# hmmscan :: search sequence(s) against a profile HMM database
# HMMER 3.0b2 (June 2009); http://hmmer.org/
# Copyright (C) 2009 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query sequence file:             /home/niguts/usr08/shisakam/FASTA/gib_22939.fasta
# target HMM database:             /home/niguts/usr08/shisakam/PFAM/ver24.0/Pfam-A.hmm
# sequence search space set to:    100000
# set reporting thresholds to:     GA cutoffs
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       AAZ21098.1  [L=422]
Description: pubi0 glcE GIB00256CH01 "(S)-2-hydroxy-acid oxidase"
Scores for complete sequence (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Model    Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    4.4e-15   58.0   0.0    1.4e-14   56.4   0.0    1.8  1  PF01565  FAD binding domain
     0.0088   18.1   0.0      0.015   17.3   0.0    1.4  1  PF02913  FAD linked oxidases, C-terminal domain
  ------ inclusion threshold ------
       0.28   13.2   0.7       0.77   11.8   0.5    1.7  1  PF12579  Protein of unknown function (DUF3755)
          1   12.0   1.2         51    6.5   0.1    3.0  3  PF09116  gp45 sliding clamp, C terminal
        5.9    9.4   4.2        4.6    9.7   0.8    2.2  1  PF11471  Protein of unknown function (DUF3205)
        6.9    9.0   0.0         31    6.9   0.0    2.1  1  PF06116  Transcriptional activator RinB
        9.4    8.3   0.3    1.3e+02    4.6   0.0    2.5  2  PF11246  Base plate wedge protein 53
         11    7.3   0.1         19    6.4   0.1    1.3  1  PF02684  Lipid-A-disaccharide synthetase
         13    8.3   0.0         39    6.8   0.0    1.8  1  PF02108  Flagellar assembly protein FliH
         13    8.2   0.6         29    7.1   0.4    1.5  1  PF12396  Protein of unknown function (DUF3659)
         18    7.5   0.3         66    5.7   0.1    2.0  1  PF10624  Plasmid conjugative transfer entry exclusion protei
         22    7.7   0.0         59    6.3   0.0    1.7  1  PF08031  Berberine and berberine like
         39    6.9   0.0         86    5.7   0.0    1.5  1  PF00903  Glyoxalase/Bleomycin resistance protein/Dioxygenase
         56    6.7   0.0    1.9e+02    5.0   0.0    1.9  1  PF12290  Bacterial type IIA DNA topoisomerase, B subunit
         61    6.5   0.0    1.3e+02    5.5   0.0    1.6  1  PF01936  Protein of unknown function DUF88
         80    4.9   0.2    3.5e+02    2.8   0.0    2.1  1  PF09265  Cytokinin dehydrogenase 1, FAD and cytokinin bindin
         84    5.8   0.2    2.4e+02    4.3   0.0    1.8  1  PF10172  Det1 complexing ubiquitin ligase
         92    5.6   0.3    2.6e+02    4.1   0.0    1.8  1  PF05912  Caenorhabditis elegans protein of unknown function 
         95    5.2   0.0    2.3e+02    4.0   0.0    1.6  1  PF03494  Beta-amyloid peptide (beta-APP)
         97    5.7   0.0    2.1e+02    4.6   0.0    1.5  1  PF09542  FFD and TFG box motifs
         97    4.9   0.0    1.6e+02    4.2   0.0    1.3  1  PF06186  Protein of unknown function (DUF992)
    1.2e+02    4.8   0.0    3.3e+02    3.3   0.0    1.6  1  PF01976  Protein of unknown function DUF116
    1.5e+02    4.9   0.0    3.7e+02    3.7   0.0    1.6  1  PF07972  NrdI Flavodoxin like
    1.6e+02    5.1   0.8    5.1e+02    3.5   0.6    1.9  1  PF08103  Uperin family
    1.8e+02    4.3   0.0    3.7e+02    3.2   0.0    1.4  1  PF07609  Protein of unknown function (DUF1572)
      2e+02    4.6   1.4    6.8e+02    2.9   0.0    2.5  1  PF09181  Prolyl-tRNA synthetase, C-terminal
    2.2e+02    4.5   0.1      5e+02    3.4   0.1    1.5  1  PF04959  Arsenite-resistance protein 2
    3.3e+02    3.4   0.1    7.5e+02    2.2   0.1    1.5  1  PF02507  Photosystem I reaction centre subunit III
    4.7e+02    2.6   0.1    6.7e+02    2.1   0.1    1.1  1  PF05217  STOP protein
    7.1e+02    3.7   5.9    3.9e+02    4.5   1.3    2.8  1  PF02370  M protein repeat
    1.4e+03    2.2   0.1      4e+03    0.9   0.1    1.6  1  PF02757  YLP motif
    1.4e+03    2.1   0.1    3.3e+03    1.0   0.1    1.4  1  PF08262  Leucophaea maderae tachykinin-related peptide


