# hmmscan :: search sequence(s) against a profile HMM database
# HMMER 3.0b2 (June 2009); http://hmmer.org/
# Copyright (C) 2009 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query sequence file:             /home/niguts/usr08/shisakam/FASTA/gib_22949.fasta
# target HMM database:             /home/niguts/usr08/shisakam/PFAM/ver24.0/Pfam-A.hmm
# sequence search space set to:    100000
# set reporting thresholds to:     GA cutoffs
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       AAZ22049.1  [L=202]
Description: pubi0 folE GIB00256CH01 "GTP cyclohydrolase I"
Scores for complete sequence (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Model    Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
      4e-36  125.2   0.3    6.6e-36  124.5   0.2    1.4  1  PF01227  GTP cyclohydrolase I
  ------ inclusion threshold ------
        0.1   15.2   0.0       0.18   14.4   0.0    1.4  1  PF07511  Protein of unknown function (DUF1525)
       0.22   12.7   0.1       0.28   12.4   0.1    1.1  1  PF02733  Dak1 domain
       0.54   13.0   0.0       0.79   12.5   0.0    1.3  1  PF02635  DsrE/DsrF-like family
        2.5   10.7   0.0        6.3    9.4   0.0    1.7  1  PF09687  Protein of unknown function (P_fal_TIGR01639)
        3.9    9.8   0.1         32    6.8   0.0    2.5  1  PF02637  GatB domain
        5.7    8.9   0.1         10    8.1   0.0    1.4  1  PF03923  Uncharacterized lipoprotein
        7.2    9.1   0.0         11    8.5   0.0    1.2  1  PF07283  Conjugal transfer protein TrbH
        7.4    8.4   0.0         11    7.8   0.0    1.3  1  PF03936  Terpene synthase family, metal binding domain
        8.6    8.2   0.1         12    7.6   0.0    1.2  1  PF11050  Virus envelope protein E26
         13    8.2   0.0         40    6.5   0.0    1.9  1  PF06777  Protein of unknown function (DUF1227)
         13    8.3   0.0         28    7.2   0.0    1.5  1  PF10440  WIYLD domain
         17    8.0   0.1         63    6.1   0.0    1.9  1  PF04854  Protein of unknown function, DUF624
         17    8.0   0.0         34    7.1   0.0    1.5  1  PF10898  Protein of unknown function (DUF2716)
         17    7.9   0.0    2.9e+02    4.0   0.0    2.1  2  PF05871  ESCRT-II complex subunit
         22    7.4   0.0         49    6.3   0.0    1.6  1  PF09720  Putative addiction module component
         22    7.6   0.0         52    6.4   0.0    1.7  1  PF00627  UBA/TS-N domain
         24    6.3   0.0         33    5.8   0.0    1.2  1  PF05913  Bacterial protein of unknown function (DUF871)
         25    5.8   0.0         27    5.7   0.0    1.3  1  PF06782  Uncharacterised protein family (UPF0236)
         29    6.6   0.1    1.5e+02    4.3   0.0    1.9  1  PF01454  MAGE family
         29    6.4   0.0         45    5.7   0.0    1.3  1  PF07454  Stage II sporulation protein P (SpoIIP)
         34    6.9   0.6    3.2e+02    3.8   0.0    2.0  2  PF03243  Alkylmercury lyase
         48    6.3   0.1    1.8e+02    4.5   0.0    1.9  1  PF04778  LMP repeated region
         50    6.2   0.5    1.6e+02    4.5   0.0    2.0  1  PF02885  Glycosyl transferase family, helical bundle domain
         51    6.3   0.0         66    6.0   0.0    1.2  1  PF04093  rod shape-determining protein MreD
         53    6.4   0.1    4.3e+02    3.5   0.0    2.1  2  PF02754  Cysteine-rich domain
         56    6.1   0.0    1.2e+02    5.1   0.0    1.5  1  PF00626  Gelsolin repeat
         62    5.8   0.0    1.2e+02    4.9   0.0    1.4  1  PF02981  Restriction endonuclease FokI, recognition domain
         67    6.2   0.4    1.7e+02    4.9   0.0    1.7  1  PF11018  Pupal cuticle protein C1
         81    6.1   0.0    1.5e+02    5.3   0.0    1.5  1  PF06946  Phage holin
         81    5.6   0.1    1.4e+02    4.8   0.1    1.3  1  PF08879  WRC
         90    5.4   0.0    1.9e+02    4.3   0.0    1.5  1  PF03190  Protein of unknown function, DUF255
    1.1e+02    4.1   0.0      2e+02    3.3   0.0    1.3  1  PF06727  Protein of unknown function (DUF1207)
    1.1e+02    5.6   0.2    1.9e+02    4.9   0.1    1.3  1  PF05650  Domain of unknown function (DUF802)
    1.3e+02    4.3   0.1    3.5e+02    2.9   0.1    1.6  1  PF02574  Homocysteine S-methyltransferase
    1.9e+02    4.3   0.1    3.5e+02    3.5   0.0    1.4  1  PF09329  Primase zinc finger
    2.4e+02    3.1   0.1    3.9e+02    2.4   0.1    1.2  1  PF04393  Protein of unknown function (DUF535)
    3.2e+02    3.6   0.1    5.3e+02    2.9   0.1    1.3  1  PF01404  Ephrin receptor ligand binding domain
    3.8e+02    3.8   0.1    7.4e+02    2.9   0.1    1.5  1  PF01627  Hpt domain
    1.7e+03    1.5   0.1    3.5e+03    0.5   0.1    1.4  1  PF03911  Sec61beta family


