# hmmscan :: search sequence(s) against a profile HMM database
# HMMER 3.0b2 (June 2009); http://hmmer.org/
# Copyright (C) 2009 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query sequence file:             /home/niguts/usr08/shisakam/FASTA/gib_22942.fasta
# target HMM database:             /home/niguts/usr08/shisakam/PFAM/ver24.0/Pfam-A.hmm
# sequence search space set to:    100000
# set reporting thresholds to:     GA cutoffs
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       AAZ21392.1  [L=312]
Description: pubi0 wcaG GIB00256CH01 "GDP-fucose synthetase chain A"
Scores for complete sequence (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Model    Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    8.6e-65  221.2   0.0    1.1e-64  220.8   0.0    1.1  1  PF01370  NAD dependent epimerase/dehydratase family
    5.6e-08   34.7   0.0    9.4e-08   34.0   0.0    1.5  1  PF04321  RmlD substrate binding domain
  ------ inclusion threshold ------
      0.017   17.1   0.4        2.3   10.1   0.1    2.4  2  PF05368  NmrA-like family
      0.042   15.4   0.0        2.6    9.5   0.0    2.3  2  PF02719  Polysaccharide biosynthesis protein
       0.37   12.9   2.4       0.56   12.3   0.3    2.2  1  PF01973  Protein of unknown function DUF115
        0.4   13.2   0.0       0.64   12.5   0.0    1.4  1  PF00899  ThiF family
        4.2    9.4   0.0        8.1    8.5   0.0    1.4  1  PF03808  Glycosyl transferase WecB/TagA/CpsF family
         10    8.7   1.3    1.5e+02    4.9   0.1    2.9  2  PF06713  Protein of unknown function (DUF1200)
         15    8.3   0.0         52    6.5   0.0    1.9  1  PF07380  Pneumovirus M2 protein
         17    7.0   0.1         29    6.3   0.0    1.3  1  PF02276  Photosynthetic reaction centre cytochrome C subunit
         17    7.9   0.1         31    7.1   0.1    1.6  1  PF01368  DHH family
         20    7.7   0.0         36    6.9   0.0    1.4  1  PF00106  short chain dehydrogenase
         21    7.3   0.0         31    6.8   0.0    1.3  1  PF08659  KR domain
         23    6.9   0.0         43    6.0   0.0    1.4  1  PF10399  Ubiquitinol-cytochrome C reductase Fe-S subunit TAT
         30    7.2   0.0    2.3e+02    4.4   0.0    2.3  1  PF06858  Nucleolar GTP-binding protein 1 (NOG1)
         36    6.8   0.1         79    5.7   0.0    1.5  1  PF05339  Protein of unknown function (DUF739)
         43    6.7   0.0         82    5.8   0.0    1.5  1  PF01113  Dihydrodipicolinate reductase, N-terminus
         45    6.2   0.1         88    5.2   0.0    1.6  1  PF04926  Poly(A) polymerase predicted RNA binding domain
         59    5.4   0.0         90    4.8   0.0    1.2  1  PF00532  family
         65    6.2   0.7    3.9e+02    3.7   0.1    2.5  1  PF01731  Arylesterase
         85    5.2   0.0    3.2e+02    3.4   0.0    1.8  1  PF03584  Herpesvirus ICP4-like protein N-terminal region
    1.2e+02    5.4   0.1    3.3e+02    4.0   0.1    1.8  1  PF10906  Protein of unknown function (DUF2697)
    1.2e+02    4.7   0.0      2e+02    4.0   0.0    1.3  1  PF05724  Thiopurine S-methyltransferase (TPMT)
    1.3e+02    5.1   0.4    2.8e+02    4.0   0.3    1.5  1  PF05374  Mu-Conotoxin
    1.3e+02    5.5   0.0    2.6e+02    4.6   0.0    1.6  1  PF01118  Semialdehyde dehydrogenase, NAD binding domain
    1.5e+02    5.1   0.1    4.1e+02    3.7   0.1    1.7  1  PF07500  Transcription factor S-II (TFIIS), central domain
    2.5e+02    4.4   0.1    4.9e+02    3.4   0.1    1.4  1  PF10886  Protein of unknown function (DUF2685)
    4.5e+02    3.6   0.0    8.9e+02    2.6   0.0    1.5  1  PF01466  Skp1 family, dimerisation domain
    5.1e+02    3.8   0.4      1e+03    2.9   0.3    1.6  1  PF07546  EMI domain
    5.1e+02    3.2   0.2    1.5e+03    1.7   0.0    1.7  1  PF06328  Ig-like C2-type domain
    5.1e+02    3.0   1.1    6.8e+02    2.6   0.1    1.7  1  PF10863  Protein of unknown function (DUF2702)
    9.9e+02    2.4   8.7         31    7.2   0.6    2.5  1  PF09690  Plasmodium yoelii subtelomeric region (PYST-C1)
    4.8e+03    0.5   0.7    8.8e+03   -0.4   0.5    1.4  1  PF00446  Gonadotropin-releasing hormone


