# hmmscan :: search sequence(s) against a profile HMM database
# HMMER 3.0b2 (June 2009); http://hmmer.org/
# Copyright (C) 2009 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query sequence file:             /home/niguts/usr08/shisakam/FASTA/gib_22938.fasta
# target HMM database:             /home/niguts/usr08/shisakam/PFAM/ver24.0/Pfam-A.hmm
# sequence search space set to:    100000
# set reporting thresholds to:     GA cutoffs
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       AAZ20988.1  [L=215]
Description: pubi0 AAZ20988.1 GIB00256CH01 "membrane protein"
Scores for complete sequence (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Model    Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    1.6e-14   56.5  27.5    6.1e-09   38.7   3.8    2.2  2  PF02588  Uncharacterized BCR, YitT family COG1284
  ------ inclusion threshold ------
        5.2    9.1   6.1        2.4   10.2   2.6    1.6  1  PF07947  YhhN-like protein
         64    6.1   1.9    1.7e+02    4.7   0.1    2.4  1  PF08285  Dolichol-phosphate mannosyltransferase subunit 3 (D
         82    5.9  11.4       0.56   12.8   1.0    2.4  1  PF09877  Predicted membrane protein (DUF2104)
         92    5.3   0.0    1.4e+02    4.8   0.0    1.3  1  PF08265  YL1 nuclear protein C-terminal domain
    1.4e+02    5.1   2.2      1e+02    5.5   0.0    1.9  1  PF04835  A9 protein conserved region
    1.9e+02    4.9   8.7         37    7.2   0.4    3.0  2  PF11196  Protein of unknown function (DUF2834)
    2.2e+02    4.7   0.1    3.7e+02    3.9   0.1    1.3  1  PF11537  Protein of unknown function (DUF3227)
    2.9e+02    3.7   0.0    5.7e+02    2.7   0.0    1.4  1  PF04807  Geminivirus AC4/5 conserved region
    3.1e+02    4.1   0.2      6e+02    3.2   0.1    1.4  1  PF08102  Scorpion antimicrobial peptide
    3.6e+02    3.4   0.9      8e+02    2.3   0.4    1.7  1  PF01252  Signal peptidase (SPase) II
    3.9e+02    3.1   0.0    6.3e+02    2.5   0.0    1.2  1  PF10444  Nbl1 / Borealin N terminal
    4.8e+02    3.3   4.5    3.8e+02    3.6   0.6    2.6  1  PF10601  LITAF-like zinc ribbon domain
    6.3e+02    2.6  12.7         25    7.1   3.4    2.6  1  PF08041  PetM family of cytochrome b6f complex subunit 7
    7.2e+02    2.9   0.7    1.4e+03    1.9   0.5    1.3  1  PF04726  Microvirus J protein
      3e+03    0.8   4.8    1.1e+03    2.3   1.1    1.8  1  PF06287  Protein of unknown function (DUF1039)


Domain and alignment annotation for each model:
>> PF02588  Uncharacterized BCR, YitT family COG1284
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   24.0   9.8   3.7e-08   0.00023       2      82 .]      28     107 ..      27     107 .. 0.97
   2 !   38.7   3.8   9.7e-13   6.1e-09       2      78 ..     124     199 ..     123     203 .. 0.93

  Alignments for each domain:
  == domain 1    score: 24.0 bits;  conditional E-value: 3.7e-08
     PF02588   2 llfaiigglllglgisiflkagastgGtdgiayylskkkgisigsillliniilliislllf.gfprlfatllaiivvgivi 82 
                 ++f+ +g +l+glg ++++ + a++++++++a++++  +++sig+i++li i +l++ l l+ +   +++t+l +i++g++i
  AAZ20988.1  28 FFFLCLGLVLFGLGEGLLIVSFAGASPWSILAQGIALNVDLSIGIITVLISIGVLFLWLPLKqKP--GIGTILNAIIIGLMI 107
                 89***********************************************************9788..************997 PP

  == domain 2    score: 38.7 bits;  conditional E-value: 9.7e-13
     PF02588   2 llfaiigglllglgisiflkagastgGtdgiayylskkkgisigsillliniilliislllf.gfprlfatllaiivv 78 
                 l++a+i+ l +glg +i+l a++++g+ dg+ ++l+kk++++i+++  ++ i++++i+++l   +  +++tll+++ +
  AAZ20988.1 124 LILATIAVLTVGLGGGIYLVANLGAGPRDGLMVGLQKKTNLPIATVRAFLEITVMSIGWYLGgTV--GIGTLLFAFGI 199
                 799**********************************************************8566..99999998865 PP