Domain and alignment annotation for each model:
>> PF01227  GTP cyclohydrolase I
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  124.5   0.2   2.6e-39   6.6e-36       1      85 [.      99     183 ..      99     184 .. 0.98

  Alignments for each domain:
  == domain 1    score: 124.5 bits;  conditional E-value: 2.6e-39
     PF01227   1 PffgkahvaYiPngkvvglsklarivevfarrlqvqErlteqiadalsellkpkgvaVvieAeHlCmtmRGvekpgsktvtsalr 85 
                 P++g+ahvaYiPn++vvglsklar+vevf++rlq+qErlt+q+a+al++ l++kgvaV+i+A+H+CmtmRG++k++++tvt+ + 
  AAZ22049.1  99 PIVGTAHVAYIPNERVVGLSKLARVVEVFSKRLQTQERLTMQVAQALMTSLDAKGVAVTIDAAHQCMTMRGIKKENATTVTNYFL 183
                 99*******************************************************************************8765 PP

>> PF07511  Protein of unknown function (DUF1525)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   14.4   0.0   7.4e-05      0.18      17      74 ..     109     166 ..      96     173 .. 0.90

  Alignments for each domain:
  == domain 1    score: 14.4 bits;  conditional E-value: 7.4e-05
     PF07511  17 elavevyeldaverleeelsaeLpadpqqaeaqarqrlqspewkrlqeqlkkayqgla 74 
                  ++ +v+ l +++r+ e +s++L ++++  ++ a+++++s++ k     + +a q ++
  AAZ22049.1 109 IPNERVVGLSKLARVVEVFSKRLQTQERLTMQVAQALMTSLDAKGVAVTIDAAHQCMT 166
                 4789**********************************************99999875 PP

>> PF02733  Dak1 domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   12.4   0.1   0.00011      0.28     257     318 ..     115     174 ..      81     181 .. 0.80

  Alignments for each domain:
  == domain 1    score: 12.4 bits;  conditional E-value: 0.00011
                 --HHHH---HHHHHHHH.HH---EEEEEE----S--TT----EEEEEEE-HHHHHHHHS-EE CS
     PF02733 257 vsllelyaiaekvveqlaeeagikiervltGafvtsldgaGfsitllkadkatkkllkafek 318
                 v l++l  + e+ +++l+++ +++++  ++ a++tsld +G+++t+  a + ++ +  + e+
  AAZ22049.1 115 VGLSKLARVVEVFSKRLQTQERLTMQ--VAQALMTSLDAKGVAVTIDAAHQCMTMRGIKKEN 174
                 6678899999*******999999875..6789*************99988877666555555 PP

>> PF02635  DsrE/DsrF-like family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   12.5   0.0   0.00032      0.79      48     106 ..     126     186 ..     117     199 .. 0.73

