIYDGVVP 70

Query: 71  XXXXXXXXEGADYYKKNNCDGVIAFGGGSGLDVGKAVAFMSGQNLPIWDFEDVG--DNWT 128
                   EG   ++ +  D +IA GGGS  D  KA+  +S  N P  +F DV   +  +
Sbjct: 71  NPTITVVKEGLGVFQNSGADYLIAIGGGSPQDTCKAIGIIS--NNP--EFADVRSLEGLS 126

Query: 129 KANSDKIAPIIAVPTTAGTGSETGRASVILNEETGVKNIIFHPKFLPSIVILDPILTVGL 188
             N   + PI+A+PTTAGT +E     VI +EE   K +   P  +P +  +D  +  G+
Sbjct: 127 PTNKPSV-PILAIPTTAGTAAEVTINYVITDEEKRRKFVCVDPHDIPQVAFIDADMMDGM 185

Query: 189 PAKMTAATGMDALAHNLEAYCAPGYHPMADGIALEGMRLIDKWLLEAVSNGSNIEARMNM 248
           P  + AATG+DAL H +E Y   G   + D + ++ + +I   L  +V+   +    M +
Sbjct: 186 PPALKAATGVDALTHAIEGYITRGAWALTDALHIKAIEIIAGALRGSVAGDKDAGEEMAL 245

Query: 249 -LTAASMGSTAFQKGLGAIHSLSHPVNALNNIHHGLSNAIFMPYVLTFNKDVIENKIIKI 307
               A MG +    GLG +H ++HP+ A  N  HG++NAI +P+V+ +N D    K   I
Sbjct: 246 GQYVAGMGFS--NVGLGLVHGMAHPLGAFYNTPHGVANAILLPHVMRYNADFTGEKYRDI 303

Query: 308 CDYLELK------DRSFDGFVNWVLDLRKKLDMPHKLSEVIDEKDFDIDRLSKMALADPS 361
              + +K      + + +  V  V  L + + +P  L +V   K+ DI  L++ AL D  
Sbjct: 304 ARVMGVKVEGMSLEEARNAAVEAVFALNRDVGIPPHLRDVGVRKE-DIPALAQAALDDVC 362

Query: 362 TGGNPKKLTEDDMRIMYQNS 381
           TGGNP++ T +D+  +Y  +
Sbjct: 363 TGGNPREATLEDIVELYHTA 382


>EUTG_SALTY RecName: Full=Ethanolamine utilization protein eutG;    
               EC=1.1.-.-;
          Length = 395

 Score =  149 bits (376), Expect = 4e-38
 Identities = 98/291 (33%), Positives = 148/291 (50%), Gaps = 7/291 (2%)

Query: 89  CDGVIAFGGGSGLDVGKAVAFMSGQNLPIWDFEDVGDNWTKANSDKIAPIIAVPTTAGTG 148
           CDGV+AFGGGS                P      + ++ T        P+IAVPTTAGTG
Sbjct: 107 CDGVVAFGGGSXXXXXXXXXXXXTN--PDQTLSAMTEHSTLRPR---LPLIAVPTTAGTG 161

Query: 149 SETGRASVILNEETGVKNIIFHPKFLPSIVILDPILTVGLPAKMTAATGMDALAHNLEAY 208
           SET   +VI++  +G K ++ H   +P + ILD  +T G+P  +TA TG+DAL H +EAY
Sbjct: 162 SETTNVTVIIDAVSGRKQVLAHASLMPDVAILDAAVTEGVPPNVTAMTGIDALTHAIEAY 221

Query: 209 CAPGYHPMADGIALEGMRLIDKWLLEAVSNGSNIEARMNMLTAASMGSTAFQK-GLGAIH 267
            A    P  D +A+  + +I K L +AV  G ++ AR NML A+ M   AF   GLG  H
Sbjct: 222 SALNATPFTDSLAIGAIAMIGKSLPKAVGYGHDLAARENMLLASCMAGMAFSSAGLGLCH 281

Query: 268 SLSHPVNALNNIHHGLSNAIFMPYVLTFNKDVIENKIIKICDYLELKDRSFDGFVNWVLD 327
           +++H   A  +I HG +NA+ +P V+ FN+ V   +  +I   L  K       +  V +
Sbjct: 282 AMAHQPGAALHIPHGQANAMLLPTVMGFNRMVCRERFSQIGRALTNKKSDDRDAIAAVCE 341

Query: 328 LRKKLDMPHKLSEVIDEKDFDIDRLSKMALADPSTGGNPKKLTEDDMRIMY 378
           L  ++    +L++    K       ++ AL D     NP+  T+  +  +Y
Sbjct: 342 LIAEVGQSKRLADA-GAKPEHYSAWAQAALEDICLRSNPRTATQAQIIDLY 391


>ADH4_YEAS7 RecName: Full=Alcohol dehydrogenase 4;       
           EC=1.1.1.1;AltName: Full=Alcohol dehydrogenase IV;      
             Short=ADHIV;
          Length = 382

 Score =  149 bits (375), Expect = 5e-38
 Identities = 101/370 (27%), Positives = 176/370 (47%), Gaps = 11/370 (2%)

Query: 9   PTTMWVGENRINDVASACKNLNIKKPLLVTDNGLAQSVIVKNTLSILKEGGIIAALYSXX 68
           P   + GE  + + A   KN + KK L+VTD G+A   +      +L+E G+  A+Y   
Sbjct: 10  PPISFFGEGALEETADYIKNKDYKKALIVTDPGIAAIGLSGRVQKMLEERGLNVAIYDKT 69

Query: 69  XXXXXXXXXXEGADYYKKNNCDGVIAFGGGSGLDVGKAVAFMSGQNLPIWDFEDVGDNWT 128
                      G    K+ N + V++ GGGS  D  KA+A ++     I D+E V  +  
Sbjct: 70  QPNPNIANVTAGLKVLKEQNSEIVVSIGGGSAHDNAKAIALLATNGGEIGDYEGVNQSKK 129

Query: 129 KANSDKIAPIIAVPTTAGTGSETGRASVILNEETGVKNIIFHPKFLPSIVILDPILTVGL 188
            A      P+ A+ TTAGT SE  R ++I NEE  +K  I      P++ + DP      
Sbjct: 130 AA-----LPLFAINTTAGTASEMTRFTIISNEEKKIKMAIIDNNVTPAVAVNDPSTMFXX 184

Query: 189 PAKMTAATGMDALAHNLEAYCAPGYHPMADGIALEGMRLIDKWLLEAVSNGSNIEARMNM 248
                         H +EAY +   +P+ D  AL+G+ LI++ L+ A  +G + +AR +M
Sbjct: 185 XXXXXXXXXXXXXXHCIEAYVSTASNPITDACALKGIDLINESLVAAYKDGKDKKARTDM 244

Query: 249 LTAASMGSTAFQK-GLGAIHSLSHPVNALNNIHHGLSNAIFMPYVLTFNKDV--IENKII 305
             A  +   AF    LG +H+L+H +    ++ HG+ NA+ +P+V   N      + ++ 
Sbjct: 245 CYAEYLAGMAFNNASLGYVHALAHQLGGFYHLPHGVCNAVLLPHVQEANMQCPKAKKRLG 304

Query: 306 KICDYLELKDRSFDGFVNWVLDLRKKLDMPHKLSEV-IDEKDFDIDRLSKMALADPSTGG 364
           +I  +        +  +  +  L + +++P  L E+ +  +DF+I  L++ A+ D     
Sbjct: 305 EIALHFGASQEDPEETIKALHVLNRTMNIPRNLKELGVKTEDFEI--LAEHAMHDACHLT 362

Query: 365 NPKKLTEDDM 374
           NP + T++ +
Sbjct: 363 NPVQFTKEQV 372


>ADH4_YEAST RecName: Full=Alcohol dehydrogenase 4;       
           EC=1.1.1.1;AltName: Full=Alcohol dehydrogenase IV;      
             Short=ADHIV;
          Length = 382

 Score =  146 bits (368), Expect = 3e-37
 Identities = 100/370 (27%), Positives = 175/370 (47%), Gaps = 11/370 (2%)

Query: 9   PTTMWVGENRINDVASACKNLNIKKPLLVTDNGLAQSVIVKNTLSILKEGGIIAALYSXX 68
           P   + GE  + + A   KN + KK L+VTD G+A   +      +L+E  +  A+Y   
Sbjct: 10  PPISFFGEGALEETADYIKNKDYKKALIVTDPGIAAIGLSGRVQKMLEERDLNVAIYDKT 69

Query: 69  XXXXXXXXXXEGADYYKKNNCDGVIAFGGGSGLDVGKAVAFMSGQNLPIWDFEDVGDNWT 128
                      G    K+ N + V++ GGGS  D  KA+A ++     I D+E V  +  
Sbjct: 70  QPNPNIANVTAGLKVLKEQNSEIVVSIGGGSAHDNAKAIALLATNGGEIGDYEGVNQSKK 129

Query: 129 KANSDKIAPIIAVPTTAGTGSETGRASVILNEETGVKNIIFHPKFLPSIVILDPILTVGL 188
            A      P+ A+ TTAGT SE  R ++I NEE  +K  I      P++ + DP      
Sbjct: 130 AA-----LPLFAINTTAGTASEMTRFTIISNEEKKIKMAIIDNNVTPAVAVNDPSTMFXX 184

Query: 189 PAKMTAATGMDALAHNLEAYCAPGYHPMADGIALEGMRLIDKWLLEAVSNGSNIEARMNM 248
                         H +EAY +   +P+ D  AL+G+ LI++ L+ A  +G + +AR +M
Sbjct: 185 XXXXXXXXXXXXXXHCIEAYVSTASNPITDACALKGIDLINESLVAAYKDGKDKKARTDM 244

Query: 249 LTAASMGSTAFQK-GLGAIHSLSHPVNALNNIHHGLSNAIFMPYVLTFNKDV--IENKII 305
             A  +   AF    LG +H+L+H +    ++ HG+ NA+ +P+V   N      + ++ 
Sbjct: 245 CYAEYLAGMAFNNASLGYVHALAHQLGGFYHLPHGVCNAVLLPHVQEANMQCPKAKKRLG 304

Query: 306 KICDYLELKDRSFDGFVNWVLDLRKKLDMPHKLSEV-IDEKDFDIDRLSKMALADPSTGG 364
           +I  +        +  +  +  L + +++P  L E+ +  +DF+I  L++ A+ D     
Sbjct: 305 EIALHFGASQEDPEETIKALHVLNRTMNIPRNLKELGVKTEDFEI--LAEHAMHDACHLT 362

Query: 365 NPKKLTEDDM 374
           NP + T++ +
Sbjct: 363 NPVQFTKEQV 372


>ADHE_CLOAB RecName: Full=Aldehyde-alcohol dehydrogenase;Includes:
           RecName: Full=Alcohol dehydrogenase;         
           Short=ADH;           EC=1.1.1.1;
          Length = 862

 Score =  127 bits (320), Expect = 1e-31
 Identities = 95/325 (29%), Positives = 171/325 (52%), Gaps = 38/325 (11%)

Query: 90  DGVIAFGGGSGLDVGKAVAFMSGQNLPIWDFEDVGDN--------WTKANSDKIAPIIAV 141
           D +IA GG   +   K +  +     P   FED+           +T     K A ++A+
Sbjct: 536 DTIIALGGTPEMSSAKLMWVLYEH--PEVKFEDLAIKFMDIRKRIYTFPKLGKKAMLVAI 593

Query: 142 PTTAGTGSETGRASVILNEETGVKNIIFHPKFLPSIVILDPILTVGLPAKMTAATGMDAL 201
            T+AG+GSE    +++ +  TG K ++   +  P++ I+D  L + +P  +TA +G+DAL
Sbjct: 594 TTSAGSGSEVTPFALVTDNNTGNKYMLADYEMTPNMAIVDAELMMKMPKGLTAYSGIDAL 653

Query: 202 AHNLEAYCAPGYHPMADGIALEGMRLIDKWLLEAVSNG-SNIEARMNMLTAASM-GSTAF 259
            +++EAY +       +G+ALE +RLI K+L EA  NG +N +AR  M  A++M G  + 
Sbjct: 654 VNSIEAYTSVYASEYTNGLALEAIRLIFKYLPEAYKNGRTNEKAREKMAHASTMAGMASA 713

Query: 260 QKGLGAIHSLSHPVNALNNIHHGLSNAIFMPYVLTFNKDVIENKI--------------- 304
              LG  HS++  +++ +NI  G++NA+ +  V+ FN   ++N +               
Sbjct: 714 NAFLGLCHSMAIKLSSEHNIPSGIANALLIEEVIKFN--AVDNPVKQAPCPQYKYPNTIF 771

Query: 305 --IKICDYLEL----KDRSFDGFVNWVLDLRKKLDMPHKLSE--VIDEKDF-DIDRLSKM 355
              +I DY++L     +   D  +N + +L+K L++P  + +  V++E  +  +DR+S++
Sbjct: 772 RYARIADYIKLGGNTDEEKVDLLINKIHELKKALNIPTSIKDAGVLEENFYSSLDRISEL 831

Query: 356 ALADPSTGGNPKKLTEDDMRIMYQN 380
           AL D  TG NP+     +++ MY N
Sbjct: 832 ALDDQCTGANPRFPLTSEIKEMYIN 856


>HOT_AEDAE RecName: Full=Probable hydroxyacid-oxoacid
           transhydrogenase, mitochondrial;         Short=HOT;     
              EC=1.1.99.24;Flags: Precursor;
          Length = 462

 Score =  122 bits (307), Expect = 4e-30
 Identities = 113/421 (26%), Positives = 186/421 (44%), Gaps = 54/421 (12%)

Query: 10  TTMWVGENRINDVASACKNLNIKKPLLVTDNGLAQSVIVKNTLSILKEGGIIAALYSXXX 69
           +T+  G     ++    +NLN K   +VTD  +A+   VK     L   GI   +Y    
Sbjct: 47  STIRYGPGVSKELGHDLQNLNAKNVCIVTDRNVAKLNSVKVAFDSLTRCGIQYQVYDETR 106

Query: 70  XXXXXXXXXEGADYYKKNNCDGVIAFGGGSGLDVGK-AVAFMSGQNLPIWDFEDVGDNWT 128
                      A+Y ++N  D  +A GGGS +D  K A  F + +     D+ +      
Sbjct: 107 VEPTDQSLLHAAEYARQNKFDSFVAIGGGSVIDTCKVANLFSADREAEFLDYVNAPIGKA 166

Query: 129 KANSDKIAPIIAVPTTAGTGSETGRASVI----LNEETGVKNIIFHPKFL-PSIVILDPI 183
           K  + K+ P+IAVPTTAGTGSET    +     L+ +TG+ +     K+L P + ++DP+
Sbjct: 167 KEVNVKLKPLIAVPTTAGTGSETTGVVIFDYKPLHAKTGISS-----KYLRPQLGLIDPL 221