Domain and alignment annotation for each model:
>> PF01565  FAD binding domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   56.4   0.0   4.5e-18   1.4e-14       5     136 ..      15     155 ..      12     157 .. 0.92

  Alignments for each domain:
  == domain 1    score: 56.4 bits;  conditional E-value: 4.5e-18
                 EEESSHHHHHHHHHHHHHCT-CEEEE-----EE.STTCS-EEEEEGTT---EEEECTTTTEEEEE---BHHHHHHHHHHC-TBBS-GG........GTC CS
     PF01565   5 vrpeseeevaaivrlarekglpvlvrGgGssll.gqavtggvvldlsrlnrileideeegtatveaGvtlgdleealaakglllglep........gsl 94 
                  +pe+e +v+++v+   +k+ p  ++G+Gs+   g++++++  l++s+l +++e+ +ee +++v a ++l+ +e++l+++++ l +ep        g  
  AAZ21098.1  15 YYPEDELQVSNLVQELYKKNQPTEIIGTGSKNFiGNNIQSAKKLSMSKLSGVIEYLPEELYIKVKANTPLELVEKELEKNNQELAFEPidfgfienGKS 113
                 58****************************9988**********************************************9999987633333333666 PP

                 CGSB---TTTTT-----TTCH..HHHHEEEEEEEET---EEE CS
     PF01565  95 ipgtvGGaiatngggygsekyGlirdnvlslevvladGevvr 136
                 + gt+ G++a n  g++++k G++rd++l+++ v+++G +++
  AAZ21098.1 114 NKGTIAGHLACNFAGSRRFKVGSLRDHILGFRGVNGKGDIIK 155
                 889************************************987 PP

>> PF02913  FAD linked oxidases, C-terminal domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   17.3   0.0   4.8e-06     0.015     230     249 .]     399     418 ..     386     418 .. 0.86

  Alignments for each domain:
  == domain 1    score: 17.3 bits;  conditional E-value: 4.8e-06
                 HHHHHHHHH-TT--BSTT-- CS
     PF02913 230 lmrriKaalDPnniLNPgkv 249
                 + ++iK+ +DP++i+NPgk+
  AAZ21098.1 399 ISEKIKKSFDPKRIFNPGKM 418
                 5689**************96 PP

>> PF12579  Protein of unknown function (DUF3755)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   11.8   0.5   0.00024      0.77       7      22 ..     304     319 ..     303     320 .. 0.91

  Alignments for each domain:
  == domain 1    score: 11.8 bits;  conditional E-value: 0.00024
     PF12579   7 dNidLFcrtRdNIlai 22 
                 +N++LF +t++N+l +
  AAZ21098.1 304 NNLELFKQTKNNLLRV 319
                 7************975 PP

>> PF09116  gp45 sliding clamp, C terminal
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.5   0.1     0.016        51      24      66 ..     198     240 ..     188     255 .. 0.85
   2 ?    1.4   0.0      0.64     2e+03      26     102 ..     259     341 ..     251     344 .. 0.63
   3 ?    0.4   0.0       1.3     4e+03      13      44 ..     375     405 ..     371     414 .. 0.81

  Alignments for each domain:
  == domain 1    score: 6.5 bits;  conditional E-value: 0.016
                 -EEEEEE----EEEE---TT-TTS-S-SEEEEEC-------EE CS
     PF09116  24 ddlavtnkdgkivikgyekvdkeetresyslavgeyegentFk 66 
                 +++++  +d+k+v + ++k+ + +++ s  + + e +++++++
  AAZ21098.1 198 NTITIHTDDKKLVKNLFDKISSSSSEVSGAVYIPEEPKDENYD 240
                 57999******************99999999999988888765 PP