  Alignments for each domain:
  == domain 1    score: 12.5 bits;  conditional E-value: 0.00032
                 GGBT..--------HHTHHHHHHHHHTS..-EEEEEHHHHHHTT-HG..GHBCT-EEEEE-HHHH CS
     PF02635  48 lllk..qtsnpideknlkellkaLkeyg..vklvvCgnaakargide..ldlvgvdvvpsglgel 106
                 +++k  qt++   ++  ++l+ +L ++g  v++ + ++++  rgi++  +     +v+   lge+
  AAZ22049.1 126 VFSKrlQTQERLTMQVAQALMTSLDAKGvaVTIDAAHQCMTMRGIKKenA----TTVTNYFLGEF 186
                 5556777777777788899***************************7431....23555555555 PP

>> PF09687  Protein of unknown function (P_fal_TIGR01639)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    9.4   0.0    0.0025       6.3       9      46 ..      20      57 ..      15      71 .. 0.82

  Alignments for each domain:
  == domain 1    score: 9.4 bits;  conditional E-value: 0.0025
     PF09687  9 qltkeeLnevLnsleevpsnedLiniWnhvlgiakegf 46
                +  +e ++++L ++ e ps+e L +  + v++  ke f
  AAZ22049.1 20 KEAEEAFKTILTWMGEDPSREGLLETPKRVVKAFKEYF 57
                556899*****************998888888777766 PP

>> PF02637  GatB domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.8   0.0     0.013        32      50      78 ..      10      38 ..       9      88 .. 0.89

  Alignments for each domain:
  == domain 1    score: 6.8 bits;  conditional E-value: 0.013
                TTS----GGGHHHHHHH----.------- CS
     PF02637 50 kliaegkiskkiakevleelleepgkspe 78
                k ++ +k+s+k a+e ++++l+  g++p+
  AAZ22049.1 10 KILDTKKVSDKEAEEAFKTILTWMGEDPS 38
                67899****************98888885 PP

>> PF03923  Uncharacterized lipoprotein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.1   0.0     0.004        10      40      73 ..     129     162 ..     118     169 .. 0.85

  Alignments for each domain:
  == domain 1    score: 8.1 bits;  conditional E-value: 0.004
     PF03923  40 ellsasqslrlllqqvlqqqlaskGfridnasnn 73 
                 + l++++ l++++ q+l+ +l +kG+ ++ ++++
  AAZ22049.1 129 KRLQTQERLTMQVAQALMTSLDAKGVAVTIDAAH 162
                 578999**********************877765 PP

>> PF07283  Conjugal transfer protein TrbH
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.5   0.0    0.0044        11      14      84 ..     118     187 ..     111     192 .. 0.76

  Alignments for each domain:
  == domain 1    score: 8.5 bits;  conditional E-value: 0.0044
     PF07283  14 kqLaklypPaktrleLkqktadafgaaLvesLrkkGYavleikkakqkaaakaaasaeaglpLrYvvdeae 84 
                 ++La+++   + rl+ + + + +  +aL++sL +kG av+ +++++     +   +++a++  +Y + e++
  AAZ22049.1 118 SKLARVVEVFSKRLQTQERLTMQVAQALMTSLDAKGVAVTIDAAHQC-MTMRGIKKENATTVTNYFLGEFK 187
                 67777777788899999999999****************87766654.44445555666666677776665 PP

>> PF03936  Terpene synthase family, metal binding domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.8   0.0    0.0043        11      95     172 ..       3      79 ..       1      92 [. 0.87

  Alignments for each domain:
  == domain 1    score: 7.8 bits;  conditional E-value: 0.0043
                 HHHHTSCCGGGCS-HTCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHCTS---HHHHH CS
     PF03936  95 averwdiasidelpdymkllfkalldtferieeelskdqgrsdivkylkeawkelleayleeakwaeeghvPsleeYl 172
                 +ve +d + +d+     k  ++a+  +++++ e+ s + g+ +  k + +a+ke++ +y e+a+++ e+   ++e+Y 
  AAZ22049.1   3 LVEDTDSKILDTKKVSDKEAEEAFKTILTWMGEDPSRE-GLLETPKRVVKAFKEYFGGYTEDAEKILEKTFGDVEGYD 79 
                 6676777777788888899999999*************.999999*********************999888888885 PP