Query: 184 LTVGLPAKMTAATGMDALAHNLEAYCA-------------------PGYHPMADGIALEG 224
            T+  P K+ A  G D   H LE++ A                    G +P++D  A   
Sbjct: 222 HTLSQPEKVAAYCGFDVFCHALESFTAIPYTERGSAPMNPNLRPPYQGSNPISDVWARFA 281

Query: 225 MRLIDKWLLEAVSNGSNIEARMNMLTAASMGSTAF-QKGLGAIHSLSHPVNALNN----- 278
           +++I +  + AV N  +++AR NM  A++M    F   G+   H LS+P++         
Sbjct: 282 LKIIRENFISAVFNQDDLKARSNMHLASTMAGVGFGNAGVHLCHGLSYPISGHVKKFVPD 341

Query: 279 --------IHHGLSNAIFMPYVLTFNKDVIENKIIKICDYL----ELKDRSFDGFVNWVL 326
                   I HGLS  +  P V  F       + ++  + L       +R+  G +  + 
Sbjct: 342 GYSGDHPIIPHGLSVVMTAPAVFKFTAASCPERHLEAAELLGANVSKANRNDAGSI--LS 399

Query: 327 DLRKKLDMPHKLSEVIDEKDF---DIDRLSKMAL-ADPSTGGNPKKLTEDDMRIMYQNSM 382
           D+ ++     K+   +D   F   DI  L K  L  +  T   P+  TE+D+  +++NSM
Sbjct: 400 DVVRQYMYKLKIENGLDSLGFTRDDIQSLVKGTLPQERITKLAPRAQTEEDLASLFENSM 459

Query: 383 T 383
           T
Sbjct: 460 T 460


>MEDH_RHOER RecName: Full=NDMA-dependent methanol dehydrogenase;    
               EC=1.1.99.-;
          Length = 423

 Score =  122 bits (305), Expect = 7e-30
 Identities = 100/307 (32%), Positives = 141/307 (45%), Gaps = 25/307 (8%)

Query: 6   WNYP---------TTMWVGENRINDVASACKNLNIKKPLLVTDNGLAQSVIVKNTLSILK 56
           W++P           M VG + I  V +  KNL  K+ LL+T  GL  S I++  +  ++
Sbjct: 8   WDFPIKEFHPFPRALMGVGAHDIIGVEA--KNLGFKRTLLMT-TGLRGSGIIEELVGKIE 64

Query: 57  EGGIIAALYSXXXXXXXXXXXXEGADYYKKNNCDGVIAFGGGSGLDVGKAVAFM---SGQ 113
             G+   LY             E A  Y+K  CD           D  K    +    G+
Sbjct: 65  YQGVEVVLYDKVESNPKDYNVMEAAALYQKEKCDXXXXXXXXXXHDAAKGARVVIAHDGR 124

Query: 114 NLPIWDFEDVGDNWTKANSDKIAPIIAVPTTAGTGSETGRASVILNEE---TGVKNIIFH 170
           N+   +FE    +  K N     P IAV TTAGTGSET  A VI +        K + F 
Sbjct: 125 NIN--EFEGFAKSTNKENP----PHIAVSTTAGTGSETSWAYVITDTSDMNNPHKWVGFD 178

Query: 171 PKFLPSIVILDPILTVGLPAKMTAATGMDALAHNLEAYCAPGYHPMADGIALEGMRLIDK 230
              + ++ I DP+L    P   TA  G D LAH  E + +      + G A+  + L+ K
Sbjct: 179 EATIVTLAIDDPLLYYTCPQHFTAYCGFDVLAHGSEPFVSRLDFAPSLGNAIYSVELVAK 238

Query: 231 WLLEAVSNGSNIEARMNMLTAASMGSTAFQKG-LGAIHSLSHPVNALNNIHHGLSNAIFM 289
            L EAV    N++AR  M+ A  +   AF  G LG +HS+SH V+A  + HHGL+NAI +
Sbjct: 239 NLREAVFEPRNLKAREGMMNAQYIAGQAFNSGGLGIVHSISHAVSAFFDSHHGLNNAIAL 298

Query: 290 PYVLTFN 296
           P V  +N
Sbjct: 299 PRVWEYN 305


>ADH2_ENTHI RecName: Full=Aldehyde-alcohol dehydrogenase 2;Includes:
            RecName: Full=Alcohol dehydrogenase;         
           Short=ADH;           EC=1.1.1.1;
          Length = 870

 Score =  117 bits (293), Expect = 2e-28
 Identities = 75/216 (34%), Positives = 114/216 (52%), Gaps = 13/216 (6%)

Query: 90  DGVIAFGGGSGLDVGKAVAFMSGQNLPIWDFEDVGDNWTKANS--------DKIAPIIAV 141
           D +IA GGGS +D  K +  +     P  DF  +   +              K A +I +
Sbjct: 548 DNIIAIGGGSAMDAAKIMWLLYEH--PEADFFAMKQKFIDLRKRAFKFPTMGKKARLICI 605

Query: 142 PTTAGTGSETGRASVILNEETGVKNIIFHPKFLPSIVILDPILTVGLPAKMTAATGMDAL 201
           PTT+GTGSE    +VI + ETG K  +      PS+ I+DP+ T+ LP +  A TG+D L
Sbjct: 606 PTTSGTGSEVTPFAVISDHETGKKYPLADYSLTPSVAIVDPMFTMSLPKRAIADTGLDVL 665

Query: 202 AHNLEAYCAPGYHPMADGIALEGMRLIDKWLLEAVSNGSNIEARMNMLTAASMGSTAFQK 261
            H  EAY +   +   DG+A E ++L+ + LL+  S   ++EAR  M  AA++   AF  
Sbjct: 666 VHATEAYVSVMANEYTDGLAREAVKLVFENLLK--SYNGDLEAREKMHNAATIAGMAFAS 723

Query: 262 G-LGAIHSLSHPVNALNNIHHGLSNAIFMPYVLTFN 296
             LG  HS++H V A  ++ HG   A+ +P+V+ +N
Sbjct: 724 AFLGMDHSMAHKVGAAFHLPHGRCVAVLLPHVIRYN 759


>HOT_BOVIN RecName: Full=Hydroxyacid-oxoacid transhydrogenase,
           mitochondrial;         Short=HOT;       
           EC=1.1.99.24;AltName: Full=Alcohol dehydrogenase
           iron-containing protein 1;
          Length = 466

 Score =  114 bits (286), Expect = 1e-27
 Identities = 103/414 (24%), Positives = 175/414 (42%), Gaps = 42/414 (10%)

Query: 10  TTMWVGENRINDVASACKNLNIKKPLLVTDNGLAQSVIVKNTLSILKEGGIIAALYSXXX 69
           +T+  G     +V    +++  K   L+TD  L+Q   V+  +  L + GI   +Y    
Sbjct: 51  STIRYGAGVTKEVGMDLQSMGAKNVCLMTDKNLSQLPPVQTVMDSLVKNGINFKVYDHVR 110

Query: 70  XXXXXXXXXEGADYYKKNNCDGVIAFGGGSGLDVGKAV-AFMSGQNLPIWDFEDVGDNWT 128
                    E  ++ KK   D  +A GGGS +D  KA   + S  +    D+ +      
Sbjct: 111 VEPTDTSFMEAIEFAKKGAFDAFLAVGGGSTIDTCKAANLYSSSPDSDFLDYVNAPIGKG 170

Query: 129 KANSDKIAPIIAVPTTAGTGSETGRASVILNEETGVKNIIFHPKFLPSIVILDPILTVGL 188
           K  +  + P+IAVP            ++   E   VK  I      P++ ++DP+ T+ +
Sbjct: 171 KPVTVPLKPLIAVPXXXXXXXXXXXVAIFDYEHLKVKTGIASRAIKPTLGLIDPLHTLHM 230

Query: 189 PAKMTAATGMDALAHNLEAYCAPGYH-------------------PMADGIALEGMRLID 229
           P ++ A +G D L H LE+Y A  YH                   P++D  A+  +R++ 
Sbjct: 231 PERVVANSGFDVLCHALESYTALPYHMRSPCPSSPITRPAYQGSNPISDIWAVHALRIVA 290

Query: 230 KWLLEAVSNGSNIEARMNMLTAASMGSTAF-QKGLGAIHSLSHPVNALNN---------- 278
           K+L  A+ N  ++EAR NM  A++     F   G+   H +S+P++ L            
Sbjct: 291 KYLKRAIRNPDDLEARSNMHLASAFAGIGFGNAGVHLCHGMSYPISGLVKTYKAKDYNVD 350

Query: 279 ---IHHGLSNAIFMPYVLTFNKDVIENKIIKICDYLELKDRSF---DGFVNWVLDLRK-- 330
              + HGLS  +  P V TF   +   + +++ + L    R+    D        LRK  
Sbjct: 351 HPLVPHGLSVVLTSPAVFTFTSQMFPERHLEVAEILGADTRTARRPDAGPVLADTLRKFL 410

Query: 331 -KLDMPHKLSEVIDEKDFDIDRLSKMAL-ADPSTGGNPKKLTEDDMRIMYQNSM 382
             LD+   L+  I     DI  L K  L  +  T   P+  +E+D+  +++ SM
Sbjct: 411 FDLDVDDGLA-AIGYSKADIPELVKGTLPQERVTKLAPRPQSEEDLSALFEASM 463


>ADHA_CLOAB RecName: Full=NADH-dependent butanol dehydrogenase A;   
                EC=1.1.1.-;AltName: Full=BDH I;
          Length = 389

 Score =  112 bits (281), Expect = 4e-27
 Identities = 103/399 (25%), Positives = 182/399 (45%), Gaps = 29/399 (7%)

Query: 1   MQKYNWNYPTTMWVGENRINDVASACKNLNIKKPLLVTDNGLAQSVIVKNTLSILKEGGI 60
           M  ++++ PT ++ G+ +I+ +    K    +  ++     + ++ I     +ILKE  I
Sbjct: 1   MLSFDYSIPTKVFFGKGKIDVIGEEIKKYGSRVLIVYGGGSIKRNGIYDRATAILKENNI 60

Query: 61  IAALYSXXXXXXXXXXXXEGADYYKKNNCDGVIAFGGGSGLDVGKAVAFMSGQNLPIWDF 120
                S            +G +  ++NN D V+A GGGS +D  K +A     +   WD 
Sbjct: 61  AFYELSGVEPNPRITTVKKGIEICRENNVDLVLAIGGGSAIDCSKVIAAGVYYDGDTWDM 120

Query: 121 EDVGDNWTKANSDKIAPIIAVPTTAGTGSETGRASVILNEETGVKNIIFHPKFLPSIVIL 180
                  TK     + PI ++ T + TGSE  + +VI N ET  K  + H    P   +L
Sbjct: 121 VKDPSKITK-----VLPIASILTLSATGSEMDQIAVISNMETNEKLGVGHDDMRPKFSVL 175

Query: 181 DPILTVGLPAKMTAATGMDALAHNLEAYCA--PGYHPMADGIALEGMRLIDKWLLEAVSN 238
           DP  T  +P   TAA   D ++H  E+Y +   G + + DGIA   +R   K+   A+  
Sbjct: 176 DPTYTFTVPKNQTAAGTADIMSHTFESYFSGVEGAY-VQDGIAEAILRTCIKYGKIAMEK 234

Query: 239 GSNIEARMNMLTAASMGSTAFQKGLG-----AIHSLSHPVNALNNIHHGLSNAIFMP--- 290
             + EAR N++ A+S+        LG     + H + H ++A  +I HG+  AI  P   
Sbjct: 235 TDDYEARANLMWASSLAINGL-LSLGKDRKWSCHPMEHELSAYYDITHGVGLAILTPNWM 293

Query: 291 -YVLTFNKDVIENKIIKICDYLELKDRSFDGF------VNWVLDLRKKLDMPHKLSEVID 343
            Y+L  N D + +K +     +   D++ D +      +    +    L +P KL EV  
Sbjct: 294 EYIL--NDDTL-HKFVSYGINVWGIDKNKDNYEIAREAIKNTREYFNSLGIPSKLREVGI 350

Query: 344 EKDFDIDRLSKMALADP-STGGNPKKLTEDDMRIMYQNS 381
            KD  ++ ++K A+ +   T G+ + +  +D+  +++ S
Sbjct: 351 GKD-KLELMAKQAVRNSGGTIGSLRPINAEDVLEIFKKS 388


>HOT_HUMAN RecName: Full=Hydroxyacid-oxoacid transhydrogenase,
           mitochondrial;         Short=HOT;       
           EC=1.1.99.24;AltName: Full=Fe-containing alcohol
           dehydrogenase;
          Length = 467

 Score =  110 bits (276), Expect = 2e-26
 Identities = 103/403 (25%), Positives = 172/403 (42%), Gaps = 42/403 (10%)

Query: 21  DVASACKNLNIKKPLLVTDNGLAQSVIVKNTLSILKEGGIIAALYSXXXXXXXXXXXXEG 80
           +V    KN+  K   L+TD  L++   V+  +  L + GI   +Y             E 
Sbjct: 63  EVGMDLKNMGAKNVCLMTDKNLSKLPPVQVAMDSLVKNGIPFTVYDNVRVEPTDSSFMEA 122

Query: 81  ADYYKKNNCDGVIAFGGGSGLDVGKAV-AFMSGQNLPIWDFEDVGDNWTKANSDKIAPII 139
            ++ +K   D  +A GGGS +D  KA   + S  +    D+        K  S  + P+I
Sbjct: 123 IEFAQKGAFDAYVAVGGGSTMDTCKAANLYASSPHSDFLDYVSAPIGKGKPVSVPLKPLI 182

Query: 140 AVPTTAGTGSETGRASVILNEETGVKNIIFHPKFLPSIVILDPILTVGLPAKMTAATGMD 199
           AVP            ++   E   VK  I      P++ ++DP+ T+ +PA++ A +G D
Sbjct: 183 AVPXXXXXXXXXXXVAIFDYEHLKVKIGITSRAIKPTLGLIDPLHTLHMPARVVANSGFD 242

Query: 200 ALAHNLEAYCAPGYH-------------------PMADGIALEGMRLIDKWLLEAVSNGS 240
            L H LE+Y    YH                   P++D  A+  +R++ K+L  AV N  
Sbjct: 243 VLCHALESYTTLPYHLRSPCPSNPITRPAYQGSNPISDIWAIHALRIVAKYLKRAVRNPD 302

Query: 241 NIEARMNMLTAASMGSTAF-QKGLGAIHSLSHPVNALNNIH-------------HGLSNA 286
           ++EAR +M  A++     F   G+   H +S+P++ L  ++             HGLS  
Sbjct: 303 DLEARSHMHLASAFAGIGFGNAGVHLCHGMSYPISGLVKMYKAKDYNVDHPLVPHGLSVV 362

Query: 287 IFMPYVLTFNKDVIENKIIKICDYLELKDRSF---DGFVNWVLDLRK---KLDMPHKLSE 340
           +  P V TF   +   + +++ + L    R+    D  +     LRK    LD+   L+ 
Sbjct: 363 LTSPAVFTFTAQMFPERHLEMAEILGADTRTARIQDAGLVLADTLRKFLFDLDVDDGLAA 422