Domain and alignment annotation for each model:
>> PF01370  NAD dependent epimerase/dehydratase family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  220.8   0.0   3.7e-68   1.1e-64       1     238 []       8     239 ..       8     245 .. 0.97

  Alignments for each domain:
  == domain 1    score: 220.8 bits;  conditional E-value: 3.7e-68
                 EEEE--------HHHHHHHHH-TEEE-EESSCSTGGGTCCHHCTEEEEB--TT-HHHHHHHHHHHT-SEEEE--S---.HHHCCCSHHHHHHHHT---H CS
     PF01370   1 ilVtGgtGfiGsalveallekgyevvdnlirrtrseelaterlrvelvegdltdkdalerlfaeeqpdaVihlaaesg.vdassedpadfiennvvgtl 98 
                 i++tG++G++Gsa+ ++l++kgy+   nl +++r++             +dlt++ ++ +++++++pd ++ +aa++g +  +++++adfi +n+++++
  AAZ21392.1   8 IFITGHKGLVGSAIYRKLKAKGYT---NLLIADRKK-------------LDLTNQIKVIKFLKKKKPDFIFIAAAKVGgIYYNLKYKADFITENLQIQT 90 
                 79**********************...*******99.............******************************99****************** PP

                 HHHHHHHHHTC-EEEEEEEGGG---BSSSCB-TTS--.--SSH....HHHHHHHHHHHHHHHHHHHT-EEEEEEESEEE-TT....-SCCSHHHHHHHH CS
     PF01370  99 nlleaarkagvkrlvflsSsevYgkdaeepikEetpl.gplsp....YaaaKlageklveayareyglraiilrlfnvyGpr.nfdeeetkvipalirr 191
                 nl++ a k+g+k l+fl+Ss+vY+k+ ++pikE+++l g+l++    Ya+aK+ag k++++y+++y++++ +l+++n yGp+ n+d+ ++++ipali++
  AAZ21392.1  91 NLIHGAYKCGIKDLIFLGSSCVYPKNCKQPIKETYLLsGKLEEtndaYAIAKIAGIKMCQSYNEQYKTKYKCLMPTNTYGPNdNYDKNNSHFIPALIKK 189
                 **************************************99999999***************************************************** PP

                 HH....---SSEEEE--TT-EEEEEEHHHHHHHHHHHHHSSS.--EEEEE- CS
     PF01370 192 il....egeeeltllgdGtqlRdflyveDvaraillalehpevegeiyniG 238
                 i+    +++++++l+g+G+++R+ ++v+D+a+a++++++++  e+  +niG
  AAZ21392.1 190 IHklklSKKNTVILWGNGKAKREVIHVDDIAEACIFFMKKKT-EHFLINIG 239
                 **777755558******************************9.77777777 PP