>> PF11050  Virus envelope protein E26
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.6   0.0    0.0049        12     126     170 ..     111     156 ..      85     169 .. 0.84

  Alignments for each domain:
  == domain 1    score: 7.6 bits;  conditional E-value: 0.0049
     PF11050 126 rrrvaelcal.ggeqvFcarRadcarDRqrlaealaaslgsgvvvs 170
                 + rv+ l+ l    +vF++r +  +r   ++a+al +sl ++ v+ 
  AAZ22049.1 111 NERVVGLSKLaRVVEVFSKRLQTQERLTMQVAQALMTSLDAKGVAV 156
                 679999999988999************************9986654 PP

>> PF06777  Protein of unknown function (DUF1227)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.5   0.0     0.016        40      64     109 ..     118     201 ..     116     202 .] 0.77

  Alignments for each domain:
  == domain 1    score: 6.5 bits;  conditional E-value: 0.016
     PF06777  64 sflkrlieylkkrlkvtevase......................................splsflkkieeetgidkktLrfca 109
                 s+l r++e + krl+++e  +                                        ++ fl +++++  ++++ Lrf++
  AAZ22049.1 118 SKLARVVEVFSKRLQTQERLTMqvaqalmtsldakgvavtidaahqcmtmrgikkenattVTNYFLGEFKKDLSVQNRYLRFIS 201
                 6677888888888866655554556667778888888888888888888888888888778999*****************986 PP

>> PF10440  WIYLD domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.2   0.0     0.011        28      10      41 ..     157     188 ..     149     191 .. 0.87

  Alignments for each domain:
  == domain 1    score: 7.2 bits;  conditional E-value: 0.011
     PF10440  10 ridaAidrmrelGfkkevikpvikeLLevyge 41 
                  idaA + m+  G+kke++  v +  L ++ +
  AAZ22049.1 157 TIDAAHQCMTMRGIKKENATTVTNYFLGEFKK 188
                 69******************999998887766 PP

>> PF04854  Protein of unknown function, DUF624
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.1   0.0     0.025        63      29      60 ..     163     194 ..     153     200 .. 0.80

  Alignments for each domain:
  == domain 1    score: 6.1 bits;  conditional E-value: 0.025
     PF04854  29 favvrkwirkeedssllktFwsaykknfkksn 60 
                 + ++++ i+ke+ + ++  F  ++kk++   n
  AAZ22049.1 163 QCMTMRGIKKENATTVTNYFLGEFKKDLSVQN 194
                 456677788888999***********987666 PP

>> PF10898  Protein of unknown function (DUF2716)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.1   0.0     0.014        34      53      95 ..     130     172 ..     115     188 .. 0.84

  Alignments for each domain:
  == domain 1    score: 7.1 bits;  conditional E-value: 0.014
     PF10898  53 kaeayedleeevlkafllalakeevllaLDWqhecyllnPsle 95 
                 +++++e l ++v +a++++l  ++v +++D  h+c +++  ++
  AAZ22049.1 130 RLQTQERLTMQVAQALMTSLDAKGVAVTIDAAHQCMTMRGIKK 172
                 45667899****************************9987655 PP

>> PF05871  ESCRT-II complex subunit
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.0   0.0      0.46   1.1e+03      42      78 ..       2      38 ..       1      57 [. 0.81
   2 ?    4.0   0.0      0.12   2.9e+02      32     103 ..     108     178 ..      90     192 .. 0.71

  Alignments for each domain:
  == domain 1    score: 2.0 bits;  conditional E-value: 0.46
                EB-----B-TTEETTTTEE--HHHHHHHHHHHHH--- CS
     PF05871 42 svseaaesslFnnekiqrrlssesikevleelvkkgk 78
                ++ e ++s+++  +k++ + ++e++k++l+++ ++ +
  AAZ22049.1  2 KLVEDTDSKILDTKKVSDKEAEEAFKTILTWMGEDPS 38
                566778999999*******************987754 PP

