# hmmscan :: search sequence(s) against a profile HMM database
# HMMER 3.0b2 (June 2009); http://hmmer.org/
# Copyright (C) 2009 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query sequence file:             /home/niguts/usr08/shisakam/FASTA/gib_22949.fasta
# target HMM database:             /home/niguts/usr08/shisakam/PFAM/ver24.0/Pfam-A.hmm
# sequence search space set to:    100000
# set reporting thresholds to:     GA cutoffs
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       AAZ22091.1  [L=388]
Description: pubi0 AAZ22091.1 GIB00256CH01 "iron-containing alcohol dehydrogenase"
Scores for complete sequence (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Model    Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
   3.8e-101  341.0   0.0   4.3e-101  340.8   0.0    1.0  1  PF00465  Iron-containing alcohol dehydrogenase
     0.0021   19.7   2.1       0.23   13.0   0.0    2.2  2  PF01761  3-dehydroquinate synthase
  ------ inclusion threshold ------
         11    8.8   0.1         77    6.1   0.0    2.1  1  PF12327  FtsZ family, C-terminal domain
         17    8.3   0.1         62    6.5   0.0    1.8  1  PF00929  Exonuclease
         20    8.3   0.0         53    6.9   0.0    1.7  1  PF02302  PTS system, Lactose/Cellobiose specific IIB subunit
         27    4.9   0.0         33    4.6   0.0    1.1  1  PF04257  Exodeoxyribonuclease V, gamma subunit
         28    7.0   0.0         51    6.1   0.0    1.4  1  PF02425  Paralytic/GBP/PSP peptide
         32    7.4   0.0         75    6.3   0.0    1.6  1  PF02874  ATP synthase alpha/beta family, beta-barrel domain
         40    6.6   0.2    1.2e+02    5.2   0.1    1.8  1  PF00608  Adenoviral fibre protein (repeat/shaft region)
         46    6.3   0.0         94    5.3   0.0    1.5  1  PF05192  MutS domain III
         48    6.4   0.1         95    5.4   0.0    1.5  1  PF00673  ribosomal L5P family C-terminus
         79    5.8   0.0      2e+02    4.5   0.0    1.6  1  PF11617  Protein metal binding site
         87    5.4   0.2    1.6e+02    4.6   0.1    1.4  1  PF10348  Domain of unknown function (DUF2427)
    1.4e+02    4.5   0.0    2.3e+02    3.8   0.0    1.2  1  PF09328  Domain of unknown function (DUF1984)
    2.1e+02    3.4   0.0    3.1e+02    2.8   0.0    1.2  1  PF06340  Vibrio cholerae toxin co-regulated pilus biosynthes
    2.3e+02    4.3   0.4    5.9e+02    3.0   0.3    1.7  1  PF05184  Saposin-like type B, region 1
    2.7e+02    4.2   0.4    7.7e+02    2.8   0.1    1.8  1  PF08136  30S ribosomal protein subunit S22 family
    4.4e+02    3.1   0.0    8.5e+02    2.2   0.0    1.4  1  PF03035  Calicivirus putative RNA polymerase/capsid protein
    4.5e+02    3.6   0.6    1.4e+03    2.0   0.4    1.8  1  PF08108  Halocidin family
    1.2e+03    2.2   0.2    2.3e+03    1.3   0.2    1.4  1  PF03183  Borrelia repeat protein


Domain and alignment annotation for each model:
>> PF00465  Iron-containing alcohol dehydrogenase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  340.8   0.0  8.6e-105  4.3e-101       1     365 []       9     374 ..       9     374 .. 0.94

  Alignments for each domain:
  == domain 1    score: 340.8 bits;  conditional E-value: 8.6e-105
                 -SEEEE---GGGGHHHHHTTT..SEEEEEEEHHHHHTHHHHHHH...HC---EEEEEE.E-----HHHHHHHHTTS-T.T--EEE------HHHHHHHH CS
     PF00465   1 Ptkivfgkgaleelgeelkkl..gkvlivtdkslkklglldkvlesLkeagievtvfdgvepeptleeveeaaalareekadvivAvGGGsviDtAKai 97 
                 Pt++++g++ ++++ + +k+l  +k+l+vtd++l+++ +++++l+ Lke gi  +++++v ++pt ++v+e+a+ ++++++d+++A+GGGs +D++Ka+
  AAZ22091.1   9 PTTMWVGENRINDVASACKNLniKKPLLVTDNGLAQSVIVKNTLSILKEGGIIAALYSNVVGNPTGTNVNEGADYYKKNNCDGVIAFGGGSGLDVGKAV 107
                 899******************555*************************************************************************** PP