>> PF07947  YhhN-like protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   10.2   2.6   0.00039       2.4      54     138 ..      31     123 ..      19     146 .. 0.81

  Alignments for each domain:
  == domain 1    score: 10.2 bits;  conditional E-value: 0.00039
     PF07947  54 filGlvaFllaHiaYivafl........eqqstktisllllllllvaavvllalllpklgdlkipvlvYalvistmaaaAlaralssssflal 138
                 + lGlv F+l+  + iv f+         q    ++ l ++++++++++++l+l lp  ++  i  ++ a++i++m+ + ++     ++ l+ 
  AAZ20988.1  31 LCLGLVLFGLGEGLLIVSFAgaspwsilAQGIALNVDLSIGIITVLISIGVLFLWLPLKQKPGIGTILNAIIIGLMIDVCIKFIPTPENYLNQ 123
                 468*********************9999999999999************999999999999***************98888766444444333 PP

>> PF08285  Dolichol-phosphate mannosyltransferase subunit 3 (DPM3)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.7   0.1     0.027   1.7e+02      44      63 ..     176     195 ..     155     197 .. 0.88

  Alignments for each domain:
  == domain 1    score: 4.7 bits;  conditional E-value: 0.027
     PF08285  44 llvlfGsYslltvgygvltf 63 
                 ++++ G Y+ +tvg g+l f
  AAZ20988.1 176 TVMSIGWYLGGTVGIGTLLF 195
                 799*************9987 PP

>> PF09877  Predicted membrane protein (DUF2104)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   12.8   1.0     9e-05      0.56      49      97 ..      61     113 ..      46     116 .. 0.81

  Alignments for each domain:
  == domain 1    score: 12.8 bits;  conditional E-value: 9e-05
     PF09877  49 wllllvnla..lvelliliglllvalvlgmRPGYGri..etvlGliialilyl 97 
                 +++l v+l+  ++++li ig+l++ l+l  +PG G i   +++Gl+i + + +
  AAZ20988.1  61 GIALNVDLSigIITVLISIGVLFLWLPLKQKPGIGTIlnAIIIGLMIDVCIKF 113
                 456777766668999********************984457789998877655 PP

>> PF08265  YL1 nuclear protein C-terminal domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.8   0.0     0.022   1.4e+02      16      30 .]     161     175 ..     161     175 .. 0.89

  Alignments for each domain:
  == domain 1    score: 4.8 bits;  conditional E-value: 0.022
     PF08265  16 kTgLpYanveaFkvI 30 
                 kT+Lp a+v aF +I
  AAZ20988.1 161 KTNLPIATVRAFLEI 175
                 7***********665 PP

>> PF04835  A9 protein conserved region
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.5   0.0     0.016     1e+02      28      46 ..      22      40 ..      20      43 .. 0.84

  Alignments for each domain:
  == domain 1    score: 5.5 bits;  conditional E-value: 0.016
     PF04835 28 ksiisMvmyLilGlaLlyi 46
                k  is   +L lGl+L+ +
  AAZ20988.1 22 KPKISTFFFLCLGLVLFGL 40
                55689999********976 PP

>> PF11196  Protein of unknown function (DUF2834)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.6   0.5      0.32     2e+03      35      59 ..      55      79 ..      31     113 .. 0.71
   2 ?    7.2   0.4     0.006        37      74      92 ..     192     210 ..     166     214 .. 0.84

  Alignments for each domain:
  == domain 1    score: 1.6 bits;  conditional E-value: 0.32
     PF11196 35 afanaaasslsaDlliaaiallvwi 59
                + + a   +l +Dl i+ i++l+ i
  AAZ20988.1 55 WSILAQGIALNVDLSIGIITVLISI 79
                5566666677788888888887766 PP

  == domain 2    score: 7.2 bits;  conditional E-value: 0.006
     PF11196  74 ailltfligvafglPLfLf 92 
                 ++l++f+ig +++l+L+L+
  AAZ20988.1 192 TLLFAFGIGPSVALGLYLV 210
                 7899**************7 PP

>> PF11537  Protein of unknown function (DUF3227)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.9   0.1     0.059   3.7e+02       7      41 ..      97     131 ..      94     134 .. 0.90

  Alignments for each domain:
  == domain 1    score: 3.9 bits;  conditional E-value: 0.059
     PF11537   7 llvktikellkevaPgleavleaylraklnktlev 41 
                 +l + i+ l+ +v+ ++ ++ e yl+  + +t+ v
  AAZ20988.1  97 ILNAIIIGLMIDVCIKFIPTPENYLNQLILATIAV 131
                 7889999*******************999888876 PP

>> PF04807  Geminivirus AC4/5 conserved region
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.7   0.0     0.091   5.7e+02      16      26 ..       5      15 ..       5      18 .. 0.87