Query: 341 VIDEKDFDIDRLSKMAL-ADPSTGGNPKKLTEDDMRIMYQNSM 382
           V   K  DI  L K  L  +  T   P   +E+D+  +++ SM
Sbjct: 423 VGYSK-ADIPALVKGTLPQERVTKLAPCPQSEEDLAALFEASM 464


>HOT_PONAB RecName: Full=Hydroxyacid-oxoacid transhydrogenase,
           mitochondrial;         Short=HOT;       
           EC=1.1.99.24;AltName: Full=Alcohol dehydrogenase
           iron-containing protein 1;
          Length = 467

 Score =  107 bits (268), Expect = 1e-25
 Identities = 102/409 (24%), Positives = 171/409 (41%), Gaps = 42/409 (10%)

Query: 15  GENRINDVASACKNLNIKKPLLVTDNGLAQSVIVKNTLSILKEGGIIAALYSXXXXXXXX 74
           G     +V    +N+  K   L+TD  L++   V+  +  L + GI   +Y         
Sbjct: 57  GAGVTKEVGMDLQNMGAKNVCLMTDKNLSKLPPVQVAMDSLVKNGIPFTVYDNVRVEPTD 116

Query: 75  XXXXEGADYYKKNNCDGVIAFGGGSGLDVGKAV-AFMSGQNLPIWDFEDVGDNWTKANSD 133
               E  ++ +K   D  +A GGGS +D   A   + S  +    D+        K  S 
Sbjct: 117 ASFMEAIEFAQKGAFDAYVAVGGGSTMDTCMAANLYASSPHSDFLDYVSAPIGKGKPVSV 176

Query: 134 KIAPIIAVPTTAGTGSETGRASVILNEETGVKNIIFHPKFLPSIVILDPILTVGLPAKMT 193
            + P+IAVP            ++   E   VK  I      P++ ++DP+ T+ +PA++ 
Sbjct: 177 PLKPLIAVPXXXXXXXXXXXVAIFDYEHLKVKIGIASRAIKPTLGLIDPLHTLHMPARVV 236

Query: 194 AATGMDALAHNLEAYCAPGYH-------------------PMADGIALEGMRLIDKWLLE 234
           A +G D L H LE+Y    YH                   P++D  A+  +R++ K+L  
Sbjct: 237 ANSGFDVLCHALESYTTLPYHLRSPCPSNPITRPAYQGSNPISDIWAIHALRIVAKYLKR 296

Query: 235 AVSNGSNIEARMNMLTAASMGSTAF-QKGLGAIHSLSHPVNALNN-------------IH 280
           AV N  ++EAR +M  A++     F   G+   H +S+P++ L               + 
Sbjct: 297 AVRNPDDLEARSHMHLASAFAGIGFGNAGVHLCHGMSYPISGLVKTYKAKDYNVDHPLVP 356

Query: 281 HGLSNAIFMPYVLTFNKDVIENKIIKICDYLELKDRSF---DGFVNWVLDLRK---KLDM 334
           HGLS  +  P V TF   +   + ++  + L    R+    D  +     LRK    LD+
Sbjct: 357 HGLSVVLTSPAVFTFTAQMFPERHLETAEILGADTRTARIQDAGLVLADTLRKFLFDLDV 416

Query: 335 PHKLSEVIDEKDFDIDRLSKMAL-ADPSTGGNPKKLTEDDMRIMYQNSM 382
              L+ V   K  DI  L K  L  +  T   P+  +E+D+  +++ SM
Sbjct: 417 DDGLAAVGYSK-ADIPALVKGTLPQERVTKLAPRPQSEEDLAALFEASM 464


>HOT_RAT RecName: Full=Hydroxyacid-oxoacid transhydrogenase,
           mitochondrial;         Short=HOT;       
           EC=1.1.99.24;AltName: Full=Alcohol dehydrogenase
           iron-containing protein 1;
          Length = 467

 Score =  105 bits (263), Expect = 5e-25
 Identities = 100/409 (24%), Positives = 172/409 (42%), Gaps = 42/409 (10%)

Query: 15  GENRINDVASACKNLNIKKPLLVTDNGLAQSVIVKNTLSILKEGGIIAALYSXXXXXXXX 74
           G     +V    +N+  K   L+TD  L+Q   V+  +  L + GI   +Y         
Sbjct: 57  GAGVTKEVGMDLQNMGAKNVCLMTDKNLSQLPPVQIVMDSLSKNGISFQVYDNVRVEPTD 116

Query: 75  XXXXEGADYYKKNNCDGVIAFGGGSGLDVGKAV-AFMSGQNLPIWDFEDVGDNWTKANSD 133
               +  ++ KK   D  +A GGGS +D  KA   +    +    D+ +      K  + 
Sbjct: 117 GSFMDAIEFAKKGAFDAYVAVGGGSTMDTCKAANLYACSPHSEFLDYVNAPIGKGKPVTV 176

Query: 134 KIAPIIAVPTTAGTGSETGRASVILNEETGVKNIIFHPKFLPSIVILDPILTVGLPAKMT 193
            + P+IAVP            ++   E   VK  I      P++ ++DP+ T+ +P ++ 
Sbjct: 177 PLKPLIAVPXXXXXXXXXXXVAIFDYEHLKVKTGIASRAIKPTLGLVDPLHTLHMPCQVV 236

Query: 194 AATGMDALAHNLEAYCA-------------------PGYHPMADGIALEGMRLIDKWLLE 234
           A +G D L H LE+Y A                    G +P++D  A+  +R++ K+L  
Sbjct: 237 ANSGFDVLCHALESYTAIPYSMRSPCPSNPIQRPAYQGSNPISDIWAVHALRIVAKYLKR 296

Query: 235 AVSNGSNIEARMNMLTAASMGSTAF-QKGLGAIHSLSHPVNALNN-------------IH 280
           AV N  ++EAR +M  A++     F   G+   H +S+P++ L               + 
Sbjct: 297 AVRNPDDLEARSSMHLASAFAGIGFGNAGVHLCHGMSYPISGLVKTYKAKEYNVDHPLVP 356

Query: 281 HGLSNAIFMPYVLTFNKDVIENKIIKICDYLELKDRSF---DGFVNWVLDLRK---KLDM 334
           HGLS  +  P V TF   +   + ++  + L    R+    D        LRK    L++
Sbjct: 357 HGLSVVLTSPAVFTFTAQMFPERHLETAEILGANIRTAKIQDAGPVLADALRKFLFDLNV 416

Query: 335 PHKLSEVIDEKDFDIDRLSKMAL-ADPSTGGNPKKLTEDDMRIMYQNSM 382
              L+ +   KD DI  L K  L  +  T   P+  +E+D+  +++ SM
Sbjct: 417 DDGLAALGYSKD-DIPSLVKGTLPQERVTKLAPRAQSEEDLSALFEASM 464


>HOT_MOUSE RecName: Full=Hydroxyacid-oxoacid transhydrogenase,
           mitochondrial;         Short=HOT;       
           EC=1.1.99.24;AltName: Full=Alcohol dehydrogenase
           iron-containing protein 1;
          Length = 465

 Score =  105 bits (263), Expect = 5e-25
 Identities = 100/409 (24%), Positives = 172/409 (42%), Gaps = 42/409 (10%)

Query: 15  GENRINDVASACKNLNIKKPLLVTDNGLAQSVIVKNTLSILKEGGIIAALYSXXXXXXXX 74
           G     +V    +N+  K   L+TD  L+Q   V+  +  L + GI   +Y         
Sbjct: 55  GAGVTKEVGMDLQNMGAKNVCLMTDKNLSQLPPVQIVMDSLSKNGISFQVYDDVRVEPTD 114

Query: 75  XXXXEGADYYKKNNCDGVIAFGGGSGLDVGKAV-AFMSGQNLPIWDFEDVGDNWTKANSD 133
               +  ++ KK   D  +A GGGS +D  KA   + S  +    D+ +      K  + 
Sbjct: 115 GSFMDAIEFAKKGAFDAYVAVGGGSTMDTCKAANLYASSPHSEFLDYVNAPIGKGKPVTV 174

Query: 134 KIAPIIAVPTTAGTGSETGRASVILNEETGVKNIIFHPKFLPSIVILDPILTVGLPAKMT 193
            + P+IAVP            ++   E   VK  I      P++ ++DP+ T+ +P ++ 
Sbjct: 175 PLKPLIAVPXXXXXXXXXXXVAIFDYEHLKVKTGIASRAIKPTLGLVDPLHTLHMPCQVV 234

Query: 194 AATGMDALAHNLEAYCA-------------------PGYHPMADGIALEGMRLIDKWLLE 234
           A +G D L H LE+Y A                    G +P++D  A+  ++++ K+L  
Sbjct: 235 ANSGFDVLCHALESYTAIPYSMRSPCPSNPIQRPAYQGSNPISDIWAVHALQIVAKYLKR 294

Query: 235 AVSNGSNIEARMNMLTAASMGSTAF-QKGLGAIHSLSHPVNALNN-------------IH 280
           AV N  ++EAR  M  A++     F   G+   H +S+P++ L               + 
Sbjct: 295 AVRNPDDLEARSKMHLASAFAGIGFGNAGVHLCHGMSYPISGLVKTYKAKEYNVDHPLVP 354

Query: 281 HGLSNAIFMPYVLTFNKDVIENKIIKICDYLELKDRSF---DGFVNWVLDLRK---KLDM 334
           HGLS  +  P V TF   +   + ++    L    R+    D  +     LRK    L++
Sbjct: 355 HGLSVVLTSPAVFTFTAQMFPERHLETAGILGANIRTARIQDAGLVLADALRKFLFDLNV 414

Query: 335 PHKLSEVIDEKDFDIDRLSKMAL-ADPSTGGNPKKLTEDDMRIMYQNSM 382
              L+ +   KD DI  L K  L  +  T   P+  +E+D+  +++ SM
Sbjct: 415 DDGLAALGYSKD-DIPSLVKGTLPQERVTKLAPRAQSEEDLSALFEASM 462


>HOT_DROPS RecName: Full=Probable hydroxyacid-oxoacid
           transhydrogenase, mitochondrial;         Short=HOT;     
              EC=1.1.99.24;Flags: Precursor;
          Length = 464

 Score =  104 bits (259), Expect = 1e-24
 Identities = 87/328 (26%), Positives = 133/328 (40%), Gaps = 34/328 (10%)

Query: 21  DVASACKNLNIKKPLLVTDNGLAQSVIVKNTLSILKEGGIIAALYSXXXXXXXXXXXXEG 80
           +V +  +NL  KK  LVTD  +A+   VK  L  L   GI   +Y               
Sbjct: 60  EVGADLRNLGAKKVCLVTDRNVAKLPSVKVALDSLARHGINYEVYDETRVEPTDASLWHA 119

Query: 81  ADYYKKNNCDGVIAFGGGSGLDVGKAV-AFMSGQNLPIWDFEDVGDNWTKANSDKIAPII 139
           ADY ++N  D  +A GGGS +D  KA   F S +     D+ +      K  S K+ P+I
Sbjct: 120 ADYARQNEFDAFLAIGGGSVMDTAKAANLFSSDREAEFLDYVNCPIGKGKEISVKLKPLI 179

Query: 140 AVPTTAGTGSETGRASVILNEETGVKNIIFHPKFLPSIVILDPILTVGLPAKMTAATGMD 199
           A+P            ++   +    K  I      P++ I+DP+ T+  P ++ A  G D
Sbjct: 180 AMPXXXXXXXXXXXVAIFDYKRLHAKTGISSKYLKPTLAIIDPLHTLSQPERVMAFAGFD 239

Query: 200 ALAHNLEAYCAPGY-------------------HPMADGIALEGMRLIDKWLLEAVSNGS 240
              H LE++ A  Y                   +P++D  A   +  I K  + A+    
Sbjct: 240 VFCHALESFTAVDYRERGPAPSDPSLRPTYQGRNPISDVWARFALETIRKNFINAIYEPG 299

Query: 241 NIEARMNMLTAASMGSTAF-QKGLGAIHSLSHPVNA-LNN------------IHHGLSNA 286
           N+EAR  M  A++M    F   G+   H LS+P++  + N            I HGLS  
Sbjct: 300 NLEARSQMHLASTMAGVGFGNAGVHLCHGLSYPISGNVRNYKPAGYTADHALIPHGLSVV 359

Query: 287 IFMPYVLTFNKDVIENKIIKICDYLELK 314
           I  P V  F      ++ ++    L  K
Sbjct: 360 ISAPAVFEFTAPACPDRHLEAAKLLGAK 387


>ADHB_CLOAB RecName: Full=NADH-dependent butanol dehydrogenase B;   
                EC=1.1.1.-;AltName: Full=BDH II;
          Length = 390

 Score =  103 bits (258), Expect = 2e-24
 Identities = 103/407 (25%), Positives = 180/407 (44%), Gaps = 42/407 (10%)

Query: 1   MQKYNWNYPTTMWVGENRINDVASACKNLNIKKPLLVTDNGLAQSVIVKNTLSILKEGGI 60
           M  + ++ PT ++ G+++IN +    K    K  ++     + ++ I    +SIL++  I
Sbjct: 1   MVDFEYSIPTRIFFGKDKINVLGRELKKYGSKVLIVYGGGSIKRNGIYDKAVSILEKNSI 60

Query: 61  IAALYSXXXXXXXXXXXXEGADYYKKNNCDGVIAFGGGSGLDVGKAVAFMSGQNLPIWDF 120
                +            +G    ++N  + V+A GGGS +D  K +A     +   WD 
Sbjct: 61  KFYELAGVEPNPRVTTVEKGVKICRENGVEVVLAIGGGSAIDCAKVIAAACEYDGNPWDI 120

Query: 121 EDVGDNWTKANSDKIAPIIAVPTTAGTGSETGRASVILNEETGVKNIIFHPKFLPSIVIL 180
              G     +   ++ PI ++ T A TGSE    +VI N +T  K I  HP   P   IL
Sbjct: 121 VLDG-----SKIKRVLPIASILTIAATGSEMDTWAVINNMDTNEKLIAAHPDMAPKFSIL 175

Query: 181 DPILTVGLPAKMTAATGMDALAHNLEAYCA---PGYHPMADGIALEGMRLIDKWLLEAVS 237
           DP  T  +P   TAA   D ++H  E Y +     Y  + D +A   +R   K+   A+ 
Sbjct: 176 DPTYTYTVPTNQTAAGTADIMSHIFEVYFSNTKTAY--LQDRMAEALLRTCIKYGGIALE 233

Query: 238 NGSNIEARMNMLTAASM---GSTAFQKGLG-AIHSLSHPVNALNNIHHGLSNAIFMP--- 290
              + EAR N++ A+S+   G   + K    ++H + H ++A  +I HG+  AI  P   
Sbjct: 234 KPDDYEARANLMWASSLAINGLLTYGKDTNWSVHLMEHELSAYYDITHGVGLAILTPNWM 293