                 HHHTT.......................--BEE--SS-S-S-TT-SEEEEE-----EE.EEEE-S.--SEEE--HHHHHHS-HHHHH-----HHHHHHH CS
     PF00465  98 allltnpgelldye....gkakkkkkpalpliaiPTtaGtGsevtplavitdeegkrklsiaspkllPdlaivDpeltltlPkrvtaatglDalthalE 192
                 a++ +++  ++d+e    +  k+++ + +p+ia+PTtaGtGse+ +++vi +ee+++k  i++pk+lP+++i+Dp lt++lP+++taatg+Dal+h lE
  AAZ22091.1 108 AFMSGQNLPIWDFEdvgdNWTKANSDKIAPIIAVPTTAGTGSETGRASVILNEETGVKNIIFHPKFLPSIVILDPILTVGLPAKMTAATGMDALAHNLE 206
                 *****554488888888856666677789********************************************************************** PP

                 HHHH-----HHHHHHHHHHHHHHH.HH----HHHHHH.HHHHTT....-----------HHHHHH---G-GGGS----TTT--HHHHH........... CS
     PF00465 193 ayvskkanplsdalaeealrliaenlpravadpedleareqmllastlAGlafsnaglgaaHalahalgglfgipHGeavaillpavlrfnaaaapery 291
                 ay++++ +p+ d +a+e++rli ++l +av++++++ear +ml a++++  af++ glga+H+l+h++ +l +i+HG+++ai++p+vl fn +  ++++
  AAZ22091.1 207 AYCAPGYHPMADGIALEGMRLIDKWLLEAVSNGSNIEARMNMLTAASMGSTAFQK-GLGAIHSLSHPVNALNNIHHGLSNAIFMPYVLTFNKDVIENKI 304
                 *****************************************************65.6****************************************** PP

                 .................HTTHHHHHHHHHHHHTT---STTT-.--TTHHHHH----TT-T..TSGSSS---HHHH CS
     PF00465 292 arlaralgvdegsdeealaeeliealrellkelglptsLkdl.gvteedldelaeaalkdqrlannprpltkedv 365
                  +++++l+++     + + + +++++ +l k+l++p +L+++   ++ d+d+l + al+d+++ +np++lt++d+
  AAZ22091.1 305 IKICDYLELK-----DRSFDGFVNWVLDLRKKLDMPHKLSEViDEKDFDIDRLSKMALADPSTGGNPKKLTEDDM 374
                 *****99666.....334679********************63444588***********9999********996 PP

>> PF01761  3-dehydroquinate synthase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   13.0   0.0   4.6e-05      0.23       1     107 [.      14     113 ..      14     116 .. 0.75
   2 !    6.2   0.2    0.0054        27     108     266 ..     137     296 ..     134     348 .. 0.72

  Alignments for each domain:
  == domain 1    score: 13.0 bits;  conditional E-value: 4.6e-05
                 CHHHCGGGCGGTTTTTSSCEEEEEEEECCGTCCHHHHHHHHHHHTTSEEEEEEE----TTSSHHHHHHHHHHHHHST--TTEEEEEE----CCCHHHHH CS
     PF01761   1 igeglleklsellkellkgkklvvvtdenvaklygekveellkeagievevlvlpegealktletleklldalleagltrksvlialGGGvigDlagfa 99 
                 +ge+ ++++++ +k+l+ +k+l+v+ +   +++++++  + lke gi + ++    g+ + t  +  +  d+  +++    + +ia GGG  +D+ + +
  AAZ22091.1  14 VGENRINDVASACKNLNIKKPLLVTDNGLAQSVIVKNTLSILKEGGIIAALYSNVVGNPTGTNVN--EGADYYKKNN---CDGVIAFGGGSGLDVGKAV 107
                 68999999999999877777777765555667889999999999888887775555554444333..3346666666...789**************** PP

                 HHHTTHT- CS
     PF01761 100 AatylrGv 107
                 A  ++ G 
  AAZ22091.1 108 A--FMSGQ 113
                 *..99986 PP