  == domain 2    score: 4.0 bits;  conditional E-value: 0.12
                 HHHHTT--EEEB-----B-TTEET.TTTEE--HHHHHHHHHHHHH---EEEE-----EEEE-SS-HHHHHHHH CS
     PF05871  32 ycrhhkifelsvseaaesslFnne.kiqrrlssesikevleelvkkgkaewldkkktkalilwrtleewasli 103
                 y+ +++++ ls +     ++F+ + + q rl+ + ++ +++ l  kg a  +d +++ ++ +    +e a+ +
  AAZ22049.1 108 YIPNERVVGLSKLAR-VVEVFSKRlQTQERLTMQVAQALMTSLDAKGVAVTIDAAHQ-CMTMRGIKKENATTV 178
                 566666666663322.356676542578899****************9999976665.444444444455555 PP

>> PF09720  Putative addiction module component
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.3   0.0      0.02        49       2      30 ..     131     163 ..     130     164 .. 0.78

  Alignments for each domain:
  == domain 1    score: 6.3 bits;  conditional E-value: 0.02
     PF09720   2 LppeERl..eLveeLwdSLdse.de.eleeawk 30 
                 L ++ERl  +++++L +SLd++  + ++++a++
  AAZ22049.1 131 LQTQERLtmQVAQALMTSLDAKgVAvTIDAAHQ 163
                 67778853388**********844489999985 PP

>> PF00627  UBA/TS-N domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.4   0.0     0.021        52      17      31 ..      62      76 ..      60      84 .. 0.94

  Alignments for each domain:
  == domain 1    score: 6.4 bits;  conditional E-value: 0.021
                HHHHHHHHHTTTSHH CS
     PF00627 17 eeakkALratnnnvE 31
                e+a k L++t+++vE
  AAZ22049.1 62 EDAEKILEKTFGDVE 76
                89************9 PP

>> PF05913  Bacterial protein of unknown function (DUF871)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.8   0.0     0.013        33      39      86 ..     132     179 ..     110     195 .. 0.87

  Alignments for each domain:
  == domain 1    score: 5.8 bits;  conditional E-value: 0.013
                 ------HHHHHHH---HHHHHT---EEEE---TTTT---BTTB-HHHH CS
     PF05913  39 eddkeeylerlkeliklakelglevivDispkvlkelgisyedlselk 86 
                 +++++ +++ ++ l++ + ++g+ v++D + + ++  gi+ e++++++
  AAZ22049.1 132 QTQERLTMQVAQALMTSLDAKGVAVTIDAAHQCMTMRGIKKENATTVT 179
                 4667889999*****************************999988765 PP

>> PF06782  Uncharacterised protein family (UPF0236)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.7   0.0     0.011        27     356     384 ..     108     136 ..      47     178 .. 0.85

  Alignments for each domain:
  == domain 1    score: 5.7 bits;  conditional E-value: 0.011
     PF06782 356 yreregvrglsaeehvsevfsaRlsklal 384
                 y  +e v+gls    v+evfs+Rl+++ +
  AAZ22049.1 108 YIPNERVVGLSKLARVVEVFSKRLQTQER 136
                 55568999****************99855 PP

>> PF01454  MAGE family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.3   0.0      0.06   1.5e+02      22      48 ..      47      73 ..      43      94 .. 0.93

  Alignments for each domain:
  == domain 1    score: 4.3 bits;  conditional E-value: 0.06
                HHT-TT-GGGHHHH---HHHHHHHH-- CS
     PF01454 22 kqvlkeykrkfpevfaraqeiLeevFG 48
                k+v+k  k+ f    ++a++iLe++FG
  AAZ22049.1 47 KRVVKAFKEYFGGYTEDAEKILEKTFG 73
                789999999*****************9 PP

>> PF07454  Stage II sporulation protein P (SpoIIP)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.7   0.0     0.018        45     105     136 ..     134     165 ..     121     183 .. 0.81

  Alignments for each domain:
  == domain 1    score: 5.7 bits;  conditional E-value: 0.018
     PF07454 105 eeknvvkVgeeLaeeLekkGikvihdktvhdl 136
                 +e+  ++V+++L  +L+ kG+ v+ d   + +
  AAZ22049.1 134 QERLTMQVAQALMTSLDAKGVAVTIDAAHQCM 165
                 5566789*****************99887665 PP

>> PF03243  Alkylmercury lyase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.3   0.0      0.73   1.8e+03      31      50 ..      82     101 ..      78     120 .. 0.80
   2 ?    3.8   0.0      0.13   3.2e+02      32      78 ..     120     166 ..     115     173 .. 0.86