>> PF04321  RmlD substrate binding domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   34.0   0.0   3.1e-11   9.4e-08       2      61 ..       7      67 ..       6     156 .. 0.82

  Alignments for each domain:
  == domain 1    score: 34.0 bits;  conditional E-value: 3.1e-11
                EEEEE--------HHHHHH----EEEEE-.-TTT--TT-HHHHHHHHHHH--SEEEE---- CS
     PF04321  2 rilvtGanGqlGteLaralkeegvevval.dreeldltdpeavaalvkeakpdvvvnaAAy 61
                ri +tG++G +G++++r+lk++g++ + + dr++ldlt++ +v +++k++kpd++  aAA 
  AAZ21392.1  7 RIFITGHKGLVGSAIYRKLKAKGYTNLLIaDRKKLDLTNQIKVIKFLKKKKPDFIFIAAAK 67
                799********************9877777*************************999995 PP

>> PF05368  NmrA-like family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   10.1   0.1   0.00074       2.3      54     118 ..      57     123 ..       8     175 .. 0.66
   2 ?    5.2   0.0     0.023        71     149     199 ..     182     233 ..     168     267 .. 0.77

  Alignments for each domain:
  == domain 1    score: 10.1 bits;  conditional E-value: 0.00074
                 -HHHHHHHH----EEEE---TT-...--TTT---HHHHHHHH---SEEEEEE---GG.G---.----T CS
     PF05368  54 dkeslvealkgvdvvfsvttfve...skeiedgkklvdAakeaGvkrfvpSelgndndrsnaeePavp 118
                   + +  a  +v  ++ ++++ +    ++++++++l++ a + G+k +++ +  +    +n ++P ++
  AAZ21392.1  57 KPDFIFIAAAKVGGIYYNLKYKAdfiTENLQIQTNLIHGAYKCGIKDLIFLGSSCVY-PKNCKQPIKE 123
                 445566677899999999998779999********************9995544433.3344455554 PP

  == domain 2    score: 5.2 bits;  conditional E-value: 0.023
                 -BSSS-S..BEEE----.-EEEEESS-TTS-EE-HHHH---HHHHHHH--TTT CS
     PF05368 149 flsllaq..vgdlepsrdkvvllgpgnpkavlldkeeDiGtfvikilkdprkl 199
                 f++ l +  ++ + +++++v+l g+g++k  ++ +++Di+++ i  +k++++ 
  AAZ21392.1 182 FIPALIKkiHKLKLSKKNTVILWGNGKAKREVI-HVDDIAEACIFFMKKKTEH 233
                 55555556555555667799999****999999.********99999886654 PP

>> PF02719  Polysaccharide biosynthesis protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.6   0.0     0.028        84       1      36 [.       8      43 ..       8      48 .. 0.91
   2 ?    9.5   0.0   0.00087       2.6      64     130 ..      42     109 ..      41     124 .. 0.82

  Alignments for each domain:
  == domain 1    score: 4.6 bits;  conditional E-value: 0.028
                EEEE--------HHHHHHHHHB-SEEEEE-S-HHHH CS
     PF02719  1 vlvtGagGSiGselvrqilkkkpkkiillersElkl 36
                +++tG  G +Gs++ r++ +k  +++++ +r+ l l
  AAZ21392.1  8 IFITGHKGLVGSAIYRKLKAKGYTNLLIADRKKLDL 43
                78****************************987765 PP

  == domain 2    score: 9.5 bits;  conditional E-value: 0.00087
                 -TT-HHHHHHHT-..---EEEE-----.-HHHHHHSHHHHHHHHT---HHHHHHHHHTT-SEEEEEEE CS
     PF02719  64 dvrdkerleealeelkvdvvfhaAAlK.hVplveenpleavktNvlgtenvieaaieagvekvvliSt 130
                 d++++ ++ + l++ k+d++f aAA    +    ++ ++ ++ N    +n+i+ a ++g+++++++ +
  AAZ21392.1  42 DLTNQIKVIKFLKKKKPDFIFIAAAKVgGIYYNLKYKADFITENLQIQTNLIHGAYKCGIKDLIFLGS 109
                 6678889999***********9999531344445567899************************9865 PP