  == domain 2    score: 1.4 bits;  conditional E-value: 0.64
                 EEEEE----EEEE---TT.-TTS-S-SEEEEEC-------EEEEEEGGG-------EEEEEE-.......--EEEEE-SSEEEEE CS
     PF09116  26 lavtnkdgkivikgyekv.dkeetresyslavgeyegentFkFvikidNmkliagdYkvklsa.......klaakfegatasyvi 102
                 la+  +++ki i++  k+  +e+  +   l+ +  +++++  F  ki+N++l ++  +  l+         ++++f g++++y+i
  AAZ21098.1 259 LALRIEGDKIAIDEKIKAlTNELELS--KLNTTVLDVHQSTPFWKKINNLELFKQTKNNLLRVvvppskgPKLIQFLGNKYKYYI 341
                 56667788999998333334444444..455555555555688899999999875433333333466766677888888888877 PP

  == domain 3    score: 0.4 bits;  conditional E-value: 1.3
                 HHHHHH------EEEEEE----EEEE---TT.- CS
     PF09116  13 qllkvsralklddlavtnkdgkivikgyekv.d 44 
                  ++k s  +  ++  +t++d +++i++  k+ +
  AAZ21098.1 375 TIIKTSDEYDYEETIFTVDDIRLLISE--KIkK 405
                 58999********************98..6734 PP

>> PF11471  Protein of unknown function (DUF3205)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    9.7   0.8    0.0015       4.6      17      43 ..      72      98 ..      56     101 .. 0.77

  Alignments for each domain:
  == domain 1    score: 9.7 bits;  conditional E-value: 0.0015
                HHHHTTS-HHHHHHHHHHHHS------ CS
     PF11471 17 dalaaKLtieerleLlEnELaenknEl 43
                ++l  K+  +  leL+E+EL +n++El
  AAZ21098.1 72 EELYIKVKANTPLELVEKELEKNNQEL 98
                578888889999**************8 PP

>> PF06116  Transcriptional activator RinB
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.9   0.0      0.01        31      20      46 ..      69      96 ..      61      98 .. 0.89

  Alignments for each domain:
  == domain 1    score: 6.9 bits;  conditional E-value: 0.01
     PF06116 20 ylteeliikltanDdve.apkDFdedDh 46
                yl eel+ik++an   e + k  +++ +
  AAZ21098.1 69 YLPEELYIKVKANTPLElVEKELEKNNQ 96
                9***************999999988765 PP

>> PF11246  Base plate wedge protein 53
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.6   0.0     0.041   1.3e+02       3      41 ..     188     226 ..     186     232 .. 0.86
   2 ?    0.6   0.0      0.69   2.2e+03     106     139 ..     334     367 ..     328     397 .. 0.70

  Alignments for each domain:
  == domain 1    score: 4.6 bits;  conditional E-value: 0.041
     PF11246   3 fsflpnieyegketksevdyvlvkniFrnykiydklvke 41 
                 +++lp+ + +++ t +  d++lvkn+F ++  +  +v+ 
  AAZ21098.1 188 LKVLPKKKLSNTITIHTDDKKLVKNLFDKISSSSSEVSG 226
                 7899**********9************999888877765 PP

  == domain 2    score: 0.6 bits;  conditional E-value: 0.69
     PF11246 106 enqvhyhvdeegekyynlvelpegpevwydkreg 139
                 +n+  y++d  g  y+  v+ +++++v   k+ +
  AAZ21098.1 334 GNKYKYYIDWCGSLYWIEVQSKKNSKVSDIKKLT 367
                 5777899999999999999999999998766333 PP

>> PF02684  Lipid-A-disaccharide synthetase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.4   0.1     0.006        19      12      63 ..      21      72 ..      19      98 .. 0.88

  Alignments for each domain:
  == domain 1    score: 6.4 bits;  conditional E-value: 0.006
     PF02684 12 ilgaelikelkeeypnlrfvGvggekmeaegleslaemeelsvvGlievlkk 63
                +++++l++el ++ +  +++G g +++  ++++s  + +  +++G+ie l++
  AAZ21098.1 21 LQVSNLVQELYKKNQPTEIIGTGSKNFIGNNIQSAKKLSMSKLSGVIEYLPE 72
                6899************************************9*******9986 PP

>> PF02108  Flagellar assembly protein FliH
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.8   0.0     0.013        39      52      94 ..     180     221 ..     169     231 .. 0.82

  Alignments for each domain:
  == domain 1    score: 6.8 bits;  conditional E-value: 0.013
     PF02108  52 ilalvrealaalpvdegkvtlrlnpdDlelveehlgeelkarg 94 
                 ++al + +l+ lp ++   t+ ++ dD +lv++ ++ ++++ +
  AAZ21098.1 180 LVALTEITLKVLPKKKLSNTITIHTDDKKLVKNLFD-KISSSS 221
                 67777888999999999******************9.555544 PP