  Alignments for each domain:
  == domain 1    score: 1.3 bits;  conditional E-value: 0.73
     PF03243  31 llgrdakvesrcpatgepir 50 
                 +++++++v+s+c +   pi 
  AAZ22049.1  82 VVEKNISVSSHCEHHMAPIV 101
                 56899********9999985 PP

  == domain 2    score: 3.8 bits;  conditional E-value: 0.13
     PF03243  32 lgrdakvesrcpatgepirltvdpnelvevePatavvslvepdssas 78 
                 l r ++v s+  +t+e  +++v +  +++++ + + v + +++++  
  AAZ22049.1 120 LARVVEVFSKRLQTQERLTMQVAQALMTSLDAKGVAVTIDAAHQCMT 166
                 56789999***************9999**999999999988777654 PP

>> PF04778  LMP repeated region
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.5   0.0     0.072   1.8e+02       8      34 ..       3      29 ..       1      74 [. 0.92

  Alignments for each domain:
  == domain 1    score: 4.5 bits;  conditional E-value: 0.072
     PF04778  8 kltdkdkeiqkaktelekeiqkanqav 34
                 + d d++i + k+  +ke ++a +++
  AAZ22049.1  3 LVEDTDSKILDTKKVSDKEAEEAFKTI 29
                5689****************9998876 PP

>> PF02885  Glycosyl transferase family, helical bundle domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.5   0.0     0.066   1.6e+02       7      28 ..       9      30 ..       5      32 .. 0.92

  Alignments for each domain:
  == domain 1    score: 4.5 bits;  conditional E-value: 0.066
                HHHHTT----HHHHHHHHHHHH CS
     PF02885  7 kkllagedLsseeaeeamdail 28
                +k+l+ ++ s  eaeea++ il
  AAZ22049.1  9 SKILDTKKVSDKEAEEAFKTIL 30
                599999************9998 PP

>> PF04093  rod shape-determining protein MreD
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.0   0.0     0.026        66      77     129 ..     115     167 ..     112     183 .. 0.87

  Alignments for each domain:
  == domain 1    score: 6.0 bits;  conditional E-value: 0.026
     PF04093  77 lvlslilylvaklqkvlrlnrrflpavlqvlllellvlvialliglaeldlig 129
                 ++ls ++ +v+++ k+l++++r+++ v+q+l+  l   ++a+ i  a++ +++
  AAZ22049.1 115 VGLSKLARVVEVFSKRLQTQERLTMQVAQALMTSLDAKGVAVTIDAAHQCMTM 167
                 677888889**********99*************9999999999999886655 PP

>> PF02754  Cysteine-rich domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.5   0.0       1.6   3.9e+03      24      62 ..      57      96 ..      50      98 .. 0.69
   2 ?    3.5   0.0      0.17   4.3e+02      26      62 ..     133     167 ..     127     169 .. 0.85

  Alignments for each domain:
  == domain 1    score: 0.5 bits;  conditional E-value: 1.6
     PF02754 24 rsgnkeedlfqelgkenvesle...etgadkivttCpgClnq 62
                + g+  +++++++ ++    +e   ++ ++k ++ +++C  +
  AAZ22049.1 57 FGGY--TEDAEKILEKTFGDVEgydDMVVEKNISVSSHCEHH 96
                5566..666666666666666655566777778889999876 PP

  == domain 2    score: 3.5 bits;  conditional E-value: 0.17
     PF02754  26 gnkeedlfqelgkenvesleetgadkivttCpgClnq 62 
                  +  e l++++++  + sl+++g+ + + ++  C ++
  AAZ22049.1 133 TQ--ERLTMQVAQALMTSLDAKGVAVTIDAAHQCMTM 167
                 45..899999**************9999999999876 PP

>> PF00626  Gelsolin repeat
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.1   0.0     0.047   1.2e+02      19      40 ..       8      40 ..       2      41 .. 0.80

  Alignments for each domain:
  == domain 1    score: 5.1 bits;  conditional E-value: 0.047
                SEEEEEESS...........EEEEEEH--HHHH CS
     PF00626 19 dvyLLdtgf...........tiylWiGkgssqe 40
                d+ +Ldt +           ti  W+G+++s+e
  AAZ22049.1  8 DSKILDTKKvsdkeaeeafkTILTWMGEDPSRE 40
                55578888888888888888*********9986 PP