>> PF01973  Protein of unknown function DUF115
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   12.3   0.3   0.00019      0.56      39     116 ..      49     126 ..      43     173 .. 0.79

  Alignments for each domain:
  == domain 1    score: 12.3 bits;  conditional E-value: 0.00019
     PF01973  39 qlellkknrdkaviiaadtalkaLlkegIkPDivvs.lDrqeityevfkeakkeg..siplvhasgvnpevlekykgkkif 116
                  +++lkk + +++ iaa  +  ++++ + k D++++ l     +++++  a k+g  + +++ +s+v+p+ +++  ++ + 
  AAZ21392.1  49 VIKFLKKKKPDFIFIAAAKVGGIYYNLKYKADFITEnLQI---QTNLIHGAYKCGikDLIFLGSSCVYPKNCKQPIKETYL 126
                 4778888889999999999999999999999999875555...77777777777777999999999999988887777664 PP

>> PF00899  ThiF family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   12.5   0.0   0.00021      0.64       1      46 [.       4      50 ..       4     106 .. 0.89

  Alignments for each domain:
  == domain 1    score: 12.5 bits;  conditional E-value: 0.00021
     PF00899  1 ksskvlvvGa.GglGseaaeaLaraGvgkltlvDkDtvelsNlnRql 46
                ++s++++ G  G +Gs++ + L + G  +l ++D+ + +l+N  + +
  AAZ21392.1  4 RNSRIFITGHkGLVGSAIYRKLKAKGYTNLLIADRKKLDLTNQIKVI 50
                57999999975889****************************87655 PP

>> PF03808  Glycosyl transferase WecB/TagA/CpsF family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.5   0.0    0.0027       8.1      46     109 ..       3      65 ..       1      69 [. 0.88

  Alignments for each domain:
  == domain 1    score: 8.5 bits;  conditional E-value: 0.0027
     PF03808  46 ekglrvfllGakeevlekaaerlkar.ypglkivgvrdgyfkeeeeeaiieeInaskadlvlvgl 109
                 +++ r+f+ G k  v +++ ++lka+ y +l i+ +++   + +++ ++i+ ++++k+d+++++ 
  AAZ21392.1   3 NRNSRIFITGHKGLVGSAIYRKLKAKgYTNLLIADRKKL--DLTNQIKVIKFLKKKKPDFIFIAA 65 
                 5678*******************9875888888887776..6669*****************985 PP

>> PF06713  Protein of unknown function (DUF1200)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.9   0.1      0.05   1.5e+02      28      54 ..     245     271 ..     244     281 .. 0.84
   2 ?    1.2   0.1      0.73   2.2e+03      18      38 ..     289     309 ..     278     311 .. 0.81

  Alignments for each domain:
  == domain 1    score: 4.9 bits;  conditional E-value: 0.05
     PF06713  28 kirktksplsspalsldrleIkygkyd 54 
                 +i+++ +++++ +l  ++++Iky+k +
  AAZ21392.1 245 SIKYYLEFIAKVILGNKKIKIKYDKTK 271
                 79999999***************9543 PP

  == domain 2    score: 1.2 bits;  conditional E-value: 0.73
     PF06713  18 rkkIpiedIkkirktksplss 38 
                  +k +++ I++ir+t + +++
  AAZ21392.1 289 GWKSKMSLITSIRNTYKSFVR 309
                 47888999*******998875 PP

>> PF07380  Pneumovirus M2 protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.5   0.0     0.017        52      18      75 ..      31      88 ..      27     102 .. 0.85