  == domain 2    score: 6.2 bits;  conditional E-value: 0.0054
                 EEEE--SSHHHHHTTTSSSCEEEBE-...---EEEEEE-.--SEEEEEHHHHCCS-HHHHH---HHHH..HHHHCHHHHHHHHCCCCCHHHHHHHTTHH CS
     PF01761 108 rfiqvPTtllaqvDssvGgktainlp...egknligafa.qPkaVliDldvLktlperelraGlaEvi..Kyglikdaelfelleeeeeaelaakrdee 200
                 ++i+vPTt+      s +g  +++l+   + kn+i+  +  P+ V+ D+ +   lp+++ +a   +++  +  +     +  +  + + + +++   ++
  AAZ22091.1 137 PIIAVPTTAGT---GSETGRASVILNeetGVKNIIFHPKfLPSIVILDPILTVGLPAKMTAATGMDALahNLEAYCAPGYHPMADGIALEGMRL--IDK 230
                 7899****999...777888777655111579999876537*********999****9988766666547888888888888888888888776..677 PP

                 HHHHHHHH..HHHHHHHHHHHTTTSS--GGG...GG-HHHHHHHHHHHTTT.TS----TTT-HHHHHHHHH CS
     PF01761 201 aleelikr..sieskaavvaaDekegglral...lnlgHtfgHalEallgygkllHGeaVaiGmvlaakls 266
                  l e++ +  +ie++++++ a     g+ a+   l++ H+++H + al    ++ HG   ai m + + + 
  AAZ22091.1 231 WLLEAVSNgsNIEARMNMLTA--ASMGSTAFqkgLGAIHSLSHPVNALN---NIHHGLSNAIFMPYVLTFN 296
                 777777541156666666666..55555555555999999999999864...5699987777666665555 PP

>> PF12327  FtsZ family, C-terminal domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.1   0.0     0.015        77       4      43 ..      11      50 ..       9      55 .. 0.91

  Alignments for each domain:
  == domain 1    score: 6.1 bits;  conditional E-value: 0.015
                B-----B----HHHHHHHHHHTSGGGT---------EEEE CS
     PF12327  4 mmgvGeasgedraeeaaeaaisspLLdvdlsgAkgvlvni 43
                 m vGe + +d a++  +  i++pLL +d   A++v+v+ 
  AAZ22091.1 11 TMWVGENRINDVASACKNLNIKKPLLVTDNGLAQSVIVKN 50
                588999999999*999********************9975 PP

>> PF00929  Exonuclease
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.5   0.0     0.012        62      89     147 ..     282     336 ..     258     339 .. 0.85

  Alignments for each domain:
  == domain 1    score: 6.5 bits;  conditional E-value: 0.012
                 ETTHHHCEHHHHHHHHHHHHHHCHHHHHCSECHHHHHHHHHHHHHHCHHHHHHHTTHHH CS
     PF00929  89 ahnaafdvgfllqddlrflklempkrndvldtlildkktlkelkrtslkklaeklllee 147
                 + ++a+++  +l  ++ ++ +   k+ +++d+l+l   ++ ++ + +  +l++kl++++
  AAZ22091.1 282 GLSNAIFMPYVLTFNKDVIEN---KIIKICDYLELKDRSFDGFVN-WVLDLRKKLDMPH 336
                 445678888888888888777...899*****************9.9999****99987 PP

>> PF02302  PTS system, Lactose/Cellobiose specific IIB subunit
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.9   0.0     0.011        53       3      49 ..      35      90 ..      33      95 .. 0.62

  Alignments for each domain:
  == domain 1    score: 6.9 bits;  conditional E-value: 0.011
     PF02302  3 llvCgaGmstSlmaaeklekaakelg......ieaegeaga....eleaeeiaddaD 49
                llv  +G++ S+++ ++  +++ke g       +++g+ +     e+ ++ +++++D
  AAZ22091.1 35 LLVTDNGLAQSVIV-KNTLSILKEGGiiaalySNVVGNPTGtnvnEGADYYKKNNCD 90
                78999*********.99999******6444332222222222223444444444455 PP

>> PF04257  Exodeoxyribonuclease V, gamma subunit
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.6   0.0    0.0065        33      15      85 ..     199     272 ..     193     344 .. 0.76