>> PF02981  Restriction endonuclease FokI, recognition domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.9   0.0     0.046   1.2e+02      20      57 ..     116     153 ..     110     172 .. 0.86

  Alignments for each domain:
  == domain 1    score: 4.9 bits;  conditional E-value: 0.046
                 -HHHHHHHHHTT-TTSHHHHHHHHTHHHHH--SHHHHH CS
     PF02981  20 dlkeLvkvvsifdedskvhkelkdtkieelvkeldlrk 57 
                  l +L +vv++f +  +  + l+ ++ ++l++ ld + 
  AAZ22049.1 116 GLSKLARVVEVFSKRLQTQERLTMQVAQALMTSLDAKG 153
                 5789**********************999999988765 PP

>> PF11018  Pupal cuticle protein C1
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.9   0.0     0.067   1.7e+02     138     160 ..      92     114 ..      75     121 .. 0.78

  Alignments for each domain:
  == domain 1    score: 4.9 bits;  conditional E-value: 0.067
     PF11018 138 avyahaApvvaaatvaYspAaav 160
                 +  +h Ap+v++a vaY p + v
  AAZ22049.1  92 HCEHHMAPIVGTAHVAYIPNERV 114
                 567899***********999887 PP

>> PF06946  Phage holin
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.3   0.0     0.058   1.5e+02      31      64 ..     126     159 ..     113     188 .. 0.84

  Alignments for each domain:
  == domain 1    score: 5.3 bits;  conditional E-value: 0.058
     PF06946  31 vpskwlptvsilvgailgalatsldgsgslatmi 64 
                 v sk l t   l   +  al tsld  g   t+ 
  AAZ22049.1 126 VFSKRLQTQERLTMQVAQALMTSLDAKGVAVTID 159
                 6799999********************9877764 PP

>> PF08879  WRC
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.8   0.1     0.057   1.4e+02      25      33 ..      90      98 ..      84     102 .. 0.85

  Alignments for each domain:
  == domain 1    score: 4.8 bits;  conditional E-value: 0.057
     PF08879 25 kklCEkHlh 33
                +++CE+H++
  AAZ22049.1 90 SSHCEHHMA 98
                689****97 PP

>> PF03190  Protein of unknown function, DUF255
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.3   0.0     0.076   1.9e+02     119     162 ..     106     149 ..      86     150 .. 0.79

  Alignments for each domain:
  == domain 1    score: 4.3 bits;  conditional E-value: 0.076
     PF03190 119 gtYfpkeeragapgflevlekiaeaweeerekleeeaeelleal 162
                  +Y+p+e+  g   + +v+e  ++  ++++    + a++l+++l
  AAZ22049.1 106 VAYIPNERVVGLSKLARVVEVFSKRLQTQERLTMQVAQALMTSL 149
                 4799999999***********99999999888888888887766 PP

>> PF06727  Protein of unknown function (DUF1207)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.3   0.0     0.078     2e+02     301     325 ..      45      69 ..      37      72 .. 0.83

  Alignments for each domain:
  == domain 1    score: 3.3 bits;  conditional E-value: 0.078
     PF06727 301 aigRklrlllEYfdGfSkeGqFvre 325
                 +++R+++++ EYf G+ ++   + e
  AAZ22049.1  45 TPKRVVKAFKEYFGGYTEDAEKILE 69 
                 678*************998766665 PP

>> PF05650  Domain of unknown function (DUF802)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.9   0.1     0.074   1.9e+02      18      40 ..     129     151 ..     120     157 .. 0.78

  Alignments for each domain:
  == domain 1    score: 4.9 bits;  conditional E-value: 0.074
     PF05650  18 eALaeQqraqeaLaqqLraaLeq 40 
                 + L+ Q+r +  +aq+L ++L++
  AAZ22049.1 129 KRLQTQERLTMQVAQALMTSLDA 151
                 55889999999999999999876 PP

>> PF02574  Homocysteine S-methyltransferase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.9   0.1      0.14   3.5e+02     193     238 ..     132     177 ..     122     184 .. 0.85