  Alignments for each domain:
  == domain 1    score: 6.5 bits;  conditional E-value: 0.017
     PF07380 18 ssiliksesdvavlnhknvldfnqnqldnhmysqnqildeiyWtsqelidavqkflql 75
                + +li ++ ++ + n+  v++f++ + +   +     +  iy+  +   d + + lq 
  AAZ21392.1 31 TNLLIADRKKLDLTNQIKVIKFLKKKKPDFIFIAAAKVGGIYYNLKYKADFITENLQI 88
                689*************************999999999999999988888777777764 PP

>> PF02276  Photosynthetic reaction centre cytochrome C subunit
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.3   0.0    0.0095        29     249     286 ..     140     177 ..     106     181 .. 0.76

  Alignments for each domain:
  == domain 1    score: 6.3 bits;  conditional E-value: 0.0095
                 HHHH---HHHHHHHHHTTGGGGGTS-GGG--------B CS
     PF02276 249 vtawlgirmvrelnneylepledvlPeerlGpvgdaak 286
                   ++ gi+m +  n++y ++ +  +P +  Gp  +  k
  AAZ21392.1 140 IAKIAGIKMCQSYNEQYKTKYKCLMPTNTYGPNDNYDK 177
                 345789**************************877666 PP

>> PF01368  DHH family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.1   0.1      0.01        31       2      38 ..       2      51 ..       1     227 [. 0.62

  Alignments for each domain:
  == domain 1    score: 7.1 bits;  conditional E-value: 0.01
                CCTTEEEEEE--TT-SHHHHHHHHHHHHHHCCHH--..................C CS
                xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx..................x RF
     PF01368  2 ikalervyvighknpDtDsvcSaiglahflnnvekg..................v 38
                i+++ r+++ ghk     ++++++++ +++ +   +                   
  AAZ21392.1  2 INRNSRIFITGHK-----GLVGSAIYRKLKAKGYTNlliadrkkldltnqikviK 51
                78999********.....************9999994444444444444444440 PP

>> PF00106  short chain dehydrogenase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.9   0.0     0.012        36       3      51 ..       8      57 ..       6      69 .. 0.78

  Alignments for each domain:
  == domain 1    score: 6.9 bits;  conditional E-value: 0.012
                EEEE--------HHHHHHHHH.-EEEEEESSS..SHHHHHHHHHHHHHTS CS
     PF00106  3 vliTGGlgglGlalArwLveegarhlvlvsrr.edapgaaeliaelealg 51
                + iTG  g +G a+ r+L ++g  +l++++r+  d   + ++i+ l+++ 
  AAZ21392.1  8 IFITGHKGLVGSAIYRKLKAKGYTNLLIADRKkLDLTNQIKVIKFLKKKK 57
                67*****************************9655555566677766555 PP

>> PF08659  KR domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.8   0.0      0.01        31       4      44 ..       9      49 ..       6      65 .. 0.81

  Alignments for each domain:
  == domain 1    score: 6.8 bits;  conditional E-value: 0.01
     PF08659  4 LvtGGlgglGlelarwLaergarhlvllsrsaapdeeaeal 44
                 +tG  g +G ++ r L ++g ++l+++ r++    ++ + 
  AAZ21392.1  9 FITGHKGLVGSAIYRKLKAKGYTNLLIADRKKLDLTNQIKV 49
                79****************************95444444444 PP

>> PF10399  Ubiquitinol-cytochrome C reductase Fe-S subunit TAT signal
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.0   0.0     0.014        43      13      25 ..      59      71 ..      54      72 .. 0.88

  Alignments for each domain:
  == domain 1    score: 6.0 bits;  conditional E-value: 0.014
                HHHHHHHHH---- CS
     PF10399 13 DFLylATaavgaV 25
                DF+++A+a vg++
  AAZ21392.1 59 DFIFIAAAKVGGI 71
                9**********86 PP

>> PF06858  Nucleolar GTP-binding protein 1 (NOG1)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.4   0.0     0.075   2.3e+02      20      46 ..     279     305 ..     279     309 .. 0.91