Query: 291 -YVLTFNKDVIEN---------KIIKICDYLELKDRSF----DGFVNWVLDLRKKLDMPH 336
            Y+L  N D +            I K  ++ ++  ++     D FVN        L +P 
Sbjct: 294 EYIL--NNDTVYKFVEYGVNVWGIDKEKNHYDIAHQAIQKTRDYFVN-------VLGLPS 344

Query: 337 KLSEV-IDEKDFDIDRLSKMALADPSTGGNPKKLTEDDMRIMYQNSM 382
           +L +V I+E+  DI     + L    T GN + +   ++  +++ S+
Sbjct: 345 RLRDVGIEEEKLDIMAKESVKLTG-GTIGNLRPVNASEVLQIFKKSV 390


>HOT_ANOGA RecName: Full=Probable hydroxyacid-oxoacid
           transhydrogenase, mitochondrial;         Short=HOT;     
              EC=1.1.99.24;Flags: Precursor;
          Length = 464

 Score =  103 bits (257), Expect = 3e-24
 Identities = 84/320 (26%), Positives = 133/320 (41%), Gaps = 34/320 (10%)

Query: 10  TTMWVGENRINDVASACKNLNIKKPLLVTDNGLAQSVIVKNTLSILKEGGIIAALYSXXX 69
           +T+  G     ++    +NL  K   +V+D  + Q   VK  L  +   GI   L+    
Sbjct: 49  STIRYGPGVTRELGHDLQNLGAKSVCVVSDRNVLQLPSVKVGLDAIVRAGIEPVLFDAVR 108

Query: 70  XXXXXXXXXEGADYYKKNNCDGVIAFGGGSGLDVGK-AVAFMSGQNLPIWDFEDVGDNWT 128
                       D+ + +  D  +A GGGS +D  K A  + + +     D+ +V     
Sbjct: 109 VEPTNESLQTAIDFARSHRFDAFVAIGGGSAIDTCKVANLYSADREAEFLDYVNVPIGRA 168

Query: 129 KANSDKIAPIIAVPTTAGTGSETGRASVILNEETGVKNIIFHPKFLPSIVILDPILTVGL 188
           K  +  + P+IAVPTTAGTGSET   ++  ++    K  I      P + ++DP+ T+  
Sbjct: 169 KEVTVPLKPLIAVPTTAGTGSETTGVAIFDHKPLHAKTGISSKALRPILGLVDPLHTLSQ 228

Query: 189 PAKMTAATGMDALAHNLEAYCA-------------------PGYHPMADGIALEGMRLID 229
           P K+ A  G D   H LE++ A                    G +P++D  A   ++ I 
Sbjct: 229 PEKVAAYCGFDVFCHALESFTAIPYTERGPAPANPKLRPPYQGSNPISDVWARFALQTIS 288

Query: 230 KWLLEAVSNGSNIEARMNMLTAASMGSTAF-QKGLGAIHSLSHPVNALNN---------- 278
           +    AV    ++EAR  M  A++M    F   G+   H LS+P+  L            
Sbjct: 289 RHFRRAVYAPDDLEARSQMHLASTMAGVGFGNAGVHLCHGLSYPIAGLVKQFIPDGYTGA 348

Query: 279 ---IHHGLSNAIFMPYVLTF 295
              I HGLS  +  P V  F
Sbjct: 349 HPIIPHGLSVVMTAPSVFRF 368


>HOT_XENTR RecName: Full=Hydroxyacid-oxoacid transhydrogenase,
           mitochondrial;         Short=HOT;       
           EC=1.1.99.24;AltName: Full=Alcohol dehydrogenase
           iron-containing protein 1;
          Length = 463

 Score =  101 bits (252), Expect = 1e-23
 Identities = 79/315 (25%), Positives = 130/315 (41%), Gaps = 34/315 (10%)

Query: 15  GENRINDVASACKNLNIKKPLLVTDNGLAQSVIVKNTLSILKEGGIIAALYSXXXXXXXX 74
           GEN   ++    +NL  +   ++TD  L +   VK  L+ L +  +   LY         
Sbjct: 53  GENVTQEIGMDLQNLGARNVCVMTDRNLVELSPVKAVLNSLVKNNVSFKLYDRVRVEPTD 112

Query: 75  XXXXEGADYYKKNNCDGVIAFGGGSGLDVGKAV-AFMSGQNLPIWDFEDVGDNWTKANSD 133
               +  ++ KK   D  +  GGGS +D  KA   + S       D+ +      KA + 
Sbjct: 113 KSFMDAIEFAKKGQFDAYVGVGGGSVIDTCKAANLYSSSPGADFLDYVNPPIGKGKAVTV 172

Query: 134 KIAPIIAVPTTAGTGSETGRASVILNEETGVKNIIFHPKFLPSIVILDPILTVGLPAKMT 193
            + P+IAVP            ++   EE   K  I      P++ ++DP+ T+ +P ++ 
Sbjct: 173 PLKPLIAVPXXXXXXXXXXXIAIFDYEELKAKTGIASRAIKPTLGLIDPVHTLSMPERVV 232

Query: 194 AATGMDALAHNLEAYCA-------------------PGYHPMADGIALEGMRLIDKWLLE 234
           A +G D L H+LE+Y A                    G +P++D  A   +R++ K+L  
Sbjct: 233 ANSGFDVLCHSLESYTALPYNMRSPCPTNPINRPAYQGSNPISDVWAKHALRIVAKYLKR 292

Query: 235 AVSNGSNIEARMNMLTAASMGSTAF-QKGLGAIHSLSHPVNALNN-------------IH 280
           AV N  + EAR  M  A+S     F   G+   H +S+P+                  + 
Sbjct: 293 AVRNPDDREARFAMHLASSFAGVGFGNAGVHLCHGMSYPIAGHVKTYRAKDYEVDHPLVP 352

Query: 281 HGLSNAIFMPYVLTF 295
           HGLS  +  P V +F
Sbjct: 353 HGLSVVLTSPAVFSF 367


>HOT_XENLA RecName: Full=Hydroxyacid-oxoacid transhydrogenase,
           mitochondrial;         Short=HOT;       
           EC=1.1.99.24;AltName: Full=Alcohol dehydrogenase
           iron-containing protein 1;
          Length = 463

 Score =  101 bits (252), Expect = 1e-23
 Identities = 81/315 (25%), Positives = 132/315 (41%), Gaps = 34/315 (10%)

Query: 15  GENRINDVASACKNLNIKKPLLVTDNGLAQSVIVKNTLSILKEGGIIAALYSXXXXXXXX 74
           GEN   ++    +N   +   ++TD  L++   VK  L+ L + GI   LY         
Sbjct: 53  GENVTQEIGMDLQNWGTRNVCVMTDRNLSELSPVKAVLNSLVKNGINFKLYDSVRVEPTD 112

Query: 75  XXXXEGADYYKKNNCDGVIAFGGGSGLDVGKAV-AFMSGQNLPIWDFEDVGDNWTKANSD 133
               +  ++ KK   D  +A GGGS +D  KA   + S  +    D+ +      KA + 
Sbjct: 113 KSFMDAIEFAKKGQFDAFVAVGGGSVIDTCKAANLYSSSPDSDFLDYVNPPIGKGKAVTV 172

Query: 134 KIAPIIAVPTTAGTGSETGRASVILNEETGVKNIIFHPKFLPSIVILDPILTVGLPAKMT 193
            + P+IAVP            ++   EE   K  I      P++ ++DP  T+ +P ++ 
Sbjct: 173 PLKPLIAVPXXXXXXXXXXXIAIFDYEELKAKTGIASRAIKPTLGLIDPAHTLSMPERVV 232

Query: 194 AATGMDALAHNLEAYCA-------------------PGYHPMADGIALEGMRLIDKWLLE 234
           A +G D L H+LE+Y A                    G +P++D  A   +R++ K+L  
Sbjct: 233 ANSGFDVLCHSLESYTALPYNMRSPCPTNPINRPAYQGSNPISDVWAKHALRIVAKFLKR 292

Query: 235 AVSNGSNIEARMNMLTAASMGSTAF-QKGLGAIHSLSHPVNALNN-------------IH 280
           AV N  + EAR  M  A+S     F   G+   H +S+P+                  + 
Sbjct: 293 AVRNPDDREARFAMHLASSFAGVGFGNAGVHLCHGMSYPIAGHVKTYRAKDYKVDHPLVP 352

Query: 281 HGLSNAIFMPYVLTF 295
           HGLS  +  P V +F
Sbjct: 353 HGLSVVLTSPAVFSF 367


>ADHE_ECOLI RecName: Full=Aldehyde-alcohol dehydrogenase;Includes:
           RecName: Full=Alcohol dehydrogenase;         
           Short=ADH;           EC=1.1.1.1;
          Length = 891

 Score =  100 bits (250), Expect = 2e-23
 Identities = 92/370 (24%), Positives = 160/370 (43%), Gaps = 36/370 (9%)

Query: 32  KKPLLVTDNGLAQSVIVKNTLSILKEGGIIAALYSXXXXXXXXXXXXEGADYYKKNNCDG 91
           K+ L+VTD  L  +       S+LK  G+   ++             +GA+       D 
Sbjct: 480 KRALIVTDRFLFNNGYADQITSVLKAAGVETEVFFEVEADPTLSIVRKGAELANSFKPDV 539

Query: 92  VIAFGGGSGLDVGKAVAFMSGQNLPIWDFEDVGDNWTKANSDKI--------APIIAVPT 143
           +IA GGGS +D  K +  M     P   FE++   +                A +IA   
Sbjct: 540 IIALGGGSPMDAAKIMWVMYEH--PETHFEELALRFMDIRKRIYKFPKMGVKAKMIAXXX 597

Query: 144 TAGTGSETGRASVILNEETGVKNIIFHPKFLPSIVILDPILTVGLPAKMTAATGMDALAH 203
                      +V+ ++ TG K  +      P + I+D  L + +P  + A  G+DA+ H
Sbjct: 598 XXXXXXXXXPFAVVTDDATGQKYPLADYALTPDMAIVDANLVMDMPKSLCAFGGLDAVTH 657

Query: 204 NLEAYCAPGYHPMADGIALEGMRLIDKWLLEAVSNGS-NIEARMNMLT-AASMGSTAFQK 261
            +EAY +      +DG AL+ ++L+ ++L  +   GS N  AR  + +            
Sbjct: 658 AMEAYVSVLASEFSDGQALQALKLLKEYLPASYHEGSKNPVARERVHSXXXXXXXXXXXX 717

Query: 262 GLGAIHSLSHPVNALNNIHHGLSNAIFMPYVLTFN---------------KDVIENKIIK 306
            LG  HS++H + +  +I HGL+NA+ +  V+ +N               +     +  +
Sbjct: 718 XLGVCHSMAHKLGSQFHIPHGLANALLICNVIRYNANDNPTKQTAFSQYDRPQARRRYAE 777

Query: 307 ICDYLELK---DRS---FDGFVNWVLDLRKKLDMPHKLSEV-IDEKDF--DIDRLSKMAL 357
           I D+L L    DR+    +  + W+  L+ +L +P  + E  + E DF  ++D+LS+ A 
Sbjct: 778 IADHLGLSAPGDRTAAKIEKLLAWLETLKAELGIPKSIREAGVQEADFLANVDKLSEDAF 837

Query: 358 ADPSTGGNPK 367
            D  TG NP+
Sbjct: 838 DDQCTGANPR 847


>ADHE_ECO57 RecName: Full=Aldehyde-alcohol dehydrogenase;Includes:
           RecName: Full=Alcohol dehydrogenase;         
           Short=ADH;           EC=1.1.1.1;
          Length = 891

 Score =  100 bits (250), Expect = 2e-23
 Identities = 92/370 (24%), Positives = 160/370 (43%), Gaps = 36/370 (9%)

Query: 32  KKPLLVTDNGLAQSVIVKNTLSILKEGGIIAALYSXXXXXXXXXXXXEGADYYKKNNCDG 91
           K+ L+VTD  L  +       S+LK  G+   ++             +GA+       D 
Sbjct: 480 KRALIVTDRFLFNNGYADQITSVLKAAGVETEVFFEVEADPTLSIVRKGAELANSFKPDV 539

Query: 92  VIAFGGGSGLDVGKAVAFMSGQNLPIWDFEDVGDNWTKANSDKI--------APIIAVPT 143
           +IA GGGS +D  K +  M     P   FE++   +                A +IA   
Sbjct: 540 IIALGGGSPMDAAKIMWVMYEH--PETHFEELALRFMDIRKRIYKFPKMGVKAKMIAXXX 597

Query: 144 TAGTGSETGRASVILNEETGVKNIIFHPKFLPSIVILDPILTVGLPAKMTAATGMDALAH 203
                      +V+ ++ TG K  +      P + I+D  L + +P  + A  G+DA+ H
Sbjct: 598 XXXXXXXXXPFAVVTDDATGQKYPLADYALTPDMAIVDANLVMDMPKSLCAFGGLDAVTH 657

Query: 204 NLEAYCAPGYHPMADGIALEGMRLIDKWLLEAVSNGS-NIEARMNMLT-AASMGSTAFQK 261
            +EAY +      +DG AL+ ++L+ ++L  +   GS N  AR  + +            
Sbjct: 658 AMEAYVSVLASEFSDGQALQALKLLKEYLPASYHEGSKNPVARERVHSXXXXXXXXXXXX 717

Query: 262 GLGAIHSLSHPVNALNNIHHGLSNAIFMPYVLTFN---------------KDVIENKIIK 306
            LG  HS++H + +  +I HGL+NA+ +  V+ +N               +     +  +
Sbjct: 718 XLGVCHSMAHKLGSQFHIPHGLANALLICNVIRYNANDNPTKQTAFSQYDRPQARRRYAE 777

Query: 307 ICDYLELK---DRS---FDGFVNWVLDLRKKLDMPHKLSEV-IDEKDF--DIDRLSKMAL 357
           I D+L L    DR+    +  + W+  L+ +L +P  + E  + E DF  ++D+LS+ A 
Sbjct: 778 IADHLGLSAPGDRTAAKIEKLLAWLETLKAELGIPKSIREAGVQEADFLANVDKLSEDAF 837

Query: 358 ADPSTGGNPK 367
            D  TG NP+
Sbjct: 838 DDQCTGANPR 847


>HOT_DICDI RecName: Full=Probable hydroxyacid-oxoacid
           transhydrogenase, mitochondrial;         Short=HOT;     
              EC=1.1.99.24;Flags: Precursor;
          Length = 547

 Score = 99.4 bits (246), Expect = 5e-23
 Identities = 104/411 (25%), Positives = 173/411 (42%), Gaps = 57/411 (13%)