  Alignments for each domain:
  == domain 1    score: 2.7 bits;  conditional E-value: 0.091
     PF04807 16 vKhLtKilwss 26
                +K  +K+ wss
  AAZ20988.1  5 IKDIPKVYWSS 15
                8999*****98 PP

>> PF08102  Scorpion antimicrobial peptide
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.2   0.1     0.096     6e+02       7      26 ..       5      24 ..       2      26 .. 0.89

  Alignments for each domain:
  == domain 1    score: 3.2 bits;  conditional E-value: 0.096
     PF08102  7 IKstAkkvwnSepvkqLKnk 26
                IK + k  w+Se   +LK k
  AAZ20988.1  5 IKDIPKVYWSSEKPLNLKPK 24
                99**********99999976 PP

>> PF01252  Signal peptidase (SPase) II
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.3   0.4      0.13     8e+02      46      94 ..      55     103 ..      44     112 .. 0.70

  Alignments for each domain:
  == domain 1    score: 2.3 bits;  conditional E-value: 0.13
     PF01252  46 fglfsgkseelrklllvlvslvavllllvlllklkkkkklallalalil 94 
                 ++++++  +    l + ++++++++++l+l+l lk+k  + ++  a+i+
  AAZ20988.1  55 WSILAQGIALNVDLSIGIITVLISIGVLFLWLPLKQKPGIGTILNAIII 103
                 8888888776677778888888888888888887775444444444444 PP

>> PF10444  Nbl1 / Borealin N terminal
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.5   0.0       0.1   6.3e+02      22      43 ..     159     180 ..     157     181 .. 0.87

  Alignments for each domain:
  == domain 1    score: 2.5 bits;  conditional E-value: 0.1
     PF10444  22 rshyenllqklrarleieilri 43 
                  +++++ + ++ra lei++++i
  AAZ20988.1 159 QKKTNLPIATVRAFLEITVMSI 180
                 5778888999**********98 PP

>> PF10601  LITAF-like zinc ribbon domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.6   0.6     0.061   3.8e+02      21      48 ..      88     115 ..      62     121 .. 0.89

  Alignments for each domain:
  == domain 1    score: 3.6 bits;  conditional E-value: 0.061
     PF10601  21 veyksGattwllaallcllglvgcclip 48 
                 ++ k+G++t+l a+++ l++ v++ +ip
  AAZ20988.1  88 LKQKPGIGTILNAIIIGLMIDVCIKFIP 115
                 5789999***999999999767778888 PP

>> PF08041  PetM family of cytochrome b6f complex subunit 7
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.1   3.4    0.0039        25       5      23 ..      27      45 ..      25      51 .. 0.85

  Alignments for each domain:
  == domain 1    score: 7.1 bits;  conditional E-value: 0.0039
     PF08041  5 ngAvIcivLVLvGLAlGFl 23
                + +++c +LVL+GL+ G l
  AAZ20988.1 27 TFFFLCLGLVLFGLGEGLL 45
                5689**********98865 PP

>> PF04726  Microvirus J protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.9   0.5      0.22   1.4e+03      17      22 ..     182     187 ..     182     187 .. 0.95

  Alignments for each domain:
  == domain 1    score: 1.9 bits;  conditional E-value: 0.22
     PF04726  17 WYVGGq 22 
                 WY GG+
  AAZ20988.1 182 WYLGGT 187
                 *****7 PP

>> PF06287  Protein of unknown function (DUF1039)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.3   1.1      0.17   1.1e+03      31      42 ..      31      42 ..      28      45 .. 0.89

  Alignments for each domain:
  == domain 1    score: 2.3 bits;  conditional E-value: 0.17
     PF06287 31 vcealllfGLne 42
                 c+ l+lfGL+e
  AAZ20988.1 31 LCLGLVLFGLGE 42
                6999*******8 PP



Internal pipeline statistics summary:
-------------------------------------
Query sequence(s):                         1  (215 residues)
Target model(s):                       11912  (2158902 nodes)
Passed MSV filter:                       363  (0.0304735); expected 238.2 (0.02)
Passed bias filter:                      172  (0.0144392); expected 238.2 (0.02)
Passed Vit filter:                        21  (0.00176293); expected 11.9 (0.001)
Passed Fwd filter:                        21  (0.00176293); expected 0.1 (1e-05)
Initial search space (Z):             100000  [as set by --Z on cmdline]
Domain search space  (domZ):              16  [number of targets reported over threshold]
# CPU time: 0.17u 0.05s 00:00:00.22 Elapsed: 00:00:01
# Mc/sec: 2730.38
//