  Alignments for each domain:
  == domain 1    score: 4.4 bits;  conditional E-value: 0.075
     PF06858  20 lfDlseqcgysleeQlkLfkeikelFk 46 
                 ++D+s    y  ++ ++L  +i++ +k
  AAZ21392.1 279 VMDISLAKKYGWKSKMSLITSIRNTYK 305
                 79*********************9874 PP

>> PF05339  Protein of unknown function (DUF739)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.7   0.0     0.026        79      22      65 ..     224     266 ..     217     272 .. 0.87

  Alignments for each domain:
  == domain 1    score: 5.7 bits;  conditional E-value: 0.026
                 HHHHHHHHHHHT---EEE---E---EEEEEE--HHHHTHHHHHH CS
     PF05339  22 isalkevtidflekygaegkdklellvyafisaldveerslssk 65 
                 i+ +k+ t++fl+++g+ gkd    ++++fi  + + +++++ k
  AAZ21392.1 224 IFFMKKKTEHFLINIGT-GKDYSIKYYLEFIAKVILGNKKIKIK 266
                 7899*************.9999999999***9999999888876 PP

>> PF01113  Dihydrodipicolinate reductase, N-terminus
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.8   0.0     0.027        82       2      50 ..       7      55 ..       6      67 .. 0.70

  Alignments for each domain:
  == domain 1    score: 5.8 bits;  conditional E-value: 0.027
                EEEEB--------HHHHHHHH----EE-EEB----.-TT---B------- CS
     PF01113  2 kvavvGasGrmGkevikaieeaedlelvaavdrke.selegkdagellgl 50
                ++ ++G +G +G+++ + ++++  ++l  a drk+   +++ ++ ++l+ 
  AAZ21392.1  7 RIFITGHKGLVGSAIYRKLKAKGYTNLLIA-DRKKlDLTNQIKVIKFLKK 55
                799****************99777776666.5554244444455555555 PP

>> PF04926  Poly(A) polymerase predicted RNA binding domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.2   0.0     0.029        88      42      80 ..     142     180 ..     137     272 .. 0.77

  Alignments for each domain:
  == domain 1    score: 5.2 bits;  conditional E-value: 0.029
                 T-----B----SS-EEEEEE-EBECTTCTTSHHHHHSSE CS
     PF04926  42 rvegialAhpfpkgfervhrceekkdenkeeaseekkee 80 
                 ++ gi++++ ++++++++++c   +++   + +++k+++
  AAZ21392.1 142 KIAGIKMCQSYNEQYKTKYKCLMPTNTYGPNDNYDKNNS 180
                 6789*****************555544444444444333 PP

>> PF00532  family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.8   0.0      0.03        90      22      65 ..      20      66 ..      17      82 .. 0.88

  Alignments for each domain:
  == domain 1    score: 4.8 bits;  conditional E-value: 0.03
                HHHH-------EEEEEE-----HHH...HHHHHHHH------EEE-S CS
     PF00532 22 gitkaakehgvdvlllaageeedla...kaidllkakgidgliiats 65
                +i + +k+ g+  ll+a+ ++ dl    k i+ lk+k++d + ia +
  AAZ21392.1 20 AIYRKLKAKGYTNLLIADRKKLDLTnqiKVIKFLKKKKPDFIFIAAA 66
                788999******************96666778899999999999865 PP

>> PF01731  Arylesterase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.7   0.1      0.13   3.9e+02      63      85 ..     209     231 ..     205     232 .. 0.89

  Alignments for each domain:
  == domain 1    score: 3.7 bits;  conditional E-value: 0.13
                 ----EEEEEETTTTEEEEEEE-T CS
     PF01731  63 adkkyiyvadilresihvmkkhk 85 
                 a++ +i+v di +  i+ mkk++
  AAZ21392.1 209 AKREVIHVDDIAEACIFFMKKKT 231
                 68899***************986 PP

>> PF03584  Herpesvirus ICP4-like protein N-terminal region
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.4   0.0      0.11   3.2e+02     142     170 ..     281     309 ..     268     311 .. 0.88