>> PF12396  Protein of unknown function (DUF3659)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.1   0.4    0.0092        29       8      35 ..     146     173 ..     141     178 .. 0.88

  Alignments for each domain:
  == domain 1    score: 7.1 bits;  conditional E-value: 0.0092
     PF12396   8 kvnkeGnVvdedGnvvGklveGdlkklv 35 
                  vn +G+++ + G+vv +++  dl+klv
  AAZ21098.1 146 GVNGKGDIIKSGGTVVKNVTGYDLSKLV 173
                 5999************999998****98 PP

>> PF10624  Plasmid conjugative transfer entry exclusion protein TraS
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.7   0.1     0.021        66      35      65 ..     340     370 ..     335     381 .. 0.85

  Alignments for each domain:
  == domain 1    score: 5.7 bits;  conditional E-value: 0.021
     PF10624  35 vllwqglfiwlfiqirkkrnvsdefkfskgv 65 
                  + w g + w+ +q +k+ +vsd  k++k +
  AAZ21098.1 340 YIDWCGSLYWIEVQSKKNSKVSDIKKLTKEL 370
                 577*********************9999965 PP

>> PF08031  Berberine and berberine like
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.3   0.0     0.019        59      29      41 ..     402     414 ..     376     416 .. 0.70

  Alignments for each domain:
  == domain 1    score: 6.3 bits;  conditional E-value: 0.019
                 HHHHHH-TT--S- CS
     PF08031  29 kvKtkyDPdnvFr 41 
                 k+K+ +DP+ +F+
  AAZ21098.1 402 KIKKSFDPKRIFN 414
                 8***********7 PP

>> PF00903  Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.7   0.0     0.028        86       9      48 ..     290     335 ..     283     358 .. 0.84

  Alignments for each domain:
  == domain 1    score: 5.7 bits;  conditional E-value: 0.028
                 ES-HHHHHHHHHHHH--EEEEEEEE......SSSSCEEEEEEEETS CS
     PF00903   9 vgdleksldFYtkvLGfklvkktdn......teeteglriaffhag 48 
                 v d+ +s++F++k+ +++l+k+t n       ++ +g++ ++f  +
  AAZ21098.1 290 VLDVHQSTPFWKKINNLELFKQTKNnllrvvVPPSKGPKLIQFLGN 335
                 67999*******************9888887666666666666555 PP

>> PF12290  Bacterial type IIA DNA topoisomerase, B subunit
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.0   0.0      0.06   1.9e+02      75     109 ..     182     216 ..     168     221 .. 0.84

  Alignments for each domain:
  == domain 1    score: 5.0 bits;  conditional E-value: 0.06
     PF12290  75 DLeevLakvlnkkateeqeafieefigLvknlfDs 109
                  L e+  kvl kk  ++ +++ ++   LvknlfD+
  AAZ21098.1 182 ALTEITLKVLPKKKLSNTITIHTDDKKLVKNLFDK 216
                 57888888998888888889999999********7 PP

>> PF01936  Protein of unknown function DUF88
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.5   0.0     0.042   1.3e+02       3      43 ..       6      44 ..       4      82 .. 0.81

  Alignments for each domain:
  == domain 1    score: 5.5 bits;  conditional E-value: 0.042
     PF01936  3 avfiDgenlpvpaggkevdyrklleeirskgelvraraygn 43
                 +f D +n ++p +  e+++++l++e+ +k++ +++   g+
  AAZ21098.1  6 QIFQDSNNTYYPED--ELQVSNLVQELYKKNQPTEIIGTGS 44
                59**********99..99**********9888766655554 PP

>> PF09265  Cytokinin dehydrogenase 1, FAD and cytokinin binding
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.8   0.0      0.11   3.5e+02     263     278 ..     402     417 ..     398     419 .. 0.89

  Alignments for each domain:
  == domain 1    score: 2.8 bits;  conditional E-value: 0.11
                 HHHHHH-TT--B---- CS
     PF09265 263 erKakyDPkaiLspGq 278
                 + K+ +DPk+i  pG+
  AAZ21098.1 402 KIKKSFDPKRIFNPGK 417
                 679***********96 PP

>> PF10172  Det1 complexing ubiquitin ligase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.3   0.0     0.078   2.4e+02      19      37 ..     215     233 ..     204     245 .. 0.72