  Alignments for each domain:
  == domain 1    score: 4.6 bits;  conditional E-value: 0.0065
     PF04257  15 dlLakllrs..qpladpfeketilvqspgmaqwLklelAernGIaanirfplpasflwqllravlgdvpees.p 85 
                 d+La++l++   p  +p++  + l   + + +wL +++++ ++I a++ + + as+  +++++ lg + + s p
  AAZ22091.1 199 DALAHNLEAycAPGYHPMADGIALEGMRLIDKWLLEAVSNGSNIEARMNMLTAASMGSTAFQKGLGAIHSLShP 272
                 45556666555688899999999999999************************************995543323 PP

>> PF02425  Paralytic/GBP/PSP peptide
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.1   0.0      0.01        51       7      17 ..     209     219 ..     204     220 .. 0.92

  Alignments for each domain:
  == domain 1    score: 6.1 bits;  conditional E-value: 0.01
                 -----EE---- CS
     PF02425   7 CipGYlRTADG 17 
                 C+pGY   ADG
  AAZ22091.1 209 CAPGYHPMADG 219
                 **********9 PP

>> PF02874  ATP synthase alpha/beta family, beta-barrel domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.3   0.0     0.015        75      49      66 ..      91     108 ..      86     110 .. 0.87

  Alignments for each domain:
  == domain 1    score: 6.3 bits;  conditional E-value: 0.015
                 EEEEB---TT-B----EE CS
     PF02874  49 riiamgstdGlkrGdeVk 66 
                 ++ia+g+ +Gl++G  V 
  AAZ22091.1  91 GVIAFGGGSGLDVGKAVA 108
                 79************9996 PP

>> PF00608  Adenoviral fibre protein (repeat/shaft region)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.2   0.1     0.023   1.2e+02       5      20 ..      28      43 ..      28      45 .. 0.93

  Alignments for each domain:
  == domain 1    score: 5.2 bits;  conditional E-value: 0.023
                E-------EE----EE CS
     PF00608  5 slntgpGLtvtnnaLa 20
                +ln+  +L vt+n La
  AAZ22091.1 28 NLNIKKPLLVTDNGLA 43
                69***********997 PP

>> PF05192  MutS domain III
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.3   0.0     0.019        94      41      67 ..     224     250 ..     219     261 .. 0.92

  Alignments for each domain:
  == domain 1    score: 5.3 bits;  conditional E-value: 0.019
                 --HHHHHHHHS-B--HHHHHHHHHHHH CS
                 xxxxxxxxxxxxxxxxxxxxxxxxxxx RF
     PF05192  41 GkRlLrrwllqPlrdreeIeaRldaVe 67 
                 G+Rl+ +wll+ + + ++IeaR ++++
  AAZ22091.1 224 GMRLIDKWLLEAVSNGSNIEARMNMLT 250
                 9**********************9976 PP

>> PF00673  ribosomal L5P family C-terminus
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.4   0.0     0.019        95      15      57 ..     294     336 ..     288     349 .. 0.86

  Alignments for each domain:
  == domain 1    score: 5.4 bits;  conditional E-value: 0.019
                 HHHHHHHH---TT-TT------S-------EEE---SSTTSSS CS
     PF00673  15 efLekllkvvlprirdfrglskksfDksGnfsfGikeqiifpe 57 
                 +f + +++  + +i d  +l+ +sfD+  n  + ++  +++p 
  AAZ22091.1 294 TFNKDVIENKIIKICDYLELKDRSFDGFVNWVLDLRKKLDMPH 336
                 677788888889999*****************99999999875 PP

>> PF11617  Protein metal binding site
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.5   0.0      0.04     2e+02      22      28 ..      87      93 ..      84      95 .. 0.92

  Alignments for each domain:
  == domain 1    score: 4.5 bits;  conditional E-value: 0.04
     PF11617 22 nnCDGqv 28
                nnCDG++
  AAZ22091.1 87 NNCDGVI 93
                9****97 PP

>> PF10348  Domain of unknown function (DUF2427)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.6   0.1     0.032   1.6e+02      64      96 ..     263     295 ..     240     302 .. 0.78

  Alignments for each domain:
  == domain 1    score: 4.6 bits;  conditional E-value: 0.032
     PF10348  64 lgiiykastPdlypnnahaklgwillllllvqv 96 
                 lg+i++ s P    nn+h+ l++++++  ++++
  AAZ22091.1 263 LGAIHSLSHPVNALNNIHHGLSNAIFMPYVLTF 295
                 68899999998777**********998777665 PP