  Alignments for each domain:
  == domain 1    score: 3.4 bits;  conditional E-value: 0.11
     PF03584 142 avamsRRYdraqKtfllqsLrrAyaplva 170
                  ++++++Y  + K  l++s+r  y ++v 
  AAZ21392.1 281 DISLAKKYGWKSKMSLITSIRNTYKSFVR 309
                 58999********************9986 PP

>> PF10906  Protein of unknown function (DUF2697)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.0   0.1      0.11   3.3e+02      23      50 ..     141     168 ..     138     172 .. 0.90

  Alignments for each domain:
  == domain 1    score: 4.0 bits;  conditional E-value: 0.11
     PF10906  23 akvNrIkeepvaeeetkkseklykPTrl 50 
                 ak+ +Ik+ +  +e+ k++ k   PT++
  AAZ21392.1 141 AKIAGIKMCQSYNEQYKTKYKCLMPTNT 168
                 79**************999999999985 PP

>> PF05724  Thiopurine S-methyltransferase (TPMT)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.0   0.0     0.066     2e+02     152     188 ..     263     299 ..     246     311 .. 0.79

  Alignments for each domain:
  == domain 1    score: 4.0 bits;  conditional E-value: 0.066
                 EEESS-SSS---------HHHHHHT----EEEEEE-- CS
     PF05724 152 vtldypqaeheGPPfsvpeeeleallsagfkvaelee 188
                 + ++y++++ +G P +v +  l++ ++ + k+  +++
  AAZ21392.1 263 IKIKYDKTKPNGSPRKVMDISLAKKYGWKSKMSLITS 299
                 789****************999999988878776655 PP

>> PF05374  Mu-Conotoxin
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.0   0.3     0.092   2.8e+02       4      11 ..     111     118 ..     109     119 .. 0.90

  Alignments for each domain:
  == domain 1    score: 4.0 bits;  conditional E-value: 0.092
                 SSSSTGGC CS
     PF05374   4 CtpPkkCk 11 
                 C +Pk Ck
  AAZ21392.1 111 CVYPKNCK 118
                 99*****9 PP

>> PF01118  Semialdehyde dehydrogenase, NAD binding domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.6   0.0     0.084   2.6e+02       1      27 [.       7      33 ..       7      67 .. 0.84

  Alignments for each domain:
  == domain 1    score: 4.6 bits;  conditional E-value: 0.084
                EEEEE--------HHHHHHCTTSSEEE CS
     PF01118  1 kvaivGatGyvGqellrlLeehpelel 27
                +++i G  G vG+ + r L+ + + +l
  AAZ21392.1  7 RIFITGHKGLVGSAIYRKLKAKGYTNL 33
                689****************98776665 PP

>> PF07500  Transcription factor S-II (TFIIS), central domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.7   0.1      0.14   4.1e+02      43      60 ..     147     164 ..     115     166 .. 0.80

  Alignments for each domain:
  == domain 1    score: 3.7 bits;  conditional E-value: 0.14
                 CCHTTTCCHHHHHHHHHC CS
     PF07500  43 keikntdkkYknkvRsli 60 
                 k +++++++Yk+k++ l+
  AAZ21392.1 147 KMCQSYNEQYKTKYKCLM 164
                 5566779********998 PP

>> PF10886  Protein of unknown function (DUF2685)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.4   0.1      0.16   4.9e+02       7      14 ..     117     124 ..     109     129 .. 0.79

  Alignments for each domain:
  == domain 1    score: 3.4 bits;  conditional E-value: 0.16
     PF10886   7 CKqPveka 14 
                 CKqP+++ 
  AAZ21392.1 117 CKQPIKET 124
                 *****986 PP

>> PF01466  Skp1 family, dimerisation domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.6   0.0      0.29   8.9e+02       4      39 ..      77     112 ..      75     140 .. 0.88