Query: 28  NLNIKKPLLVTDNGLAQSV------IVKNTLSILKEGGIIAALYSXXXXXXXXXXXXEGA 81
           ++N +  ++ TDN L + V       V   L  L++ GI   +YS            +  
Sbjct: 137 DMNCRNVIVFTDNNLLKLVDTDKESAVAKCLYSLEKCGIKYTIYSDVSIEPTDTSFKDAI 196

Query: 82  DYYKKNNCDGVIAFGGGSGLDVGKAVAFMSGQNLPIWDF-----EDVGDNWTKANSDKIA 136
               K   DGV+A GGGS +D  KA    +       DF       +G         K  
Sbjct: 197 SVMGKGRYDGVVAVGGGSVMDTAKAANLYNSYPPADNDFLAYINPPIGKGLLVPGPLK-R 255

Query: 137 PIIAVPTTAGTGSETGRASVI---LNEETGVKNIIFHPKFLPSIVILDPILTVGLPAKMT 193
           P+IA+PTT GT SET    ++   L +    K  I      P + ++DP   + LP+ + 
Sbjct: 256 PLIAIPTTCGTASETTGVCILDIKLGDGLSAKTGIASRHLKPILGLVDPDNLLTLPSNVA 315

Query: 194 AATGMDALAHNLEAYCA-------------------PGYHPMADGIALEGMRLIDKWLLE 234
            ++G D L H LE++ A                    G +P++D  +L  + ++ K +  
Sbjct: 316 ISSGFDQLCHALESFTAIPFNQRSPRPLAPNQRPSYQGANPVSDVWSLRSLEMLCKNIHR 375

Query: 235 AVSNGSNIEARMNMLTAASMGSTAF-QKGLGAIHSLSHPVNAL--------------NNI 279
            V N ++  AR  M+ AAS     F   G+ A H +S+ ++++              N I
Sbjct: 376 FVLNPNDDYARSQMMLAASYAGLGFGNSGVHACHGMSYSISSMVKDYKPEGYYGLKKNLI 435

Query: 280 HHGLSNAIFMPYVLTFNKDVIENKIIKICDYL--ELKDRSFDG----FVNWVLDLRKKLD 333
            HG S  +  P V  F       + + +   +  ++ + S         N ++ L K L+
Sbjct: 436 PHGQSVILSAPAVFKFTAPSNPERHLLLAKIMGADISNASESDAGVLLSNQIVKLMKLLN 495

Query: 334 MPHKLSEVIDEKDFDIDRLSKMALADPS-TGGNPKKLTEDDMRIMYQNSMT 383
           +P+ L + +  K+ DID L K  L     T   PK+ T DD+  ++++SMT
Sbjct: 496 VPNGL-QALGYKESDIDSLVKGTLPQHRVTKLMPKQATYDDLYKLFKDSMT 545


>TFTE_BURCE RecName: Full=Maleylacetate reductase;       
           EC=1.3.1.32;
          Length = 352

 Score = 98.6 bits (244), Expect = 8e-23
 Identities = 80/296 (27%), Positives = 136/296 (45%), Gaps = 35/296 (11%)

Query: 90  DGVIAFGGGSGLDVGKAVAFMSGQNLPIWDFEDVGDNWTKANSDKIAPIIAVPTTAGTGS 149
           D  +A GGGS   +GKA+A  SG                        PI+++PTT     
Sbjct: 87  DCAVAIGGGSTTGLGKAIALESG-----------------------LPILSIPTTYAGSE 123

Query: 150 ETGRASVILNEETGVKNIIFHPKFLPSIVILDPILTVGLPAKMTAATGMDALAHNLEAYC 209
            T    V  N   GVK      + LP  VI DP LT+GLP +MT ++G++A+AH  E+  
Sbjct: 124 MTPIYGVTDN---GVKQTGRDARVLPRTVIYDPELTLGLPIRMTVSSGLNAIAHAAESLY 180

Query: 210 APGYHPMADGIALEGMRLIDKWLLEAVSNGSNIEARMNMLTAASM-GSTAFQKGLGAIHS 268
           A   +P+   +A EG+R I   L    +N +++ AR + L  A + G+      +G  H 
Sbjct: 181 AHDGNPVIGLMAEEGIRAIGAALTPLQANPADLVARSDALYGAWLCGAVLGAVSMGLHHK 240

Query: 269 LSHPVNALNNIHHGLSNAIFMPYVLTFNKDVIENKIIKICDYLELKDRSFDGFVNWVLDL 328
           L H +    N+ H   + + +P+ L +N       + +I   L +           + DL
Sbjct: 241 LCHTLGGAFNLPHAELHTVILPHALAYNSARASQAMERIARALGVSSAP-----RGLFDL 295

Query: 329 RKKLDMPHKLSEVIDEKDFDIDRLSKMALADPSTGGNPKKLTEDDMRIMYQNSMTG 384
            ++  +P  L+ +   ++  I+  + MA+ +P    NP+ L  D +R++ +++  G
Sbjct: 296 AERSGLPVSLAALGMPRE-GIELAADMAVKNPYP--NPRPLERDAIRVLLEHAYDG 348


>HOT_DROME RecName: Full=Probable hydroxyacid-oxoacid
           transhydrogenase, mitochondrial;         Short=HOT;     
              EC=1.1.99.24;Flags: Precursor;
          Length = 464

 Score = 98.6 bits (244), Expect = 8e-23
 Identities = 87/349 (24%), Positives = 140/349 (40%), Gaps = 44/349 (12%)

Query: 10  TTMWVGENRINDVASACKNLNIKKPLLVTDNGLAQSVIVKNTLSILKEGGIIAALYSXXX 69
           +T+  G     +V +  +NL  +K  LVTD  + Q   VK  L  L   GI   +Y    
Sbjct: 49  STVRFGPGVSAEVGADLRNLGARKVCLVTDKNVVQLPSVKVALDSLARNGINYEVYDETR 108

Query: 70  XXXXXXXXXEGADYYKKNNCDGVIAFGGGSGLDVGKAV-AFMSGQNLPIWDFEDVGDNWT 128
                       ++ +    D  +A GGGS +D  KA   F S  N    D+ +      
Sbjct: 109 VEPTDGSMWHAVEFARGKEFDAFLAIGGGSAMDTAKAANLFSSDANAEFLDYVNCPIGRG 168

Query: 129 KANSDKIAPIIAVPTTAGTGSETGRASVI----LNEETGVKNIIFHPKFL-PSIVILDPI 183
           K  S K+ P+IA+P            ++     L+ +TG+ +     KFL P++ ++DP+
Sbjct: 169 KEISVKLKPLIAMPXXXXXXXXXXXVAIFDYKKLHAKTGISS-----KFLKPTLAVIDPL 223

Query: 184 LTVGLPAKMTAATGMDALAHNLEAYCAPGY-------------------HPMADGIALEG 224
            T+  P ++ A  G D   H LE++ A  Y                   +P++D  A   
Sbjct: 224 HTLSQPQRVMAFAGFDVFCHALESFTAVDYRERGLAPSDPSLRPTYQGRNPVSDVWARFA 283

Query: 225 MRLIDKWLLEAVSNGSNIEARMNMLTAASMGSTAF-QKGLGAIHSLSHPVNALNN----- 278
           +  I K  + A+    N+EAR  M  A++M    F   G+   H LS+P++         
Sbjct: 284 LETIRKNFVNAIYQPDNLEARSQMHLASTMAGVGFGNAGVHLCHGLSYPISGNVRDYKPK 343

Query: 279 --------IHHGLSNAIFMPYVLTFNKDVIENKIIKICDYLELKDRSFD 319
                   I HGLS  I  P V  F      ++ ++    L  + R  +
Sbjct: 344 GYSADHALIPHGLSVVISAPAVFEFTAPACPDRHLEAAQLLGAEVRGVE 392


>HOT_CAEBR RecName: Full=Probable hydroxyacid-oxoacid
           transhydrogenase, mitochondrial;         Short=HOT;     
              EC=1.1.99.24;Flags: Precursor;
          Length = 465

 Score = 93.2 bits (230), Expect = 3e-21
 Identities = 101/418 (24%), Positives = 172/418 (41%), Gaps = 47/418 (11%)

Query: 10  TTMWVGENRINDVASACKNLNIKKPLLVTDNGLAQSVIVKNTLSILKEGGIIAALYSXXX 69
           +T+  G+    ++    +NL  KK LL+TD  +  ++  KN    LK   I   ++    
Sbjct: 49  STLRFGKGVTLEIGYDVRNLGAKKTLLITDKNVQNTIAFKNAEQALKMVNIEYEIFDDVL 108

Query: 70  XXXXXXXXXEGADYYKKNNCDGVIAFGGGSGLDVGKAVAFMSGQNLPIWDFED-VGDNWT 128
                    +   + K    D  IA GGGS +D  KA A  +    P  DF D VG  + 
Sbjct: 109 IEPSEKSMQKAIAFAKSKPFDSFIAVGGGSVIDTTKAAALYASN--PEADFLDFVGPPFG 166

Query: 129 KANSDK--IAPIIAVPTTAGTGSETGRASVILNEETGVKNIIFHPKFLPSIVILDPILTV 186
           K+   K  + P+IAVP             ++   E   K  I      P + ++DP+  +
Sbjct: 167 KSLQPKNPMLPLIAVPXXXXXXXXXXXXXIMDLPEHKCKTGIRLRCIKPYLAVVDPLNVM 226

Query: 187 GLPAKMTAATGMDALAHNLEAYCA-------------------PGYHPMADGIALEGMRL 227
            +P  +   +G D L H LE+Y A                    G +P++D  + E +R+
Sbjct: 227 SMPRNVAIYSGFDVLCHALESYTALPYDQRSPRPARPEVRPVYQGSNPISDVWSREALRI 286

Query: 228 IDKWLLEAVSNGSNIEARMNMLTAASMGSTAF-QKGLGAIHSLSHPVNA----------- 275
           I ++   +V + S+ EAR  ML A+S     F   G+   H LS+P+++           
Sbjct: 287 IGQYFRRSVFDPSDEEARTEMLKASSFAGIGFGNAGVHLCHGLSYPISSQAKGCVAHDYP 346

Query: 276 --LNNIHHGLSNAIFMPYVLTFNKDVIENKIIKICDYL--ELKDRSFDGFVNWVL----- 326
              N I HGLS          F      ++ +     L  ++ + + + +++  L     
Sbjct: 347 QDKNLIPHGLSVMTTAVADFEFTTAACPDRHLVAAQTLGADIPNNADNEYISRTLCDQLR 406

Query: 327 DLRKKLDMPHKLSEVIDEKDFDIDRLSKMAL-ADPSTGGNPKKLTEDDMRIMYQNSMT 383
              K   +P+ L  +  E   DID L++ A  + P+   +PK    D +  +Y+ S+T
Sbjct: 407 GFMKDFGVPNGLKGMGFEYS-DIDHLTEAASHSVPNIVISPKSTDRDIISKLYEKSLT 463


>HOT_CAEEL RecName: Full=Probable hydroxyacid-oxoacid
           transhydrogenase, mitochondrial;         Short=HOT;     
              EC=1.1.99.24;Flags: Precursor;
          Length = 465

 Score = 91.3 bits (225), Expect = 1e-20
 Identities = 80/311 (25%), Positives = 130/311 (41%), Gaps = 38/311 (12%)

Query: 10  TTMWVGENRINDVASACKNLNIKKPLLVTDNGLAQSVIVKNTLSILKEGGIIAALYSXXX 69
           +T+  G+    ++    +NL  KK LL+TD  +  ++  KN    LK   I   ++    
Sbjct: 49  STLRFGKGVTLEIGYDVRNLGAKKTLLITDKNVQNTIAFKNAEQALKMVNIEYEVFDDVL 108

Query: 70  XXXXXXXXXEGADYYKKNNCDGVIAFGGGSGLDVGKAVAFMSGQNLPIWDFED-VGDNWT 128
                    +   + K    D  IA GGGS +D  KA A  +    P  DF D VG  + 
Sbjct: 109 IEPTVNSMQKAIAFAKSKQFDSFIAVGGGSVIDTTKAAALYASN--PEADFLDFVGPPFG 166

Query: 129 KANSDK--IAPIIAVPTTAGTGSETGRASVILNEETGVKNIIFHPKFLPSIVILDPILTV 186
           K+   K  + P+IAVP             ++   E   K  I      P + ++DP+  +
Sbjct: 167 KSMQPKNPMLPLIAVPXXXXXXXXXXXXXIMDLPEHKCKTGIRLRCIKPYLAVVDPLNVM 226

Query: 187 GLPAKMTAATGMDALAHNLEAYCA-------------------PGYHPMADGIALEGMRL 227
            +P  +   +G D L H LE++ A                    G +P++D  + E +R+
Sbjct: 227 SMPRNVAIYSGFDVLCHALESFTALPFDQRSPRPENPGVRPLYQGSNPISDVWSKEALRI 286

Query: 228 IDKWLLEAVSNGSNIEARMNMLTAASMGSTAF-QKGLGAIHSLSHPVNA----------- 275
           I K+   ++ + ++ EAR  ML A+S     F   G+   H LS+P+++           
Sbjct: 287 IGKYFRRSIFDPTDEEARTEMLKASSFAGIGFGNAGVHLCHGLSYPISSQAKSCVADDYP 346

Query: 276 --LNNIHHGLS 284
              N I HGLS
Sbjct: 347 KEKNLIPHGLS 357


>4HDB_CLOK5 RecName: Full=NAD-dependent 4-hydroxybutyrate
           dehydrogenase;         Short=4HBD;         EC=1.1.1.61;
          Length = 371

 Score = 90.5 bits (223), Expect = 2e-20
 Identities = 60/201 (29%), Positives = 100/201 (49%), Gaps = 12/201 (5%)

Query: 92  VIAFGGGSGLDVGKAVAFM-SGQNLPIWDFEDVGDNWTKANSDKIAPIIAVPTTAGTGSE 150
           +IA GGGS +D+ K ++   +  +L +++         K    K   +I VPTT GTGSE
Sbjct: 82  IIAVGGGSVIDIAKILSLKYTDDSLDLFE--------GKVPLVKNKELIIVPTTCGTGSE 133

Query: 151 TGRASVILNEETGVKNIIFHPKFLPSIVILDPILTVGLPAKMTAATGMDALAHNLEAYCA 210
               SV   +    K  I   +   +  +L P    GLP K    + +DAL H  EAY +
Sbjct: 134 VTNVSVAELKRRHTKKGIASDELYATYAVLVPEFIKGLPYKFFVTSSVDALIHATEAYVS 193

Query: 211 PGYHPMADGIALEGMRLIDKWLLEAVSNGSN--IEARMNMLTAASMGSTAF-QKGLGAIH 267
           P  +P  D  +++ M LI    ++ V  G++  +E   + +  ++    AF   G+GA+H
Sbjct: 194 PNANPYTDMFSVKAMELILNGYMQMVEKGNDYRVEIIEDFVIGSNYAGIAFGNAGVGAVH 253