>> PF09328  Domain of unknown function (DUF1984)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.8   0.0     0.046   2.3e+02      55      77 ..     318     340 ..     301     351 .. 0.87

  Alignments for each domain:
  == domain 1    score: 3.8 bits;  conditional E-value: 0.046
     PF09328  55 laefikwvaevrrqeegesklsk 77 
                 +  f++wv ++r++ +  +kls+
  AAZ22091.1 318 FDGFVNWVLDLRKKLDMPHKLSE 340
                 778*****************997 PP

>> PF06340  Vibrio cholerae toxin co-regulated pilus biosynthesis protein F
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.8   0.0     0.062   3.1e+02     163     200 ..      15      52 ..       2      69 .. 0.86

  Alignments for each domain:
  == domain 1    score: 2.8 bits;  conditional E-value: 0.062
     PF06340 163 geykivkvGnvadsspvkLPaivskrgLvGtalvvnal 200
                 ge +i  v +  ++ ++k P +v+ +gL  +  v n+l
  AAZ22091.1  15 GENRINDVASACKNLNIKKPLLVTDNGLAQSVIVKNTL 52 
                 7788999*********************9998888776 PP

>> PF05184  Saposin-like type B, region 1
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.0   0.3      0.12   5.9e+02      24      38 ..     297     311 ..     295     312 .. 0.90

  Alignments for each domain:
  == domain 1    score: 3.0 bits;  conditional E-value: 0.12
     PF05184  24 eeeIikaldkvCell 38 
                 ++ I++ + k+C++l
  AAZ22091.1 297 KDVIENKIIKICDYL 311
                 789**********97 PP

>> PF08136  30S ribosomal protein subunit S22 family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.8   0.1      0.15   7.7e+02      30      39 ..      66      75 ..      60      82 .. 0.89

  Alignments for each domain:
  == domain 1    score: 2.8 bits;  conditional E-value: 0.15
     PF08136 30 ssvvnnPtGR 39
                s vv nPtG 
  AAZ22091.1 66 SNVVGNPTGT 75
                89******95 PP

>> PF03035  Calicivirus putative RNA polymerase/capsid protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.2   0.0      0.17   8.5e+02       4      28 ..      59      83 ..      57      88 .. 0.88

  Alignments for each domain:
  == domain 1    score: 2.2 bits;  conditional E-value: 0.17
     PF03035  4 allaglagdvlgsavgslinagana 28
                 ++a+l ++v+g+  g+ +n ga+ 
  AAZ22091.1 59 GIIAALYSNVVGNPTGTNVNEGADY 83
                69********************985 PP

>> PF08108  Halocidin family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.0   0.4      0.29   1.4e+03       3       7 ..     279     283 ..     277     286 .. 0.83

  Alignments for each domain:
  == domain 1    score: 2.0 bits;  conditional E-value: 0.29
     PF08108   3 LHHGL 7  
                  HHGL
  AAZ22091.1 279 IHHGL 283
                 5***9 PP

>> PF03183  Borrelia repeat protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.3   0.2      0.45   2.3e+03       1       6 [.      51      56 ..      51      56 .. 0.91

  Alignments for each domain:
  == domain 1    score: 1.3 bits;  conditional E-value: 0.45
     PF03183  1 TlSILl 6 
                TlSIL+
  AAZ22091.1 51 TLSILK 56
                9****6 PP



Internal pipeline statistics summary:
-------------------------------------
Query sequence(s):                         1  (388 residues)
Target model(s):                       11912  (2158902 nodes)
Passed MSV filter:                       284  (0.0238415); expected 238.2 (0.02)
Passed bias filter:                      256  (0.0214909); expected 238.2 (0.02)
Passed Vit filter:                        20  (0.00167898); expected 11.9 (0.001)
Passed Fwd filter:                        20  (0.00167898); expected 0.1 (1e-05)
Initial search space (Z):             100000  [as set by --Z on cmdline]
Domain search space  (domZ):              20  [number of targets reported over threshold]
# CPU time: 0.26u 0.04s 00:00:00.30 Elapsed: 00:00:00
# Mc/sec: 3221.75
//