  Alignments for each domain:
  == domain 1    score: 2.6 bits;  conditional E-value: 0.29
     PF01466   4 wDaeFlevdeetLfdlilAAnyLnikgLldlackkv 39 
                 + a+F++ + ++ ++li  A    ik+L+ l + +v
  AAZ21392.1  77 YKADFITENLQIQTNLIHGAYKCGIKDLIFLGSSCV 112
                 5689999999999***************99988887 PP

>> PF07546  EMI domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.9   0.3      0.34     1e+03      36      51 ..     146     161 ..     109     169 .. 0.76

  Alignments for each domain:
  == domain 1    score: 2.9 bits;  conditional E-value: 0.34
     PF07546  36 grtCpsyrtlyrpsYr 51 
                  + C+sy   y+++Y+
  AAZ21392.1 146 IKMCQSYNEQYKTKYK 161
                 5678888888888887 PP

>> PF06328  Ig-like C2-type domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.7   0.0       0.5   1.5e+03      24      39 ..     110     125 ..     105     132 .. 0.86

  Alignments for each domain:
  == domain 1    score: 1.7 bits;  conditional E-value: 0.5
                 EEE--CCCHCT-SCCC CS
     PF06328  24 sCilkqkclhsvsakk 39 
                 sC++ ++c++ +++++
  AAZ21392.1 110 SCVYPKNCKQPIKETY 125
                 8********9887776 PP

>> PF10863  Protein of unknown function (DUF2702)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.6   0.1      0.22   6.8e+02      84     143 .]     252     311 ..     236     311 .. 0.85

  Alignments for each domain:
  == domain 1    score: 2.6 bits;  conditional E-value: 0.22
     PF10863  84 tigdFiksdkkvsslakkkkkteeaskrnsiyrvakddtkamiaLknKmrkeerekirkk 143
                  i   i ++kk++ +  k+k++ + +k  +i  ++k   k+ ++L   +r++ ++ +r++
  AAZ21392.1 252 FIAKVILGNKKIKIKYDKTKPNGSPRKVMDISLAKKYGWKSKMSLITSIRNTYKSFVREN 311
                 566778899999999999999888899999999*******************99999875 PP

>> PF09690  Plasmodium yoelii subtelomeric region (PYST-C1)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.2   0.6      0.01        31      36      73 ..     143     180 ..     137     199 .. 0.82

  Alignments for each domain:
  == domain 1    score: 7.2 bits;  conditional E-value: 0.01
     PF09690  36 iraikkinrsnekndieskretqLkNnnnkdekddkdd 73 
                 i +ik  +  ne+ ++++k+ +  +   ++d+ d++++
  AAZ21392.1 143 IAGIKMCQSYNEQYKTKYKCLMPTNTYGPNDNYDKNNS 180
                 789******************99999888665555543 PP

>> PF00446  Gonadotropin-releasing hormone
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -0.4   0.5       2.9   8.8e+03       5       8 ..     288     291 ..     288     291 .. 0.93

  Alignments for each domain:
  == domain 1    score: -0.4 bits;  conditional E-value: 2.9
     PF00446   5 HgWk 8  
                 +gWk
  AAZ21392.1 288 YGWK 291
                 9**9 PP



Internal pipeline statistics summary:
-------------------------------------
Query sequence(s):                         1  (312 residues)
Target model(s):                       11912  (2158902 nodes)
Passed MSV filter:                       495  (0.0415547); expected 238.2 (0.02)
Passed bias filter:                      290  (0.0243452); expected 238.2 (0.02)
Passed Vit filter:                        34  (0.00285426); expected 11.9 (0.001)
Passed Fwd filter:                        34  (0.00285426); expected 0.1 (1e-05)
Initial search space (Z):             100000  [as set by --Z on cmdline]
Domain search space  (domZ):              33  [number of targets reported over threshold]
# CPU time: 0.26u 0.04s 00:00:00.30 Elapsed: 00:00:01
# Mc/sec: 2590.68
//