  Alignments for each domain:
  == domain 1    score: 2.9 bits;  conditional E-value: 0.14
                 ------------HHHHHH--.--EE-EESSS-HHHHHHHHHHHH-- CS
     PF02574 193 gtgleeagaiieaalnsvqaeivavGvNCalgakeadeilellklt 238
                 +t  ++ +++++a+++s+ a+ vav +  a++  +++ i+++  +t
  AAZ22049.1 132 QTQERLTMQVAQALMTSLDAKGVAVTIDAAHQCMTMRGIKKENATT 177
                 567778899*********9999****************99998775 PP

>> PF09329  Primase zinc finger
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.5   0.0      0.14   3.5e+02      24      35 ..      86      97 ..      81     100 .. 0.87

  Alignments for each domain:
  == domain 1    score: 3.5 bits;  conditional E-value: 0.14
                -TTT-SS-TTTH CS
     PF09329 24 nkrktelCeyHv 35
                n++ +++Ce+H 
  AAZ22049.1 86 NISVSSHCEHHM 97
                679999*****5 PP

>> PF04393  Protein of unknown function (DUF535)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.4   0.1      0.16   3.9e+02     186     231 ..     136     181 ..     133     182 .. 0.83

  Alignments for each domain:
  == domain 1    score: 2.4 bits;  conditional E-value: 0.16
     PF04393 186 rLlvealklLaealgveeilavsnkahvysrlrylkkkkkklladY 231
                 rL ++++++L+ +l+++ +    ++ah     r +kk + + +++Y
  AAZ22049.1 136 RLTMQVAQALMTSLDAKGVAVTIDAAHQCMTMRGIKKENATTVTNY 181
                 899*************987666688888888888777788888888 PP

>> PF01404  Ephrin receptor ligand binding domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.9   0.1      0.21   5.3e+02     126     172 ..     125     171 ..     103     175 .. 0.81

  Alignments for each domain:
  == domain 1    score: 2.9 bits;  conditional E-value: 0.21
                 S-B-GHHHHTT-EEEEEEEEEE-E------EEEEEE---EEEEEEEE CS
     PF01404 126 esftesdlgsrvvklnvevrslgplskkgvylAfqdkGaClallsvr 172
                 e f+++  +++ +++ v +  +  l  kgv + +     C+++  ++
  AAZ22049.1 125 EVFSKRLQTQERLTMQVAQALMTSLDAKGVAVTIDAAHQCMTMRGIK 171
                 44556556667799999999999******************997775 PP

>> PF01627  Hpt domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.9   0.1      0.29   7.4e+02      45      77 ..     114     146 ..     113     162 .. 0.74

  Alignments for each domain:
  == domain 1    score: 2.9 bits;  conditional E-value: 0.29
                 T---HHHHHHHHHHHHHHHCCHTTSSHHHHHHH CS
     PF01627  45 mlGltalaelahelEqllkagrdgeldlllqal 77 
                  +Gl +la++ + + + l+ +++ ++++++ ++
  AAZ22049.1 114 VVGLSKLARVVEVFSKRLQTQERLTMQVAQALM 146
                 689999999999999999999998853333332 PP

>> PF03911  Sec61beta family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.5   0.1       1.4   3.5e+03       9      16 ..      60      67 ..      60      67 .. 0.94

  Alignments for each domain:
  == domain 1    score: 0.5 bits;  conditional E-value: 1.4
     PF03911  9 YeeeaeGl 16
                Y+e+ae++
  AAZ22049.1 60 YTEDAEKI 67
                9*****97 PP



Internal pipeline statistics summary:
-------------------------------------
Query sequence(s):                         1  (202 residues)
Target model(s):                       11912  (2158902 nodes)
Passed MSV filter:                       620  (0.0520484); expected 238.2 (0.02)
Passed bias filter:                      459  (0.0385326); expected 238.2 (0.02)
Passed Vit filter:                        40  (0.00335796); expected 11.9 (0.001)
Passed Fwd filter:                        40  (0.00335796); expected 0.1 (1e-05)
Initial search space (Z):             100000  [as set by --Z on cmdline]
Domain search space  (domZ):              40  [number of targets reported over threshold]
# CPU time: 0.21u 0.04s 00:00:00.25 Elapsed: 00:00:01
# Mc/sec: 2076.66
//