Query: 268 SLSHPVNALNNIHHGLSNAIF 288
           +LS+P+    ++ HG +N +F
Sbjct: 254 ALSYPIGGNYHVPHGEANYLF 274


>YUGJ_BACSU RecName: Full=Probable NADH-dependent butanol
           dehydrogenase 1;         EC=1.1.1.-;
          Length = 387

 Score = 88.6 bits (218), Expect = 8e-20
 Identities = 99/401 (24%), Positives = 171/401 (42%), Gaps = 33/401 (8%)

Query: 1   MQKYNWNYPTTMWVGENRINDVASACKNLNIKKPLLVTDNG-LAQSVIVKNTLSILKEGG 59
           MQ + +  PT +  G   +  +    K    K  LLV   G + +S +    +  L + G
Sbjct: 1   MQNFTYWNPTKLIFGRGEVERLPEELKPYG-KNVLLVYGGGSIKRSGLYDQVIEQLNKAG 59

Query: 60  IIAALYSXXXXXXXXXXXXEGADYYKKNNCDGVIAFGGGSGLDVGKAVAFMSGQNLPIWD 119
                 +            +G    K+ N D ++A GGGS +D  KA+A  +  +   WD
Sbjct: 60  ATVHELAGVEPNPRVSTVNKGVAICKEQNIDFLLAVGGGSVIDCTKAIAAGAKYDGDAWD 119

Query: 120 FEDVGDNWTKANSDKIA-PIIAVPTTAGTGSETGRASVILNEETGVKNIIFHPKFLPSIV 178
                   TK +  K A P   V T A TGSE    SVI N ET  K     P   P   
Sbjct: 120 IV------TKKHQPKDALPFGTVLTLAATGSEMNSGSVITNWETKEKYGWGSPLVFPKFS 173

Query: 179 ILDPILTVGLPAKMTAATGMDALAHNLEAYCAPGYH-----PMADGIALEGMRLIDKWLL 233
           ILDP+ T  +P   T    +D ++H  E Y    +H     P  D +    +R + +   
Sbjct: 174 ILDPVNTFTVPKNHTIYGMVDMMSHVFEQY----FHHVSNTPYQDRMCESLLRTVIETAP 229

Query: 234 EAVSNGSNIEARMNMLTAASMGSTAF----QKGLGAIHSLSHPVNALNNIHHGLSNAIFM 289
           + +++  N E R  +L   ++          +G  A H++ H V+A+ +I H    AI  
Sbjct: 230 KLINDLENYELRETILYTGTIALNGMLSMGARGDWATHNIEHAVSAVYDIPHAGGLAILF 289

Query: 290 P----YVLTFNKDVIENKIIKICDYLEL----KDRSFDGFVNWVLDLRKKLDMPHKLSEV 341
           P    + L+ N   ++   +++ D  E     ++ + +G ++ +      L  P++L++ 
Sbjct: 290 PNWMRHTLSENPARMKQLAVRVFDVEEAGKTDEEIALEG-IDKLSAFWTSLGAPNRLAD- 347

Query: 342 IDEKDFDIDRLSKMALADPSTGGNPKKLTEDDMRIMYQNSM 382
            D  D  +D ++  A+A+  T G  K L ++D+  + + S+
Sbjct: 348 YDINDEQLDTIADKAMAN-GTFGQFKSLNKEDVLSILKASL 387


>TFDF_DELAC RecName: Full=Maleylacetate reductase;       
           EC=1.3.1.32;AltName: Full=Chloromaleylacetate reductase;
          Length = 352

 Score = 85.5 bits (210), Expect = 7e-19
 Identities = 83/372 (22%), Positives = 154/372 (41%), Gaps = 39/372 (10%)

Query: 15  GENRINDVASACKNLNIKKPLLVTDNGLAQSVIVKNTLSILKEGGIIAALYSXXXXXXXX 74
           G  R+  +    K L I++ L+++     Q  +     +++   G +A  +         
Sbjct: 15  GAGRLQSLGEELKLLGIRRVLVISTP--EQRELANQVAALIP--GSVAGFFDRATMHVPS 70

Query: 75  XXXXEGADYYKKNNCDGVIAFGGGSGLDVGKAVAFMSGQNLPIWDFEDVGDNWTKANSDK 134
               + A   ++   D  +A GGGS + + K +A  S                       
Sbjct: 71  QIVDQAASVARELGVDSYVAPGGGSTIGLAKMLALHSS---------------------- 108

Query: 135 IAPIIAVPTTAGTGSETGRASVILNEETGVKNIIFHPKFLPSIVILDPILTVGLPAKMTA 194
             PI+A+PTT      T    V  NE   +K      + L   VI DP LT GLP  ++ 
Sbjct: 109 -LPIVAIPTTYAGSEMTSIYGVTENE---LKKTGRDRRVLARTVIYDPELTFGLPTGISV 164

Query: 195 ATGMDALAHNLEAYCAPGYHPMADGIALEGMRLIDKWLLEAVSNGSNIEARMNMLTAASM 254
            +G++A+AH +E   AP  +P+   +A +G+  + K +    S  +++EAR      A +
Sbjct: 165 TSGLNAIAHAVEGLYAPEVNPILAIMAQQGIAALAKSIPTIRSAPTDLEARSQAQYGAWL 224

Query: 255 -GSTAFQKGLGAIHSLSHPVNALNNIHHGLSNAIFMPYVLTFNKDVIENKIIKICDYLEL 313
            GS      +   H L H +    N+ H  ++ + +P+ L +N   I      + + L  
Sbjct: 225 CGSVLGNVSMALHHKLCHTLGGTFNLPHAETHTVVLPHALAYNTPAIPRANAWLQEALAT 284

Query: 314 KDRSFDGFVNWVLDLRKKLDMPHKLSEVIDEKDFDIDRLSKMALADPSTGGNPKKLTEDD 373
           ++ +       + DL K    P  L + I  K+ D+DR  ++ ++  +   NP+ L +  
Sbjct: 285 REPA-----QALFDLAKSNGAPVSL-QSIGMKEADLDRACELVMS--AQYPNPRPLEKHA 336

Query: 374 MRIMYQNSMTGE 385
           +  + + +  GE
Sbjct: 337 IANLLRRAYLGE 348


>TCBF_PSESQ RecName: Full=Maleylacetate reductase;       
           EC=1.3.1.32;
          Length = 352

 Score = 85.5 bits (210), Expect = 7e-19
 Identities = 83/372 (22%), Positives = 154/372 (41%), Gaps = 39/372 (10%)

Query: 15  GENRINDVASACKNLNIKKPLLVTDNGLAQSVIVKNTLSILKEGGIIAALYSXXXXXXXX 74
           G  R+  +    K L I++ L+++     Q  +     +++   G +A  +         
Sbjct: 15  GAGRLQSLGEELKLLGIRRVLVISTP--EQRELANQVAALIP--GSVAGFFDRATMHVPS 70

Query: 75  XXXXEGADYYKKNNCDGVIAFGGGSGLDVGKAVAFMSGQNLPIWDFEDVGDNWTKANSDK 134
               + A   ++   D  +A GGGS + + K +A  S                       
Sbjct: 71  QIVDQAASVARELGVDSYVAPGGGSTIGLAKMLALHSS---------------------- 108

Query: 135 IAPIIAVPTTAGTGSETGRASVILNEETGVKNIIFHPKFLPSIVILDPILTVGLPAKMTA 194
             PI+A+PTT      T    V  NE   +K      + L   VI DP LT GLP  ++ 
Sbjct: 109 -LPIVAIPTTYAGSEMTSIYGVTENE---LKKTGRDRRVLARTVIYDPELTFGLPTGISV 164

Query: 195 ATGMDALAHNLEAYCAPGYHPMADGIALEGMRLIDKWLLEAVSNGSNIEARMNMLTAASM 254
            +G++A+AH +E   AP  +P+   +A +G+  + K +    S  +++EAR      A +
Sbjct: 165 TSGLNAIAHAVEGLYAPEVNPILAIMAQQGIAALAKSIPTIRSAPTDLEARSQAQYGAWL 224

Query: 255 -GSTAFQKGLGAIHSLSHPVNALNNIHHGLSNAIFMPYVLTFNKDVIENKIIKICDYLEL 313
            GS      +   H L H +    N+ H  ++ + +P+ L +N   I      + + L  
Sbjct: 225 CGSVLGNVSMALHHKLCHTLGGTFNLPHAETHTVVLPHALAYNTPAIPRANAWLQEALAT 284

Query: 314 KDRSFDGFVNWVLDLRKKLDMPHKLSEVIDEKDFDIDRLSKMALADPSTGGNPKKLTEDD 373
           ++ +       + DL K    P  L + I  K+ D+DR  ++ ++  +   NP+ L +  
Sbjct: 285 REPA-----QALFDLAKSNGAPVSL-QSIGMKEADLDRACELVMS--AQYPNPRPLEKHA 336

Query: 374 MRIMYQNSMTGE 385
           +  + + +  GE
Sbjct: 337 IANLLRRAYLGE 348


>YUGK_BACSU RecName: Full=Probable NADH-dependent butanol
           dehydrogenase 2;         EC=1.1.1.-;
          Length = 390

 Score = 85.1 bits (209), Expect = 9e-19
 Identities = 99/408 (24%), Positives = 177/408 (43%), Gaps = 44/408 (10%)

Query: 1   MQKYNWNYPTTMWVGENRINDVASACKNLNIKKPLLVTDNG-LAQSVIVKNTLSILKEGG 59
           M+ + +  PT +  G+ ++  +    K    K  LLV   G + ++ +      ILKE G
Sbjct: 1   MENFTYYNPTKLIFGKGQLEQLRKEFKRYG-KNVLLVYGGGSIKRNGLYDQVTGILKEEG 59

Query: 60  IIAALYSXXXXXXXXXXXXEGADYYKKNNCDGVIAFGGGSGLDVGKAVAFMSGQNLPIWD 119
            +    S            +G    ++++ D ++A GGGS +D  KA+A     +   WD
Sbjct: 60  AVVHELSGVEPNPRLATVEKGIGLCREHDIDFLLAVGGGSVIDCTKAIAAGVKYDGDAWD 119

Query: 120 FEDVGDNWTKANSDKIAPIIAVPTTAGTGSETGRASVILNEETGVKNI----IFHPKFLP 175
                    K  ++   P   V T A TGSE    SVI N ET  K +    + HP+F  
Sbjct: 120 IFS-----KKVTAEDALPFGTVLTLAATGSEMNPDSVITNWETNEKFVWGSNVTHPRF-- 172

Query: 176 SIVILDPILTVGLPAKMTAATGMDALAHNLEAYCAPGYH-----PMADGIALEGMRLIDK 230
              ILDP  T  +P   T    +D ++H  E Y    +H     P+ D +    ++ + +
Sbjct: 173 --SILDPENTFTVPENQTVYGMVDMMSHVFEQY----FHNVENTPLQDRMCFAVLQTVIE 226

Query: 231 WLLEAVSNGSNIEARMNMLTAASMGSTAFQK----GLGAIHSLSHPVNALNNIHHGLSNA 286
              + + +  N E R  +L A ++      +    G  A H++ H V+A+ +I H    A
Sbjct: 227 TAPKLLEDLENYELRETILYAGTIALNGTLQMGYFGDWASHTMEHAVSAVYDIPHAGGLA 286

Query: 287 IFMP----YVLTFNKDVIENKIIKICDY----LELKDRSFDGFVNWVLDLRKKLDMPHKL 338
           I  P    Y L  N    +N ++ + D        K+ + +G ++ +      L  P +L
Sbjct: 287 ILFPNWMRYTLDTNVGRFKNLMLNMFDIDTEGKTDKEIALEG-IDKLSAFWTSLGAPSRL 345

Query: 339 SE--VIDEKDFDIDRLSKMALADPSTG--GNPKKLTEDDMRIMYQNSM 382
           ++  + +EK   ++ ++ +A  +   G  GN +KL +DD+  + + S+
Sbjct: 346 ADYNIGEEK---LELIADIAAKEMEHGGFGNFQKLNKDDVLAILRASL 390


>CLCE_PSEAE RecName: Full=Maleylacetate reductase;       
           EC=1.3.1.32;
          Length = 352

 Score = 77.0 bits (188), Expect = 3e-16
 Identities = 61/239 (25%), Positives = 102/239 (42%), Gaps = 27/239 (11%)

Query: 59  GIIAALYSXXXXXXXXXXXXEGADYYKKNNCDGVIAFGGGSGLDVGKAVAFMSGQNLPIW 118
           G +AA Y             E     + +  +GVIA GGGS + + K VA  +       
Sbjct: 55  GHVAAFYDGATMHVPALVAEEACKIARTSEANGVIAIGGGSTIGLAKIVALRTE------ 108

Query: 119 DFEDVGDNWTKANSDKIAPIIAVPTTAGTGSETGRASVILNEETGVKNIIFHPKFLPSIV 178
                             PI+AVPTT   GSE    S+    E GVK      + +P  V
Sbjct: 109 -----------------LPIVAVPTTYA-GSEM--TSIFGITEGGVKKTGRDARVMPRAV 148

Query: 179 ILDPILTVGLPAKMTAATGMDALAHNLEAYCAPGYHPMADGIALEGMRLIDKWLLEAVSN 238
           I +P LT+ LP  ++  + ++A+AH +E   AP   P+   +A EG+    + +     +
Sbjct: 149 IYEPRLTLELPLSISVTSAINAIAHAVEGLYAPDATPLLTIMAQEGIAATVRAISRMYQS 208

Query: 239 GSNIEARMNMLTAASM-GSTAFQKGLGAIHSLSHPVNALNNIHHGLSNAIFMPYVLTFN 296
             +++AR + L  A +  S      +   H L H +    ++ H  ++ + +P+ L +N
Sbjct: 209 PRDLQARGDALYGAWLCASVVGNVSMALHHKLCHTLGGTLDLPHAQTHTVVLPHALAYN 267


>YQHD_ECOLI RecName: Full=Alcohol dehydrogenase yqhD;       
           EC=1.1.1.-;
          Length = 387

 Score = 76.6 bits (187), Expect = 3e-16
 Identities = 79/305 (25%), Positives = 124/305 (40%), Gaps = 38/305 (12%)

Query: 92  VIAFGGGSGLDVGKAVAFMSG--QNLPIWDFEDVGDNWTKANSDKIAPIIAVPTTAGTGS 149
           ++A GGGS LD  K +A  +   +N+  W     G    K+      P+  V T   TGS
Sbjct: 89  LLAVGGGSVLDGTKFIAAAANYPENIDPWHILQTGGKEIKS----AIPMGCVLTLPATGS 144

Query: 150 ETGRASVILNEETGVKNIIFHPKFLPSIVILDPILTVGLPAKMTAATGMDALAHNLEAYC 209
           E+   +VI  + TG K         P   +LDP+ T  LP +  A   +DA  H +E Y 
Sbjct: 145 ESNAGAVISRKTTGDKQAFHSAHVQPVFAVLDPVYTYTLPPRQVANGVVDAFVHTVEQYV 204