  Alignments for each domain:
  == domain 1    score: 4.3 bits;  conditional E-value: 0.078
     PF10172  19 asdvikssnkrpsvYlptH 37 
                  + +++ss+ + +vY+p+ 
  AAZ21098.1 215 DKISSSSSEVSGAVYIPEE 233
                 5678899999*******94 PP

>> PF05912  Caenorhabditis elegans protein of unknown function (DUF870)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.1   0.0     0.083   2.6e+02      14      36 ..     342     364 ..     337     376 .. 0.77

  Alignments for each domain:
  == domain 1    score: 4.1 bits;  conditional E-value: 0.083
     PF05912  14 lWCGelyvleedvlgkhdilktd 36 
                  WCG+ly +e  ++    + +++
  AAZ21098.1 342 DWCGSLYWIEVQSKKNSKVSDIK 364
                 5*********9988554444444 PP

>> PF03494  Beta-amyloid peptide (beta-APP)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.0   0.0     0.073   2.3e+02      17      30 ..     107     120 ..      91     123 .. 0.88

  Alignments for each domain:
  == domain 1    score: 4.0 bits;  conditional E-value: 0.073
     PF03494  17 FAEDVsSNKGAIIG 30 
                 F E   SNKG I G
  AAZ21098.1 107 FIENGKSNKGTIAG 120
                 778889******98 PP

>> PF09542  FFD and TFG box motifs
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.6   0.0     0.067   2.1e+02       8      19 ..     212     223 ..     208     245 .. 0.77

  Alignments for each domain:
  == domain 1    score: 4.6 bits;  conditional E-value: 0.067
     PF09542   8 sFFDnIScetkd 19 
                 + FD+IS+++ +
  AAZ21098.1 212 NLFDKISSSSSE 223
                 56*******987 PP

>> PF06186  Protein of unknown function (DUF992)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.2   0.0     0.052   1.6e+02      12      50 ..     110     148 ..     105     176 .. 0.83

  Alignments for each domain:
  == domain 1    score: 4.2 bits;  conditional E-value: 0.052
     PF06186  12 aaaaaervkvGvLeCeieggvglivgSskeleCtfrped 50 
                 + ++++++ +G L C+ +g+  + vgS ++    fr  +
  AAZ21098.1 110 NGKSNKGTIAGHLACNFAGSRRFKVGSLRDHILGFRGVN 148
                 5677889999*****************999888887765 PP

>> PF01976  Protein of unknown function DUF116
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.3   0.0       0.1   3.3e+02      95     133 ..      24      62 ..      21      72 .. 0.84

  Alignments for each domain:
  == domain 1    score: 3.3 bits;  conditional E-value: 0.1
     PF01976  95 gsllkkiikekqpkaiigvaCerdLaegieklkrlgipv 133
                 ++l+++  k++qp  iig   ++++ ++i+++k+l++  
  AAZ21098.1  24 SNLVQELYKKNQPTEIIGTGSKNFIGNNIQSAKKLSMSK 62 
                 567888999************************988764 PP

>> PF07972  NrdI Flavodoxin like
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.7   0.0      0.12   3.7e+02      64      97 ..      26      59 ..      11      66 .. 0.81

  Alignments for each domain:
  == domain 1    score: 3.7 bits;  conditional E-value: 0.12
     PF07972 64 FlneeknrkllrgviasGNrnfgeqfclaakkis 97
                 ++e  ++++   +i++G +nf  +   +akk+s
  AAZ21098.1 26 LVQELYKKNQPTEIIGTGSKNFIGNNIQSAKKLS 59
                4555556778899**********99999999987 PP

>> PF08103  Uperin family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.5   0.6      0.16   5.1e+02       3      16 ..     151     164 ..     149     165 .. 0.84

  Alignments for each domain:
  == domain 1    score: 3.5 bits;  conditional E-value: 0.16
     PF08103   3 GDliRKiVsaIKNV 16 
                 GD+i+   +++KNV
  AAZ21098.1 151 GDIIKSGGTVVKNV 164
                 88888888*****9 PP

>> PF07609  Protein of unknown function (DUF1572)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.2   0.0      0.12   3.7e+02     102     154 ..     187     239 ..     180     242 .. 0.90

  Alignments for each domain:
  == domain 1    score: 3.2 bits;  conditional E-value: 0.12
     PF07609 102 aleslkeedlektvtiRgeahtvveaieRqlahyayhvgqlvflakllkekew 154
                 +l+ l +++l++t+ti  + + +v+ +  +++  ++ v   v++    k++++
  AAZ21098.1 187 TLKVLPKKKLSNTITIHTDDKKLVKNLFDKISSSSSEVSGAVYIPEEPKDENY 239
                 799999*********************999*9999999999999988888877 PP