Query: 210 APGYHPMADGIALEGMRLIDKWLLE----AVSNGSNIEARMNMLTAASMGSTAFQKGLG- 264
                        EG+ L    L+E    A+    N + R N++ AA+        G G 
Sbjct: 205 TKPVDAKIQDRFAEGILLT---LIEDGPKALKEPENYDVRANVMWAATQALNGL-IGAGV 260

Query: 265 ----AIHSLSHPVNALNNIHHGLSNAIFMPYVLTFNKDVIENKIIKICDYL-----ELKD 315
               A H L H + A++ + H  + AI +P +    +D    K+++  + +        D
Sbjct: 261 PQDWATHMLGHELTAMHGLDHAQTLAIVLPALWNEKRDTKRAKLLQYAERVWNITEGSDD 320

Query: 316 RSFDGFVNWVLDLRKKLDMPHKLSEVIDEKDFDIDRLSKMALADPSTGGNPKKLTEDDMR 375
              D  +    +  ++L +P  LS      D+ +D  S  AL         KKL E  M 
Sbjct: 321 ERIDAAIAATRNFFEQLGVPTHLS------DYGLDGSSIPALL--------KKLEEHGMT 366

Query: 376 IMYQN 380
            + +N
Sbjct: 367 QLGEN 371


>TFDF2_RALEJ RecName: Full=Maleylacetate reductase 2;       
           EC=1.3.1.32;AltName: Full=Maleylacetate reductase
           II;AltName: Full=Chloromaleylacetate reductase;
          Length = 359

 Score = 76.6 bits (187), Expect = 3e-16
 Identities = 49/160 (30%), Positives = 81/160 (50%), Gaps = 4/160 (2%)

Query: 139 IAVPTTAGTGSETGRASVILNEETGVKNIIFHPKFLPSIVILDPILTVGLPAKMTAATGM 198
           +A+PTT      T    +  +   G K     P+ LPS V+ DP     LP ++T  +GM
Sbjct: 117 VALPTTYAGSEMTPIWGLTAD---GAKRTGRDPRVLPSTVLYDPHHLTSLPPEVTGPSGM 173

Query: 199 DALAHNLEAYCAPGYHPMADGIALEGMRLIDKWLLEAVSNGSNIEARMNMLTAASMGSTA 258
           +A+AH +E+  AP  +P+   +A E +R + + L  AV +  +++AR   L AA +  T 
Sbjct: 174 NAIAHAVESMYAPDRNPITMLLAEESIRAMAQGLPVAVDSPGDLDARTRTLYAAWLAGTV 233

Query: 259 F-QKGLGAIHSLSHPVNALNNIHHGLSNAIFMPYVLTFNK 297
                +G  H L H +    N+ H   +A+ +P+V  FN+
Sbjct: 234 LGMVSMGLHHKLCHVLGGRFNLPHAPMHAVLLPHVAAFNE 273


>CLCE_PSESB RecName: Full=Maleylacetate reductase;       
           EC=1.3.1.32;
          Length = 352

 Score = 76.6 bits (187), Expect = 3e-16
 Identities = 61/239 (25%), Positives = 102/239 (42%), Gaps = 27/239 (11%)

Query: 59  GIIAALYSXXXXXXXXXXXXEGADYYKKNNCDGVIAFGGGSGLDVGKAVAFMSGQNLPIW 118
           G +AA Y             E     + +  +GVIA GGGS + + K VA  +       
Sbjct: 55  GHVAAFYDGATMHVPALVAEEACKIARTSEANGVIAIGGGSTIGLAKIVALRTE------ 108

Query: 119 DFEDVGDNWTKANSDKIAPIIAVPTTAGTGSETGRASVILNEETGVKNIIFHPKFLPSIV 178
                             PI+AVPTT   GSE    S+    E GVK      + +P  V
Sbjct: 109 -----------------LPIVAVPTTYA-GSEM--TSIFGITEGGVKKTGRDARVMPRAV 148

Query: 179 ILDPILTVGLPAKMTAATGMDALAHNLEAYCAPGYHPMADGIALEGMRLIDKWLLEAVSN 238
           I +P LT+ LP  ++  + ++A+AH +E   AP   P+   +A EG+    + +     +
Sbjct: 149 IYEPRLTLELPLSISVTSAINAIAHAVEGLYAPDATPLLTIMAQEGIAATVRAISRMYQS 208

Query: 239 GSNIEARMNMLTAASM-GSTAFQKGLGAIHSLSHPVNALNNIHHGLSNAIFMPYVLTFN 296
             +++AR + L  A +  S      +   H L H +    ++ H  ++ + +P+ L +N
Sbjct: 209 PRDLQARGDALYGAWLCASVLGNVSMALHHKLCHTLGGTLDLPHAQTHTVVLPHALAYN 267


>TFDF1_RALEJ RecName: Full=Maleylacetate reductase 1;       
           EC=1.3.1.32;AltName: Full=Maleylacetate reductase I;
          Length = 354

 Score = 72.8 bits (177), Expect = 5e-15
 Identities = 65/249 (26%), Positives = 107/249 (42%), Gaps = 12/249 (4%)

Query: 137 PIIAVPTTAGTGSETGRASVILNEETGVKNIIFHPKFLPSIVILDPILTVGLPAKMTAAT 196
           P + +PTT      T    V    E G+K     PK LP  VI DP+LTV LP  ++  +
Sbjct: 111 PSLVIPTTYAGSEMTTIWGVT---EGGMKRTGRDPKVLPKTVIYDPLLTVDLPLAISVTS 167

Query: 197 GMDALAHNLEAYCAPGYHPMADGIALEGMRLIDKWLLEAVSNGSNIEARMNMLTAASMGS 256
            ++A+AH  E   +   +P+ + +  +G+  +   +   V+  ++ EAR + L  A M  
Sbjct: 168 ALNAIAHAAEGLYSADLNPVLETMCKQGICALFDAIPRLVAKPTDAEARTDALFGAWMCG 227

Query: 257 TAF-QKGLGAIHSLSHPVNALNNIHHGLSNAIFMPYVLTFNKDVIENKIIKICDYLELKD 315
           TA    G+G  H L H +    N+ H  ++AI     +               + L  + 
Sbjct: 228 TALCHLGMGLHHKLCHTLGGTLNLPHAETHAI-----VXXXXXXXXXXXXXXXERLLQEV 282

Query: 316 RSFDGFVNWVLDLRKKLDMPHKLSEVIDEKDFDIDRLSKMALADPSTGGNPKKLTEDDMR 375
                  + + DL +    P  L+E I  +  DI R+  +AL D     NP+ L  D + 
Sbjct: 283 AGSSDVPSALYDLARNAGAPLSLAE-IGMRPEDIPRVRDLALRDQYP--NPRPLESDALE 339

Query: 376 IMYQNSMTG 384
            +  N+  G
Sbjct: 340 TLLVNAFRG 348


>ADH3_ENTHI RecName: Full=Alcohol dehydrogenase 3;       
           Short=ADH;         EC=1.1.1.2;
          Length = 395

 Score = 62.4 bits (150), Expect = 6e-12
 Identities = 68/271 (25%), Positives = 113/271 (41%), Gaps = 27/271 (9%)

Query: 92  VIAFGGGSGLDVGKAVAFMSGQNLPIWDFEDVGDNWTKANSDKIAPIIA----VPTTAGT 147
           ++A GGGS +D  K +A            +D  D   K    K+ P  A    V T   T
Sbjct: 91  LVAVGGGSIIDATKYIALGMEHTYS----DDPYDICLKGGKFKVNPAQAKIGVVLTIPAT 146

Query: 148 GSETGRASVILNEETGVKNIIFHPKFLPSIVILDPILTVGLPAKMTAATGMDALAHNLEA 207
           GSET    VI      +K    +    P+  I+DP  T+ LP        +D+  H +E 
Sbjct: 147 GSETNCWGVISRHADKLKLPFNNESVFPTWSIVDPCFTMSLPDNQIRNGLVDSFVHCIEQ 206

Query: 208 YCAPGYH--PMADGIALEGMRLIDKWLLEAVSNGSNIEAR------------MNMLTAAS 253
           Y    YH  P+ +      MR I     + + N  + +AR            M++L   +
Sbjct: 207 YIG-NYHLNPVVEAETEGVMRTIIGVSHKTLENHQDYQARITFCYAATVALNMSLLCGVT 265

Query: 254 MGSTAFQKGL---GAIHSLSHPVNALNNIHHGLSNAIFMPYVLTFNKDVIENKIIKICDY 310
           +   A   G+   G  H++ H + +   + HG + AI  P V+ FNK+    K+I++ + 
Sbjct: 266 LCGGAHAVGVTLCGGAHAVGHELTSYYGLAHGETLAITTPGVMRFNKEKNAKKLIQMGEQ 325

Query: 311 L-ELKDRSFDGFVNWVLDLRKKLDMPHKLSE 340
           +  +K+ + +  +       K + M  +LSE
Sbjct: 326 VFGIKNSTPEAAIEATEKWFKSIGMKTRLSE 356


>GLDA_ECOLI RecName: Full=Glycerol dehydrogenase;       
           Short=GLDH;         Short=GDH;         EC=1.1.1.6;
          Length = 367

 Score = 52.4 bits (124), Expect = 7e-09
 Identities = 56/209 (26%), Positives = 82/209 (39%), Gaps = 41/209 (19%)

Query: 89  CDGVIAFGGGSGLDVGKAVAFMSGQNLPIWDFEDVGDNWTKANSDKIAPIIAVPTTAGTG 148
           C  ++  GGG  LD  KA+A   G                        P+   PT A T 
Sbjct: 85  CGAILGIGGGKTLDTAKALAHFMG-----------------------VPVAIAPTIASTD 121

Query: 149 SETGRASVILNEETGVKNIIFHPKFLPSIVILDPILTVGLPAKMTAATGMDALAHNLEAY 208
           +     SVI  +E      +  P   P++VI+D  +  G PA++ AA   DALA   EA 
Sbjct: 122 APCSALSVIYTDEGEFDRYLLLPNN-PNMVIVDTKIVAGAPARLLAAGIGDALATWFEAR 180

Query: 209 CA--PGYHPMADG----IALEGMRLIDKWLLEAVSNGSNIEARMNMLTAA---------S 253
                G   MA G     AL    L    LLE     + + A  +++T A          
Sbjct: 181 ACSRSGATTMAGGKCTQAALALAELCYNTLLEE-GEKAMLAAEQHVVTPALERVIEANTY 239

Query: 254 MGSTAFQK-GLGAIHSLSHPVNALNNIHH 281
           +    F+  GL A H++ + + A+ + HH
Sbjct: 240 LSGVGFESGGLAAAHAVHNGLTAIPDAHH 268


>GLDA_ECOL6 RecName: Full=Glycerol dehydrogenase;       
           Short=GLDH;         Short=GDH;         EC=1.1.1.6;
          Length = 367

 Score = 52.4 bits (124), Expect = 7e-09
 Identities = 56/209 (26%), Positives = 82/209 (39%), Gaps = 41/209 (19%)

Query: 89  CDGVIAFGGGSGLDVGKAVAFMSGQNLPIWDFEDVGDNWTKANSDKIAPIIAVPTTAGTG 148
           C  ++  GGG  LD  KA+A   G                        P+   PT A T 
Sbjct: 85  CGAILGIGGGKTLDTAKALAHFMG-----------------------VPVAIAPTIASTD 121

Query: 149 SETGRASVILNEETGVKNIIFHPKFLPSIVILDPILTVGLPAKMTAATGMDALAHNLEAY 208
           +     SVI  +E      +  P   P++VI+D  +  G PA++ AA   DALA   EA 
Sbjct: 122 APCSALSVIYTDEGEFDRYLLLPNN-PNMVIVDTKIVAGAPARLLAAGIGDALATWFEAR 180

Query: 209 CA--PGYHPMADG----IALEGMRLIDKWLLEAVSNGSNIEARMNMLTAA---------S 253
                G   MA G     AL    L    LLE     + + A  +++T A          
Sbjct: 181 ACSRSGATTMAGGKCTQAALALAELCYNTLLEE-GEKAMLAAEQHVVTPALERVIEANTY 239

Query: 254 MGSTAFQK-GLGAIHSLSHPVNALNNIHH 281
           +    F+  GL A H++ + + A+ + HH
Sbjct: 240 LSGVGFESGGLAAAHAVHNGLTAIPDAHH 268


>MACA1_RHOOP RecName: Full=Maleylacetate reductase 1;       
           EC=1.3.1.32;AltName: Full=Maleylacetate reductase I;
          Length = 357

 Score = 48.5 bits (114), Expect = 1e-07
 Identities = 59/301 (19%), Positives = 111/301 (36%), Gaps = 35/301 (11%)

Query: 85  KKNNCDGVIAFGGGSGLDVGKAVAFMSGQNLPIWDFEDVGDNWTKANSDKIAPIIAVPTT 144
           + +  D V+A GGGS   + KA+A  +G +  I      G   T    + +         
Sbjct: 86  RTSEADCVVAIGGGSTTGLAKALAARTGVDQVILPTTYAGSEVTPVLGETVE-------- 137

Query: 145 AGTGSETGRASVILNEETGVKNIIFHPKFLPSIVILDPILTVGLPAKMTAATGMDALAHN 204
              G +T R+++ +               LP  VI D  L+  LP  +            
Sbjct: 138 ---GRKTTRSTLAV---------------LPETVIYDVELSKNLPVPIXXXXXXXXXXXX 179

Query: 205 LEAYCAPGYHPMADGIALEGMRLIDKWLLEAVSNGSNIEARMNMLTAASM-GSTAFQKGL 263
                +P  +P+ D                 VS+ S    R ++L  + + G      G+
Sbjct: 180 XXXMYSPDANPVVDTWXXXXXXXXXXXXXXXVSDPSCRRIRTDLLRGSWLAGMCLGSVGM 239

Query: 264 GAIHSLSHPVNALNNIHHGLSNAIFMPYVLTFNKDVIENKIIKICDYLELKDRSFDGFVN 323
              H L H +     + H  ++ + +PY ++FN   + + +  +   + + +        
Sbjct: 240 AVHHKLCHTLGGAFGLPHAPTHTVVLPYAMSFNASEVPDVMDSLASAMNVSNAPAG---- 295

Query: 324 WVLDLRKKLDMPHKLSEVIDEKDFDIDRLSKMALADPSTGGNPKKLTEDDMRIMYQNSMT 383
            V DL      P  L+  +     D+DR + +A   P    NP+++T   +R + Q++  
Sbjct: 296 -VWDLIADAGGPTSLAS-LGLLQTDLDRAADLATEAPYR--NPRQITRSGIRDLLQSAWE 351

Query: 384 G 384
           G
Sbjct: 352 G 352


>GLDA_THEMA RecName: Full=Glycerol dehydrogenase;       
           Short=GLDH;         Short=GDH;         EC=1.1.1.6;
          Length = 364

 Score = 47.0 bits (110), Expect = 3e-07
 Identities = 39/131 (29%), Positives = 52/131 (39%), Gaps = 25/131 (19%)

Query: 90  DGVIAFGGGSGLDVGKAVAFMSGQNLPIWDFEDVGDNWTKANSDKIAPIIAVPTTAGTGS 149
           D V+  GGG  LD  KAVA+   +                       P++ VPT A T +
Sbjct: 84  DVVVGIGGGKTLDTAKAVAYKLKK-----------------------PVVIVPTIASTDA 120

Query: 150 ETGRASVILNEETGVKNIIFHPKFLPSIVILDPILTVGLPAKMTAATGMDALAHNLEA-Y 208
                SVI       K  +F P+  P +V++D  +    PA+   A   DALA   EA  
Sbjct: 121 PCSALSVIYTPNGEFKRYLFLPR-NPDVVLVDTEIVAKAPARFLVAGMGDALATWFEAES 179

Query: 209 CAPGYHPMADG 219
           C   Y P   G
Sbjct: 180 CKQKYAPNMTG 190


>GLDA_PSEPU RecName: Full=Glycerol dehydrogenase;       
           Short=GLDH;         Short=GDH;         EC=1.1.1.6;
          Length = 365

 Score = 43.5 bits (101), Expect = 3e-06
 Identities = 33/117 (28%), Positives = 49/117 (41%), Gaps = 24/117 (20%)

Query: 86  KNNCDGVIAFGGGSGLDVGKAVAFMSGQNLPIWDFEDVGDNWTKANSDKIAPIIAVPTTA 145
           +N    ++  GGG  LD  KAVAF          F+ V             P+   PT A
Sbjct: 82  QNGRSAIVGIGGGKTLDTAKAVAF----------FQKV-------------PVAVAPTIA 118

Query: 146 GTGSETGRASVILNEETGVKNIIFHPKFLPSIVILDPILTVGLPAKMTAATGMDALA 202
            T +     SV+  +E      +  P   P++V++D  +    PA++ AA   DALA
Sbjct: 119 STDAPCSALSVLYTDEGEFDRYLMLPT-NPALVVVDTAIVARAPARLLAAGIGDALA 174


>G1PDH_PYRHO RecName: Full=Glycerol-1-phosphate dehydrogenase
           [NAD(P)+];         Short=G1P dehydrogenase;       
           Short=G1PDH;         EC=1.1.1.261;
          Length = 346

 Score = 41.6 bits (96), Expect = 1e-05
 Identities = 47/202 (23%), Positives = 74/202 (36%), Gaps = 35/202 (17%)

Query: 8   YPTTMWVGENRINDVASACKNLNIKKPLLVTDNGLAQSVIVKNTLSILKEGGIIAALYSX 67
           +P  + +G+N I ++ +  K L +  P LV    + + +   N   I+KE      +YS 
Sbjct: 6   FPREVILGKNLIQEINNVIKRLKLGSPGLVVYGPITKKIAGSNVEKIVKEE---FEVYSI 62

Query: 68  XXXXXXXXXXXEGADYYKKNNCDGVIAFGGGSGLDVGKAVAFMSGQNLPIWDFEDVGDNW 127
                            +       IA GGGS +DV K  +F  G               
Sbjct: 63  TVKEAHINEVERVISKIRDKGIKWAIAVGGGSIIDVTKLASFKMG--------------- 107

Query: 128 TKANSDKIAPIIAVPTTAG-TGSETGRASVI-LNEETGVKNIIFHPKFLPSIVILDPILT 185
                    P I+ PTTA   G  +  AS+  LN +T +       K  P I ++  I  
Sbjct: 108 --------IPFISFPTTASHDGIASANASIKGLNVKTSI-------KAKPPIAVIADIDV 152

Query: 186 VGLPAKMTAATGMDALAHNLEA 207
           +    K   A G+  +  N+ A
Sbjct: 153 IKTAPKRYLAAGVGDIVSNITA 174


>GLDA_CITFR RecName: Full=Glycerol dehydrogenase;       
           Short=GLDH;         Short=GDH;         EC=1.1.1.6;
          Length = 365

 Score = 40.0 bits (92), Expect = 3e-05
 Identities = 22/71 (30%), Positives = 36/71 (50%), Gaps = 1/71 (1%)

Query: 137 PIIAVPTTAGTGSETGRASVILNEETGVKNIIFHPKFLPSIVILDPILTVGLPAKMTAAT 196
           P++ +PT A T + T   SVI  E    +  + +PK  P +V++D  +    P ++  A 
Sbjct: 110 PVVVIPTIASTDAPTSALSVIYTEAGEFEEYLIYPK-NPDMVVMDTAIIAKAPVRLLVAG 168

Query: 197 GMDALAHNLEA 207
             DAL+   EA
Sbjct: 169 MGDALSTWFEA 179


>G1PDH_PYRFU RecName: Full=Glycerol-1-phosphate dehydrogenase
           [NAD(P)+];         Short=G1P dehydrogenase;       
           Short=G1PDH;         EC=1.1.1.261;
          Length = 346

 Score = 38.5 bits (88), Expect = 1e-04
 Identities = 42/201 (20%), Positives = 77/201 (38%), Gaps = 33/201 (16%)

Query: 8   YPTTMWVGENRINDVASACKNLNIKKPLLVTDNGLAQSVIVKNTLSILKEGGIIAALYSX 67
           +P  + +G+N I++  +  K L+   P+LV      + +  K+   +LKE      ++S 
Sbjct: 6   FPREVILGKNVISETVNVAKRLSFSSPVLVVYGPKTKEIAGKDVERVLKEE---FDVHSV 62

Query: 68  XXXXXXXXXXXEGADYYKKNNCDGVIAFGGGSGLDVGKAVAFMSGQNLPIWDFEDVGDNW 127
                      +     + N     IA GGG+ +DV K  ++ +G               
Sbjct: 63  IVKEATINEVEKVEGIIRDNKVKWAIAVGGGTIIDVTKLASYRAG--------------- 107

Query: 128 TKANSDKIAPIIAVPTTAG-TGSETGRASVILNEETGVKNIIFHPKFLPSIVILDPILTV 186
                    P ++ PTTA   G  +  AS+   +  G K  I   K  P + ++  I  +
Sbjct: 108 --------IPFVSFPTTASHDGIASANASI---KGLGTKTSI---KARPPVAVIADIRII 153

Query: 187 GLPAKMTAATGMDALAHNLEA 207
               +   A G+  +  N+ A
Sbjct: 154 KSAPRRYLAAGVGDVISNITA 174


>G1PDH_PICTO RecName: Full=Glycerol-1-phosphate dehydrogenase
           [NAD(P)+];         Short=G1P dehydrogenase;       
           Short=G1PDH;         EC=1.1.1.261;
          Length = 350

 Score = 38.5 bits (88), Expect = 1e-04
 Identities = 45/200 (22%), Positives = 84/200 (42%), Gaps = 37/200 (18%)

Query: 7   NYPTTMWVGENRINDVASAC-KNLNIKKPLLVTDNGLAQSVIVKNTLSILKEGGIIAALY 65
           ++P+ +++G + I ++ S   K L   + LL+T      ++  K  LS L +  +   + 
Sbjct: 10  HFPSDVYIGHDAILNIGSVVSKFLKSGEVLLITGEN-TYNIAGKKVLSNLNDFDVNVIIA 68

Query: 66  SXXXXXXXXXXXXEGADYYKKNNCDGVI-AFGGGSGLDVGKAVAFMSGQNLPIWDFEDVG 124
           S            +  +   KN   G++   GGGS +D+ K +A+            D+G
Sbjct: 69  SRATRDSI-----KSIEESLKNRRSGIVLGVGGGSKIDIAKKIAY------------DLG 111

Query: 125 DNWTKANSDKIAPIIAVPTT-AGTGSETGRASVILNEETGVKNIIFHPKFLPSIVILDPI 183
                       P I+VPTT +  G  + RAS+        K++      +PS ++ D  
Sbjct: 112 -----------IPFISVPTTPSHDGIASPRASIY-----DGKSVYSEEATMPSAIVADTS 155

Query: 184 LTVGLPAKMTAATGMDALAH 203
           + V  P +  AA   D +++
Sbjct: 156 IMVLAPYRYVAAGAADVISN 175


>SCP47_ARATH RecName: Full=Serine carboxypeptidase-like 47;       
           EC=3.4.16.-;Flags: Precursor;
          Length = 505

 Score = 38.1 bits (87), Expect = 1e-04
 Identities = 31/93 (33%), Positives = 42/93 (45%), Gaps = 13/93 (13%)

Query: 92  VIAFGGGSGLDVGKAVAFMSGQNLPIWDFEDVGDNWTKANSDKIAPIIAVPTTAGTG-SE 150
           VI   GG G     A+ + +G   P    +D+   W     DK++ II V    GTG S 
Sbjct: 129 VIWLTGGPGCSSSVAMFYENG---PFKISKDLSLYWNDFGWDKVSNIIYVDQPVGTGFSY 185

Query: 151 TGRASVILNEETGVKNIIF---------HPKFL 174
           T   S I N+E GV N ++         HPKF+
Sbjct: 186 TSDESDIRNDEDGVSNDLYDFLQAFFKEHPKFV 218


>G1PDH_METPE RecName: Full=Glycerol-1-phosphate dehydrogenase
           [NAD(P)+];         Short=G1P dehydrogenase;       
           Short=G1PDH;         EC=1.1.1.261;
          Length = 359

 Score = 37.0 bits (84), Expect = 3e-04
 Identities = 46/203 (22%), Positives = 77/203 (37%), Gaps = 35/203 (17%)

Query: 3   KYNW-NYPTTMWVGENRINDVASACKNLNIKKPLLVTDNGLAQSVIVKNTLSILKEGGII 61
           K  W   P  + +G N ++   + C++L I + +++        V       +L     I
Sbjct: 16  KSKWMQLPRDVVIGHNALDQFPAVCQDLKIGRSVMLFAGKSTMQVAGNRIEELLAPSFDI 75

Query: 62  AALYSXXXXXXXXXXXXEGADYYKKNNCDGVIAFGGGSGLDVGKAVAFMSGQNLPIWDFE 121
           +   +            E A        D +I  GGG  +D  K V+F    NL +    
Sbjct: 76  STFLARELTPESMKEGEEAAC-----GVDLIIGVGGGRVIDTAKIVSF----NLDL---- 122

Query: 122 DVGDNWTKANSDKIAPIIAVPTTAG-TGSETGRASVILNEETGVKNIIFHPKFLPSIVIL 180
                          P I+VPT A   G  +GRAS+  +E  G  ++  HP   P  V+ 
Sbjct: 123 ---------------PFISVPTAASHDGIASGRASLQTSE--GSASLTAHP---PLGVVA 162

Query: 181 DPILTVGLPAKMTAATGMDALAH 203
           D  +    P ++ AA   D +++
Sbjct: 163 DTGIIAAAPHRLLAAGCADIISN 185


>AROB_CHLCH RecName: Full=3-dehydroquinate synthase;       
           EC=4.2.3.4;
          Length = 365

 Score = 36.2 bits (82), Expect = 5e-04
 Identities = 45/172 (26%), Positives = 74/172 (43%), Gaps = 22/172 (12%)

Query: 137 PIIAVPTT--AGTGSETGRASVILNEETGVKNII--FHPKFLPSIVILDPILTVGLPAKM 192
           P+I +PTT  A T S  G   V +N   G KN+I  FH   LP +V++DP     LP + 
Sbjct: 113 PVIQMPTTLLAMTDSAIG-GKVAINHPLG-KNLIGFFH---LPELVLIDPATLASLPRRE 167

Query: 193 TAATGMDALAHNLEAYCAPGYHPMADGIALEGMRLIDKWLLEAVSNGSNIEARMNMLTAA 252
             A   + + +   A     +  M +    E   L + +L EAV   + I  + +++T  
Sbjct: 168 IYAGLAEVVKYGFIA--DANFFDMLEAHFSEVATLQEPYLTEAVKTSALI--KQDVVTRD 223

Query: 253 SMGSTAFQKGLGAIHSLSHPVNALNNIHH---------GLSNAIFMPYVLTF 295
                  +  L   H+ +H +  L +  H         GL  A+++ + L F
Sbjct: 224 FRELDGLRATLNFGHTFAHGLEKLADYRHLRHGEAVTMGLVCALYLSHRLGF 275


>G1PDH_METJA RecName: Full=Glycerol-1-phosphate dehydrogenase
           [NAD(P)+];         Short=G1P dehydrogenase;       
           Short=G1PDH;         EC=1.1.1.261;
          Length = 335

 Score = 35.8 bits (81), Expect = 6e-04
 Identities = 71/278 (25%), Positives = 111/278 (39%), Gaps = 57/278 (20%)

Query: 90  DGVIAFGGGSGLDVGKAVAFMSGQNLPIWDFEDVGDNWTKANSDKIAPIIAVPTTAGTGS 149
           D VI  GGG  +D GK +A+  G                        P I+VPTTA   S
Sbjct: 70  DCVIGIGGGRSIDTGKYLAYKLG-----------------------IPFISVPTTA---S 103

Query: 150 ETGRASVILNEETGVKNIIFHPKFL---PSIVILDPILTVGLPAKMTAATGMDALAHNLE 206
             G AS I++        I  P F+   P  +I D  +    P ++ +A GM  +  N+ 
Sbjct: 104 NDGIASPIVS--------IRQPSFMVDAPIAIIADTEIIKKSPRRLLSA-GMGDIVSNIT 154

Query: 207 -------AYCAPGYHPMADGIALEGMRLIDKWLLEAVSNGSNIEARMNMLTAASMGSTAF 259
                  AY   G    ++  A+   + I K L+  V N S++    N L  A +GS   
Sbjct: 155 AVLDWKLAYKEKG-EKYSESSAIFS-KTIAKELISYVLN-SDLSEYHNKLVKALVGS--- 208

Query: 260 QKGLG-AIHSLSHPVNALNNIHHGLSNAIFMPYVLTFNKDVIENKIIK--ICDYL-ELKD 315
             G+  AI + S P +   ++     + +   Y L  N    E   I   +  YL E ++
Sbjct: 209 --GIAIAIANSSRPASGSEHLFSHALDKLKEEYNLNINSLHGEQCGIGTIMMSYLHEKEN 266

Query: 316 RSFDGFVNWVLDLRKKLDMPHKLSEVIDEKDFDIDRLS 353
           +   G    +    KK+D P    E+  ++D  I+ L+
Sbjct: 267 KKLSGLHEKIKMSLKKVDAPTTAKELGFDEDIIIEALT 304


  Database: sws57.9x
    Posted date:  Nov 5, 2009 10:46 AM
  Number of letters in database: 179,409,320
  Number of sequences in database:  510,076
  
Lambda     K      H
   0.317    0.136    0.429 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 510076
Number of Hits to DB: 8,652,356,540
Number of extensions: 357547550
Number of successful extensions: 928261
Number of sequences better than 1.0e-03: 17454
Number of HSP's gapped: 913003
Number of HSP's successfully gapped: 19238
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.2 bits)