>> PF09181  Prolyl-tRNA synthetase, C-terminal
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.9   0.0      0.22   6.8e+02       1      32 [.     200     231 ..     200     245 .. 0.87

  Alignments for each domain:
  == domain 1    score: 2.9 bits;  conditional E-value: 0.22
                 -EE-SS--HH......HHHHHCTTT---EEEE CS
     PF09181   1 itvleniekdllllsekvkeaLsekkGviLvP 32 
                 it+  +++k ++ l +k+    se  G + +P
  AAZ21098.1 200 ITIHTDDKKLVKNLFDKISSSSSEVSGAVYIP 231
                 7999999999*********************9 PP

>> PF04959  Arsenite-resistance protein 2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.4   0.1      0.16     5e+02      34      74 ..      59      99 ..      35     102 .. 0.83

  Alignments for each domain:
  == domain 1    score: 3.4 bits;  conditional E-value: 0.16
     PF04959 34 klakllskketlsedeakklGrkdpeqevekfvsantqeLa 74
                 ++kl  + e+l e+   k+ +  p + vek +++n qeLa
  AAZ21098.1 59 SMSKLSGVIEYLPEELYIKVKANTPLELVEKELEKNNQELA 99
                4566666789999999************************8 PP

>> PF02507  Photosystem I reaction centre subunit III
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.2   0.1      0.24   7.5e+02     118     141 ..     340     363 ..     331     367 .. 0.90

  Alignments for each domain:
  == domain 1    score: 2.2 bits;  conditional E-value: 0.24
     PF02507 118 wiGwvGrsyliavkkekkptekei 141
                 +i w G  y i+v+++k+++ ++i
  AAZ21098.1 340 YIDWCGSLYWIEVQSKKNSKVSDI 363
                 9****************9987776 PP

>> PF05217  STOP protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.1   0.1      0.21   6.7e+02     328     376 ..     203     251 ..     189     254 .. 0.73

  Alignments for each domain:
  == domain 1    score: 2.1 bits;  conditional E-value: 0.21
     PF05217 328 ttshkpakkakdkqiasgqaakkksaevsatakpedkekskelnnklae 376
                  t +k + k    +i+s+ +    +   ++++k e+ ++ ke+  k+ +
  AAZ21098.1 203 HTDDKKLVKNLFDKISSSSSEVSGAVYIPEEPKDENYDQNKEMVFKFND 251
                 344444445555568999999999999****************988765 PP

>> PF02370  M protein repeat
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.5   1.3      0.13   3.9e+02       3      13 ..      88      98 ..      87      99 .. 0.89

  Alignments for each domain:
  == domain 1    score: 4.5 bits;  conditional E-value: 0.13
     PF02370  3 kkeLEaelqeL 13
                 keLE+ +qeL
  AAZ21098.1 88 EKELEKNNQEL 98
                69********9 PP

>> PF02757  YLP motif
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.9   0.1       1.3     4e+03       3       6 ..      68      71 ..      67      71 .. 0.95

  Alignments for each domain:
  == domain 1    score: 0.9 bits;  conditional E-value: 1.3
     PF02757  3 EYLP 6 
                EYLP
  AAZ21098.1 68 EYLP 71
                9**9 PP

>> PF08262  Leucophaea maderae tachykinin-related peptide
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.0   0.1       1.1   3.3e+03       4       9 ..     142     147 ..     142     147 .. 0.92

  Alignments for each domain:
  == domain 1    score: 1.0 bits;  conditional E-value: 1.1
     PF08262   4 MGFhGv 9  
                 +GF Gv
  AAZ21098.1 142 LGFRGV 147
                 7****8 PP



Internal pipeline statistics summary:
-------------------------------------
Query sequence(s):                         1  (422 residues)
Target model(s):                       11912  (2158902 nodes)
Passed MSV filter:                       594  (0.0498657); expected 238.2 (0.02)
Passed bias filter:                      342  (0.0287105); expected 238.2 (0.02)
Passed Vit filter:                        35  (0.00293821); expected 11.9 (0.001)
Passed Fwd filter:                        34  (0.00285426); expected 0.1 (1e-05)
Initial search space (Z):             100000  [as set by --Z on cmdline]
Domain search space  (domZ):              32  [number of targets reported over threshold]
# CPU time: 0.29u 0.05s 00:00:00.34 Elapsed: 00:00:00
# Mc/sec: 3141.57
//